Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_55.2210649547123630.0
Sklu_2316.348744612531e-169
KLLA0E02134g53945111241e-149
YGR197C (SNG1)54743711201e-148
CAGL0G09273g54543310651e-140
YJR015W51046610181e-133
Scas_617.35414609801e-127
CAGL0B03949g6324499621e-124
Scas_647.94494099341e-122
CAGL0B03971g5434918531e-108
ADL193C4654358211e-105
Scas_434.13572654216e-47
Scas_617.0d46381361e-10
KLLA0A03905g155042740.59
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_55.22106
         (488 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_55.22106                                                         914   0.0  
Sklu_2316.3 , Contig c2316 10494-11957 reverse complement             487   e-169
KLLA0E02134g complement(200436..202055) similar to sp|P46950 Sac...   437   e-149
YGR197C (SNG1) [2147] chr7 complement(892500..894143) Probable t...   436   e-148
CAGL0G09273g 885374..887011 similar to sp|P46950 Saccharomyces c...   414   e-140
YJR015W (YJR015W) [2918] chr10 (462635..464167) Protein with sim...   396   e-133
Scas_617.3                                                            382   e-127
CAGL0B03949g complement(387861..389759) similar to sp|P46950 Sac...   375   e-124
Scas_647.9                                                            364   e-122
CAGL0B03971g complement(390700..392331) similar to sp|P47090 Sac...   333   e-108
ADL193C [1548] [Homologous to ScYGR197C (SNG1) - NSH] (357909..3...   320   e-105
Scas_434.1                                                            166   6e-47
Scas_617.0d                                                            57   1e-10
KLLA0A03905g complement(345818..350470) similar to sp|P19524 Sac...    33   0.59 

>Kwal_55.22106
          Length = 495

 Score =  914 bits (2363), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 446/471 (94%), Positives = 446/471 (94%)

Query: 18  HAGFARAIVXXXXXXXXXXXRGYKELDPENEAGATEGELRRVESKLSRVVTGFFSDRVKG 77
           HAGFARAIV           RGYKELDPENEAGATEGELRRVESKLSRVVTGFFSDRVKG
Sbjct: 18  HAGFARAIVGEGSEEGSSGERGYKELDPENEAGATEGELRRVESKLSRVVTGFFSDRVKG 77

Query: 78  ERRKLIMRFLLNHFLLAMLIMSVFSLYWGATYQRSKHMHKVKILAVVQDEPGTGTGIASS 137
           ERRKLIMRFLLNHFLLAMLIMSVFSLYWGATYQRSKHMHKVKILAVVQDEPGTGTGIASS
Sbjct: 78  ERRKLIMRFLLNHFLLAMLIMSVFSLYWGATYQRSKHMHKVKILAVVQDEPGTGTGIASS 137

Query: 138 IPTLAEQAPGTWHVYNTSSFQQKYGVAQDEVDAKIQQLVHDQKYWVSLNVKPNATSTLIE 197
           IPTLAEQAPGTWHVYNTSSFQQKYGVAQDEVDAKIQQLVHDQKYWVSLNVKPNATSTLIE
Sbjct: 138 IPTLAEQAPGTWHVYNTSSFQQKYGVAQDEVDAKIQQLVHDQKYWVSLNVKPNATSTLIE 197

Query: 198 SLQNSRASPFNSSAFFELFYESGRDPTNLKSSILPIALSLESRYQNIYASTILPGILSNI 257
           SLQNSRASPFNSSAFFELFYESGRDPTNLKSSILPIALSLESRYQNIYASTILPGILSNI
Sbjct: 198 SLQNSRASPFNSSAFFELFYESGRDPTNLKSSILPIALSLESRYQNIYASTILPGILSNI 257

Query: 258 TQRVGDVSRNVAMAGNMVFAQVDNRPFNDYVLLGPLQVGLIYCILLTFFQLALFGPIHAL 317
           TQRVGDVSRNVAMAGNMVFAQVDNRPFNDYVLLGPLQVGLIYCILLTFFQLALFGPIHAL
Sbjct: 258 TQRVGDVSRNVAMAGNMVFAQVDNRPFNDYVLLGPLQVGLIYCILLTFFQLALFGPIHAL 317

Query: 318 LGQKLKPVHMLLYRYVIAFVNYXXXXXXXXXXXXXXQVDFTKAFGRAGFMVAWMSSWLLM 377
           LGQKLKPVHMLLYRYVIAFVNY              QVDFTKAFGRAGFMVAWMSSWLLM
Sbjct: 318 LGQKLKPVHMLLYRYVIAFVNYFFLSLFFCLVSLAFQVDFTKAFGRAGFMVAWMSSWLLM 377

Query: 378 AAVGGANENMLTIIMAFGPQYLGFWLIFWVVLNISPAFYPMELTHNFYRYGYMTPIYNGV 437
           AAVGGANENMLTIIMAFGPQYLGFWLIFWVVLNISPAFYPMELTHNFYRYGYMTPIYNGV
Sbjct: 378 AAVGGANENMLTIIMAFGPQYLGFWLIFWVVLNISPAFYPMELTHNFYRYGYMTPIYNGV 437

Query: 438 GIFRVTFLDLYRGHLGRNYGILCAWIVLNMAIFPFVMKLFVYVKKREAMKA 488
           GIFRVTFLDLYRGHLGRNYGILCAWIVLNMAIFPFVMKLFVYVKKREAMKA
Sbjct: 438 GIFRVTFLDLYRGHLGRNYGILCAWIVLNMAIFPFVMKLFVYVKKREAMKA 488

>Sklu_2316.3 , Contig c2316 10494-11957 reverse complement
          Length = 487

 Score =  487 bits (1253), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 232/446 (52%), Positives = 310/446 (69%), Gaps = 9/446 (2%)

Query: 46  ENEAGATEGELRRVESK----LSRVVTGFFSDRVKGERRKLIMRFLLNHFLLAMLIMSVF 101
           ++E  +    L  V S     L R+ T FFS R++ +R+ +  +FL N   LA L +SVF
Sbjct: 37  QSEHDSVRTSLSEVASNDGGSLQRMATSFFSPRLQAQRKHVWFQFLFNILALAALTISVF 96

Query: 102 SLYWGATYQRSKHMHKVKILAVVQDEPGTGTGIASSIPTLAEQAPGTWHVYNTSSFQQKY 161
           SLYWGA Y R+ H+ KV+ILAV+QD+      +  ++P + +  PG WHVY +  FQ KY
Sbjct: 97  SLYWGALYNRNSHLGKVRILAVIQDD----GSLPGALPAIIDANPGGWHVYTSEQFQSKY 152

Query: 162 GVAQDEVDAKIQQLVHDQKYWVSLNVKPNATSTLIESLQNSRASPFNSSAFFELFYESGR 221
            + + ++D+KI+ LVH QK+W+SLNVKPNAT+ L ESLQN  A PF +S +FE  YESGR
Sbjct: 153 HINETQIDSKIEHLVHTQKFWMSLNVKPNATNALHESLQNPSADPFVASNYFEAIYESGR 212

Query: 222 DPTNLKSSILPIALSLESRYQNIYASTILPGILSNITQRVGDVSRNVAMAGNMVFAQVDN 281
           DPTN +SSILP+   +E  +Q  Y S+ LP +LS+ T        N+A AGN+ F   D 
Sbjct: 213 DPTNFRSSILPLLQEVELSFQKNYTSSYLPELLSH-TNLSNASPANLAAAGNLEFCSEDM 271

Query: 282 RPFNDYVLLGPLQVGLIYCILLTFFQLALFGPIHALLGQKLKPVHMLLYRYVIAFVNYXX 341
           RPF++YVLLGPLQVGLI+C+LLTFFQLA+FGP+H ++  KLKP H+L+YRY I+   Y  
Sbjct: 272 RPFSNYVLLGPLQVGLIFCVLLTFFQLAMFGPLHGMVSPKLKPAHILIYRYCISMTAYFF 331

Query: 342 XXXXXXXXXXXXQVDFTKAFGRAGFMVAWMSSWLLMAAVGGANENMLTIIMAFGPQYLGF 401
                       QVDFT  FGRAGFMV WMS+WL+MAAVGGANEN+L++I+ +G QYLGF
Sbjct: 332 LSLFFCTVSAIFQVDFTPTFGRAGFMVYWMSTWLIMAAVGGANENVLSLILPYGAQYLGF 391

Query: 402 WLIFWVVLNISPAFYPMELTHNFYRYGYMTPIYNGVGIFRVTFLDLYRGHLGRNYGILCA 461
           WL+FW+V NISP+F+P+ L +NFYRYGYM PI+N + I++V FL+ Y+G LGRNYGILCA
Sbjct: 392 WLVFWIVSNISPSFFPLALMNNFYRYGYMMPIHNAMDIYKVIFLNTYKGTLGRNYGILCA 451

Query: 462 WIVLNMAIFPFVMKLFVYVKKREAMK 487
           W+V+N  +F  V+K+     K+ A K
Sbjct: 452 WVVINSILFVPVLKIVGNKMKQNAQK 477

>KLLA0E02134g complement(200436..202055) similar to sp|P46950
           Saccharomyces cerevisiae YGR197c SNG1 involved in
           nitroguanidine resistance, start by similarity
          Length = 539

 Score =  437 bits (1124), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 219/451 (48%), Positives = 293/451 (64%), Gaps = 15/451 (3%)

Query: 43  LDPENEAGATEGELRRVESKLSRVVTGFFSDRVKGERRKLIMRFLLNHFLLAMLIMSVFS 102
           +D +NE           +  L RV T FFS ++   R     RF LN FLL  L +++FS
Sbjct: 97  IDDKNEEQNDGSPAEAGQPALGRVKTRFFSSKLSTHRNIFARRFALNCFLLGSLAIAMFS 156

Query: 103 LYWGATYQRSKHMHKVKILAVVQDEPGTGTGIASSIPTLAEQAPGTWHVYNTSSFQQKYG 162
           LYWGA Y  S   H VK +AVV+D+   G G+   IP +    P  + VYNTSSF+ KYG
Sbjct: 157 LYWGALYNHSSDYHNVKFIAVVEDDGDMGAGV---IPIMDSAIP-QFFVYNTSSFRDKYG 212

Query: 163 VAQD-EVDAKIQQLVHDQKYWVSLNVKPNATSTLIESLQNSRASPFNSSAFFELFYESGR 221
             QD  +  K+  LVH +K+W SL V P  T   ++SL    A  FNS+ +FE FY++ R
Sbjct: 213 --QDVNISEKVHHLVHTKKFWGSLIVYPGTTDAFVDSLTTDDAPAFNSTDYFEFFYKTAR 270

Query: 222 DPTNLKSSILPIALSLESRYQ-NIYASTILPGILSNITQRVGDVSRNVAMAGNMVFAQVD 280
           D +N+++SI+P+  S+E+ Y+   + +   P +++NIT   G    N++ AG+M + Q+D
Sbjct: 271 DLSNMRASIVPLLTSIETTYKKTFFYNDYFPSVIANITNISG---PNLSAAGDMNWKQID 327

Query: 281 NRPFNDYVLLGPLQVGLIYCILLTFFQLALFGPIHALLGQKLKPVHMLLYRYVIAFVNYX 340
           NRPF DY LLGP+QVGLIYCILLTFFQLALFGP HA+L   LKP H++LYR V ++  Y 
Sbjct: 328 NRPFTDYTLLGPMQVGLIYCILLTFFQLALFGPFHAMLSPLLKPKHIILYRLVTSWATYF 387

Query: 341 XXXXXXXXXXXXXQVDFTKAFGRAGFMVAWMSSWLLMAAVGGANENMLTIIMAFGPQYLG 400
                         VDFT AFGR GF+V WM++W+LM AVGGANEN+L+I++A+ PQYLG
Sbjct: 388 FLSLFFCTVSAIFHVDFTLAFGRGGFVVYWMTTWILMGAVGGANENVLSILLAYCPQYLG 447

Query: 401 FWLIFWVVLNISPAFYPMELTHNFYRYGYMTPIYNGVGIFRVTFLDLYRGHLGRNYGILC 460
           FWLI W+++NIS +F P+ L + FYRYGYMTPIYN + I+RV F D Y+G +GRNYGIL 
Sbjct: 448 FWLISWIIINISASFVPLVLANRFYRYGYMTPIYNAMEIYRVIFTDTYKGDMGRNYGILA 507

Query: 461 AWIVLNMAIFPFVMKL----FVYVKKREAMK 487
           AW VLN  +FPFVMK+    F+   K+ AM+
Sbjct: 508 AWCVLNTLLFPFVMKIVGQKFMNDAKKRAMQ 538

>YGR197C (SNG1) [2147] chr7 complement(892500..894143) Probable
           transport protein, confers resistance to MNNG and
           nitrosoguanidine [1644 bp, 547 aa]
          Length = 547

 Score =  436 bits (1120), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 208/437 (47%), Positives = 296/437 (67%), Gaps = 13/437 (2%)

Query: 46  ENEAGATEGELRRVESKLSRVVTGFFSDRVKGERRKLIMRFLLNHFLLAMLIMSVFSLYW 105
           E E G  +G        L+R+ TG FS R++  R+K++ +F+LN+F +A + +S+ S+YW
Sbjct: 75  EEEKGGNDG------GPLARIQTGLFSPRLRNHRKKILSKFVLNNFFIACVCVSLISIYW 128

Query: 106 GATYQRSKHMHKVKILAVVQDEPGTGT--GIASSIPTLAEQAPGTWHVYNTSSFQQKYGV 163
           GA Y   ++  KVK + V+QD P   +   I++ IP+L    PGTWH+YN +SF +K+G 
Sbjct: 129 GACYGTDRYFFKVKNIVVLQDAPSNTSVQSISAIIPSLLASVPGTWHIYNATSFHRKFGT 188

Query: 164 AQD-EVDAKIQQLVHDQKYWVSLNVKPNATSTLIESLQNSRA-SPFNSSAFFELFYESGR 221
               E+D KI  L++D++YW++LNVKPNAT TL  SL +  A S FNSS FFE  +ESGR
Sbjct: 189 TNSTEIDRKIVDLIYDERYWLALNVKPNATDTLYNSLISQDANSEFNSSIFFESVFESGR 248

Query: 222 DPTNLKSSILPIALSLESRYQNIYASTILPGILSNITQRVGDVSRNV---AMAGNMVFAQ 278
           DP+++KS+ILP+   LE R Q  Y    LP ++SNIT    D++ N+   A+AG ++F  
Sbjct: 249 DPSSVKSTILPLMQQLEVRLQKYYVKEYLPSLMSNITSNDRDLNINMENWAIAGQLLFTY 308

Query: 279 VDNRPFNDYVLLGPLQVGLIYCILLTFFQLALFGPIHALLGQKLKPVHMLLYRYVIAFVN 338
            D RPF D +L+ PLQVGLIYCILLT  QL+L+G +H  + + LKP H+L+YR +I++  
Sbjct: 309 NDYRPFADRILMAPLQVGLIYCILLTVLQLSLYGKLHGEMARVLKPKHILIYRLLISWAT 368

Query: 339 YXXXXXXXXXXXXXXQVDFTKAFGRAGFMVAWMSSWLLMAAVGGANENMLTIIMAFGPQY 398
           Y              ++DFT AFGR GF+V WMS+WL+M AVGGANEN+L++++A+ P Y
Sbjct: 369 YFLLSIGFCTVSAIFRIDFTPAFGRGGFVVYWMSTWLVMMAVGGANENVLSLVIAYCPPY 428

Query: 399 LGFWLIFWVVLNISPAFYPMELTHNFYRYGYMTPIYNGVGIFRVTFLDLYRGHLGRNYGI 458
           L  WL+ W++LNIS +FYPM L + FYRYGY+ PI+N V I++V FL+L +  +GRNYGI
Sbjct: 429 LSIWLMTWIILNISASFYPMVLNNEFYRYGYIMPIHNAVDIYKVIFLNLTKRKMGRNYGI 488

Query: 459 LCAWIVLNMAIFPFVMK 475
           L AW+ LN ++ PF MK
Sbjct: 489 LVAWVALNTSLMPFCMK 505

>CAGL0G09273g 885374..887011 similar to sp|P46950 Saccharomyces
           cerevisiae YGR197c SNG1 or sp|P47090 Saccharomyces
           cerevisiae YJR015w, hypothetical start
          Length = 545

 Score =  414 bits (1065), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 201/433 (46%), Positives = 285/433 (65%), Gaps = 7/433 (1%)

Query: 62  KLSRVVTGFFSDRVKGERRKLIMRFLLNHFLLAMLIMSVFSLYWGATYQRSKHMHKVKIL 121
           K   ++    + +++  +  L  +F   + LLA + +S+  +YWGA Y+   ++ KV IL
Sbjct: 97  KCVHLLKNILNPKLESHKSVLAFQFCFTNVLLATVCLSIICIYWGAAYRTEHYLFKVNIL 156

Query: 122 AVVQDEPGTG-TGIASSIPTLAEQAPGTWHVYNTSSFQQKYGV--AQDEVDAKIQQLVHD 178
           +V+QD+       +AS++P L +Q PGTWH+YN SSF +KYG+    + VD KI  L+ +
Sbjct: 157 SVIQDQDYNNIQSMASTLPALIDQTPGTWHLYNRSSFVEKYGIENTSEAVDKKITDLIFE 216

Query: 179 QKYWVSLNVKPNATSTLIESLQNSRASPFNSSAFFELFYESGRDPTNLKSSILPIALSLE 238
           +KYW+SLNVK  AT  L  SL ++ A  FNSSA+FE  +ESGRDPTNLKS+ILPI   L+
Sbjct: 217 EKYWMSLNVKTGATEALYNSLTDNTAPAFNSSAYFECMFESGRDPTNLKSAILPIMQQLQ 276

Query: 239 SRYQNIYASTILPGILSNIT---QRVGDVSR-NVAMAGNMVFAQVDNRPFNDYVLLGPLQ 294
           + Y   Y ST LP +L N++     +GDV+  ++A +GN  F  +D RPF D VLL PLQ
Sbjct: 277 AAYVQYYTSTYLPSMLRNVSATINSIGDVNPLSLANSGNFEFNYIDYRPFFDRVLLAPLQ 336

Query: 295 VGLIYCILLTFFQLALFGPIHALLGQKLKPVHMLLYRYVIAFVNYXXXXXXXXXXXXXXQ 354
           VGLI+ ++LT  QL+L+GP+HA + +  KP H LLYRY +++  Y              Q
Sbjct: 337 VGLIFTLILTVVQLSLYGPMHAKMVRVFKPKHFLLYRYGLSWSTYFILSLFFCTVSAIYQ 396

Query: 355 VDFTKAFGRAGFMVAWMSSWLLMAAVGGANENMLTIIMAFGPQYLGFWLIFWVVLNISPA 414
           +DFT AFGR GF++ W++++ +M A+G  NEN++++I+A+ PQY+  WLI W++LNISP+
Sbjct: 397 IDFTLAFGRGGFVIYWITTFYVMLAIGATNENVISLIVAYCPQYMPIWLISWIILNISPS 456

Query: 415 FYPMELTHNFYRYGYMTPIYNGVGIFRVTFLDLYRGHLGRNYGILCAWIVLNMAIFPFVM 474
           FYPM L + FYRYGY  P++N V I+RV FLDL R  LGRNYGIL AW+ +   IFPFVM
Sbjct: 457 FYPMVLNNQFYRYGYAMPLHNAVDIYRVIFLDLSRNKLGRNYGILTAWVAVTHIIFPFVM 516

Query: 475 KLFVYVKKREAMK 487
           K+     K  AMK
Sbjct: 517 KIAGTKMKSNAMK 529

>YJR015W (YJR015W) [2918] chr10 (462635..464167) Protein with
           similarity to Sng1p and multidrug resistance proteins
           [1533 bp, 510 aa]
          Length = 510

 Score =  396 bits (1018), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 198/466 (42%), Positives = 300/466 (64%), Gaps = 15/466 (3%)

Query: 38  RGYKELDPENEAGATEGELRRVESKLSRVVTG-FFSDRVKGERRKLIMRFLLNHFLLAML 96
           +G  ++D +    + + E    + K     +G FFS  ++G+R+K++++F+  + LLA++
Sbjct: 41  QGVPDMDGQTTDSSKDPEPNSEDKKAFPPSSGSFFSPNLQGQRKKVLLKFVFTNCLLAII 100

Query: 97  IMSVFSLYWGATYQRSKHMHKVKILAVVQDEP---------GTGTGIASSIPTLAEQAPG 147
             ++F L+WGA Y  SK++HKVK+L V+Q+ P              I+ ++PT   + P 
Sbjct: 101 CFTMFVLFWGALYDTSKYLHKVKLLVVIQEPPVVILDNNSSMVVPSISYALPTFINKIPC 160

Query: 148 TWHVYNTSSFQQKYGV-AQDEVDAKIQQLVHDQKYWVSLNVKPNATSTLIESLQNSRASP 206
            W +YN+ +FQ K+ V    +V+ K+  LV+D+KYW ++N+KPNAT TL ESL N  A  
Sbjct: 161 DWDIYNSPTFQAKFDVNTPQQVNDKVVDLVYDEKYWFAINIKPNATETLFESLINDTAPL 220

Query: 207 FNSSAFFELFYESGRDPTNLKSSILPIALSLESRYQNIYASTILPGILSNITQ----RVG 262
           FNS+ F ++ YE+GRDPTNLKS+ILP+A ++E  Y   Y    LP +L+NITQ     + 
Sbjct: 221 FNSTLFNQVVYETGRDPTNLKSTILPVAQTIEEYYHTFYTLNYLPPLLTNITQVYRYALT 280

Query: 263 DVSRNVAMAGNMVFAQVDNRPFNDYVLLGPLQVGLIYCILLTFFQLALFGPIHALLGQKL 322
           + +R +A AG   +   D+RPF D +LL P Q+G++YC+LLTFFQ  L+GP+H  + + L
Sbjct: 281 NNARYIAAAGKYNYEYYDHRPFTDRILLAPTQIGVVYCLLLTFFQFLLYGPLHVEMAKVL 340

Query: 323 KPVHMLLYRYVIAFVNYXXXXXXXXXXXXXXQVDFTKAFGRAGFMVAWMSSWLLMAAVGG 382
           +P + L+YR  +++  +              QVDFTK+FGR GF+V WMS+WL M A GG
Sbjct: 341 RPANGLIYRIAMSWFTFFFASLFFCTTTAIFQVDFTKSFGRGGFVVYWMSTWLFMLAAGG 400

Query: 383 ANENMLTIIMAFGPQYLGFWLIFWVVLNISPAFYPMELTHNFYRYGYMTPIYNGVGIFRV 442
           ANEN + +++  GPQYLGFW++ +V+LNI+P+F+P+ L +N YRYGYM P++N + I+RV
Sbjct: 401 ANENAVMLVITLGPQYLGFWILSFVILNIAPSFFPLALNNNVYRYGYMMPVHNVIDIYRV 460

Query: 443 TFLDLYRGHLGRNYGILCAWIVLNMAIFPFVMKLFVYVKKREAMKA 488
            F D+ R  +GRNYGIL A I LN A+ PFV K      K++A+ A
Sbjct: 461 IFFDVTRRKMGRNYGILVALIALNTALLPFVGKYASRKLKQKALVA 506

>Scas_617.3
          Length = 541

 Score =  382 bits (980), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 185/460 (40%), Positives = 289/460 (62%), Gaps = 17/460 (3%)

Query: 44  DPENEA--GATEGELRRVESKLSRVVTGFFSDRVKGERRKLIMRFLLNHFLLAMLIMSVF 101
           D +N A    T+ E       +S   T  +S ++  +R+K+ ++F++++ LLA + +S+ 
Sbjct: 82  DGQNTAKPAVTQPEENEENVPISPTKTRLYSPKLASQRKKITVKFIISNLLLAGVCLSIL 141

Query: 102 SLYWGATYQRSKHMHKVKILAVVQDE--PGTG---TGIASSIPTLAEQAPGTWHVYNTSS 156
           SLYWG+ YQ +KH+ ++ I+A++QD+  P      T + + +P+  EQ+ G WHVYN S 
Sbjct: 142 SLYWGSLYQTTKHLERISIIAIIQDDYIPPNDLNLTSVVAPVPSFIEQSTGKWHVYNQSY 201

Query: 157 FQQKYGVAQDE--VDAKIQQLVHDQKYWVSLNVKPNATSTLIESLQNSRASPFNSSAFFE 214
           FQ+K+ V QD   ++ ++  L+HD+KYW++LN+  N T  ++ SL       FNS+    
Sbjct: 202 FQEKFNV-QDPTMINERLNALIHDEKYWIALNIGANLTMRIVNSLTTPNEPFFNSTQHIR 260

Query: 215 LFYESGRDPTNLKSSILPIALSLESRYQNIYASTILPGILSNI-----TQRVGDVSRNVA 269
           + YE+ R+PT L++ +LPI   +E  YQ+ Y +  LP +LS +     T      + N+A
Sbjct: 261 VVYETSREPTTLEAYMLPIIQEIELAYQDFYHTEYLPELLSKLQNSTTTPLSNTGAANLA 320

Query: 270 MAGNMVFAQVDNRPFNDYVLLGPLQVGLIYCILLTFFQLALFGPIHALLGQKLKPVHMLL 329
             G   F   D   F D +L+ PLQVGLIYC++LT FQL+LFGP+HA + + LKP H+++
Sbjct: 321 NIGKFQFDYDDILVFPDRILIAPLQVGLIYCLILTVFQLSLFGPLHAEMAKYLKPKHIII 380

Query: 330 YRYVIAFVNYXXXXXXXXXXXXXXQVDFTKAFGRAGFMVAWMSSWLLMAAVGGANENMLT 389
           YR  +++  Y              Q+DFT  FG+ GF++ WM+++L+M A+GGANEN+L+
Sbjct: 381 YRLSVSWATYFFLSLFFCTVSAIFQIDFTVTFGKGGFVIYWMTTYLVMLALGGANENVLS 440

Query: 390 IIMAFGPQYLGFWLIFWVVLNISPAFYPMELTHNFYRYGYMTPIYNGVGIFRVTFLDLYR 449
           +I+ F P+YL  WL+ W+++NISP F PM L + FYRYGYM P++  + IF+V FL++ +
Sbjct: 441 LIILFIPEYLPLWLLSWIIMNISPTFNPMVLDNVFYRYGYMMPLHQALDIFKVVFLNVSK 500

Query: 450 GHLGRNYGILCAWIVLNMAIFPFVMKLF--VYVKKREAMK 487
            H+GRNYGIL AWIV+N  +FP VMK+      K+ EA K
Sbjct: 501 RHMGRNYGILVAWIVVNTCLFPLVMKIVGKTVQKRMEAKK 540

>CAGL0B03949g complement(387861..389759) similar to sp|P46950
           Saccharomyces cerevisiae YGR197c SNG1 or sp|P47090
           Saccharomyces cerevisiae YJR015w, hypothetical start
          Length = 632

 Score =  375 bits (962), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 190/449 (42%), Positives = 276/449 (61%), Gaps = 14/449 (3%)

Query: 53  EGE-LRRVESKLS--RVVTGFFSDRVKGERRKLIMRFLLNHFLLAMLIMSVFSLYWGATY 109
           EG+ + RV S  S  +  T  FS R+K  RR+++ +F+  H LLA+ ++   SLYWGA Y
Sbjct: 151 EGDVISRVSSTASQWKKKTSLFSKRMKDHRRRILAKFISTHILLAIFVIGALSLYWGAIY 210

Query: 110 QRSKHMHKVKILAVVQDEPGT---GTGIAS---SIPTLAEQAPGTWHVYNTSSFQQKYGV 163
             S ++++V  +AV+QDEP T   GT I +   ++  +    PG W + N++ F+  Y V
Sbjct: 211 NYSGNLYRVHSIAVIQDEPYTAPDGTVIPALTRNVTNIINSIPGNWRIMNSTEFKVIYNV 270

Query: 164 AQ-DEVDAKIQQLVHDQKYWVSLNVKPNATSTLIESLQNSRASPFNSSAFFELFYESGRD 222
               E+D K+ +L+ D+K+W+++NV+  AT    +S+    A  FNS+ +F+  YESGRD
Sbjct: 271 TNAQEIDEKVAELIFDEKFWLAVNVREGATEAFYKSVTEEGAPVFNSTNYFQSIYESGRD 330

Query: 223 PTNLKSSILPIALSLESRYQNIYASTILPGILSNITQRVGDVSRNVAMA---GNMVFAQV 279
           PTNLKSSI PI    ES +++ Y    +P  + NIT    + + N A     GN      
Sbjct: 331 PTNLKSSIYPILAKFESVFRSQYLKIYVPEFIKNITSPDFNETVNTANLYGLGNFATNSY 390

Query: 280 DNRPFNDYVLLGPLQVGLIYCILLTFFQLALFGPIHALLGQKLKPVHMLLYRYVIAFVNY 339
           D RPF D VLLGPL +GL Y I+ + F +++FGP++  + + LKP  +  YR +I++  +
Sbjct: 391 DLRPFTDRVLLGPLSMGLNYNIMFSVFSISIFGPVNKEMAKYLKPRSLFFYRILISWSMF 450

Query: 340 XXXXXXXXXXXXXXQVDFTKAFGRAGFMVAWMSSWLLMAAVGGANENMLTIIMAFGPQYL 399
                         Q+DFT  FG+AGF++ WM+SWL+M AVG ANEN+L+II+ F PQY+
Sbjct: 451 FFLSLFTCTVSAIFQIDFTPGFGKAGFVIYWMTSWLVMTAVGMANENILSIILTFCPQYM 510

Query: 400 GFWLIFWVVLNISPAFYPMELTHNFYRYGYMTPIYNGVGIFRVTFLDLYRGHLGRNYGIL 459
            +W+I W +LNI+P+ YP+ L   FYR+GY  PI+NGV I+RV FLD+ R  + RNYGIL
Sbjct: 511 SYWMIIWTILNIAPSLYPLVLISRFYRFGYAMPIHNGVQIYRVIFLDISRHQMSRNYGIL 570

Query: 460 CAWIVLNMAIFPFVMKLFV-YVKKREAMK 487
            AW+ +N AI PFV K     VKKRE  K
Sbjct: 571 AAWVAVNTAINPFVNKFISKVVKKREERK 599

>Scas_647.9
          Length = 449

 Score =  364 bits (934), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 169/409 (41%), Positives = 260/409 (63%), Gaps = 7/409 (1%)

Query: 75  VKGERRKLIMRFLLNHFLLAMLIMSVFSLYWGATYQRSKHMHKVKILAVVQDE---PGTG 131
           +KGER+ +++ F   + +LA+   ++F L+WG  Y+ +   H+V+ILAV+QDE     T 
Sbjct: 1   MKGERKNVLINFAFTNGVLAVFCFTIFVLFWGINYRITDKYHRVQILAVIQDEGINNSTV 60

Query: 132 TGIASSIPTLAEQAPGTWHVYNTSSFQQKYGVAQDE-VDAKIQQLVHDQKYWVSLNVKPN 190
             +AS +PTL ++ P TWH+YNT+SF +K+G    E +D ++   V  + YW++LNVKPN
Sbjct: 61  LPMASILPTLMQENPATWHLYNTTSFNEKFGTNSTEAIDKEVIHEVFSEHYWMALNVKPN 120

Query: 191 ATSTLIESLQNSRASPFNSSAFFELFYESGRDPTNLKSSILPIALSLESRYQNIYASTIL 250
           AT  L E+  N    PFNS+ +F+  + S RDP+N + ++LP+   LE+ Y+N Y +T  
Sbjct: 121 ATQALFETFINPNGPPFNSTEYFQAVFLSARDPSNFRVTLLPLIEFLETAYRNYYINTYF 180

Query: 251 PGILSN--ITQRVGDVS-RNVAMAGNMVFAQVDNRPFNDYVLLGPLQVGLIYCILLTFFQ 307
           P  +SN  I   +  V+  N+A+AG M F   D RPF +  L+ P+ +G+ YC+LLTFFQ
Sbjct: 181 PQFMSNVSIANNLTTVNVTNIALAGAMNFDYFDYRPFTERELIAPVMIGVAYCLLLTFFQ 240

Query: 308 LALFGPIHALLGQKLKPVHMLLYRYVIAFVNYXXXXXXXXXXXXXXQVDFTKAFGRAGFM 367
             ++  +HA   + LKP  ++ YR ++ +                 QVDFT+AFG+ GF+
Sbjct: 241 FLVYSGLHAETSRLLKPNQVIYYRIIMLWCTMFIASLFFCTTSAIFQVDFTRAFGKGGFV 300

Query: 368 VAWMSSWLLMAAVGGANENMLTIIMAFGPQYLGFWLIFWVVLNISPAFYPMELTHNFYRY 427
           V WM++WL M A GG NEN ++++   GP++LG W++ +++LNI+P FYP+ L +  YRY
Sbjct: 301 VYWMTTWLFMVACGGTNENAVSLLFLMGPRFLGIWILSFIILNITPTFYPLILANPVYRY 360

Query: 428 GYMTPIYNGVGIFRVTFLDLYRGHLGRNYGILCAWIVLNMAIFPFVMKL 476
           GYM P++N + I+RV FLDL +  +GRN+G+L AWI +N A  PFV K 
Sbjct: 361 GYMMPVHNAIDIYRVIFLDLSKHKMGRNFGLLIAWIAMNTAALPFVYKF 409

>CAGL0B03971g complement(390700..392331) similar to sp|P47090
           Saccharomyces cerevisiae YJR015w or sp|P46950
           Saccharomyces cerevisiae YGR197c SNG1, hypothetical
           start
          Length = 543

 Score =  333 bits (853), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 184/491 (37%), Positives = 274/491 (55%), Gaps = 20/491 (4%)

Query: 18  HAGFARAIVXXXXXXXXXXXRGYKE--LDPENEAGATEGELR---------RVESKLSRV 66
           H G A +I              Y E   DP+  A   EG+ +            + L++ 
Sbjct: 47  HYGGAPSIPLEDEESIRTSNEDYSEEAKDPQAYAPGPEGDEKGKPTQNNNPEPTNTLTKT 106

Query: 67  VTGFFSDRVKGERRKLIMRFLLNHFLLAMLIMSVFSLYWGATYQRSKHMHKVKILAVVQD 126
            T FFS   K +R+++  R+LL  FLL     ++  L WG  Y+   ++ + K+LAV+Q+
Sbjct: 107 KTRFFSPNFKDQRKRVAYRWLLAVFLLMCFCFTILVLMWGVLYRTPHYVRRAKVLAVIQE 166

Query: 127 EPGTGTGIASSIPTLAE-------QAPGTWHVYNTSSFQQKYGVAQDE-VDAKIQQLVHD 178
           +           P+++        + P +W +YN +SFQ KY V   E ++ K+  LV+ 
Sbjct: 167 DQVYRFNDTVQFPSVSSPLYDIIAEVPLSWEIYNATSFQIKYNVEGIEAMNQKVIDLVYK 226

Query: 179 QKYWVSLNVKPNATSTLIESLQNSRAS-PFNSSAFFELFYESGRDPTNLKSSILPIALSL 237
           +++W++LNV+ N T TL+ SL ++ +   FNS++ FE+ YESGRD TNL S +LP+   +
Sbjct: 227 EEFWLALNVQGNVTDTLVRSLISADSDVQFNSTSLFEVVYESGRDITNLPSVLLPVFQGI 286

Query: 238 ESRYQNIYASTILPGILSNITQRVGDVSRNVAMAGNMVFAQVDNRPFNDYVLLGPLQVGL 297
           E  +Q +Y    LP +L NIT         VA AG M F   D RP  D V L   Q+G 
Sbjct: 287 EGVFQKVYTYQYLPQLLGNITNGDNFNPARVAAAGRMKFNYNDYRPVTDRVTLLSTQIGA 346

Query: 298 IYCILLTFFQLALFGPIHALLGQKLKPVHMLLYRYVIAFVNYXXXXXXXXXXXXXXQVDF 357
           +YC+LLT FQ  +FGP+H  + + +K  ++ +YR ++ +                 QVDF
Sbjct: 347 VYCLLLTVFQFLVFGPLHGEMSRMIKFSNLWIYRLIVLWSVLFFVSIFWCTVSAMYQVDF 406

Query: 358 TKAFGRAGFMVAWMSSWLLMAAVGGANENMLTIIMAFGPQYLGFWLIFWVVLNISPAFYP 417
           TKAFGRAGF+V WMS++L M AVGG NEN++ +I+   P Y+GFW++ +V+LN++PAF+ 
Sbjct: 407 TKAFGRAGFVVYWMSTYLYMLAVGGLNENVIMLIILISPSYIGFWILSFVILNLAPAFFA 466

Query: 418 MELTHNFYRYGYMTPIYNGVGIFRVTFLDLYRGHLGRNYGILCAWIVLNMAIFPFVMKLF 477
           +   + FYRYGY  P++  VGI RV F D+ +  LGRNYGILCAW+ LN    PFV K  
Sbjct: 467 IGYANVFYRYGYAMPLHCIVGINRVIFFDISKHQLGRNYGILCAWVGLNTISMPFVSKFV 526

Query: 478 VYVKKREAMKA 488
           +    + A KA
Sbjct: 527 LKTLHKRARKA 537

>ADL193C [1548] [Homologous to ScYGR197C (SNG1) - NSH]
           (357909..359306) [1398 bp, 465 aa]
          Length = 465

 Score =  320 bits (821), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 171/435 (39%), Positives = 265/435 (60%), Gaps = 9/435 (2%)

Query: 45  PENEAGATEGELRRVESKLSRVVTGFFSDRVKGERRKLIMRFLLNHFLLAMLIMSVFSLY 104
           P+N      GE+  +  KL+R+ T F S RV   R++L++ FL N   LA L++ VFSL+
Sbjct: 28  PKNAEREGSGEM--LGGKLARLKTRFMSPRVYLARKRLLVLFLSNKLFLACLVLVVFSLH 85

Query: 105 WGATYQRSKHMHKVKILAVVQDEPGTGTGIASSIPTLAEQAPGTWHVYNTSSFQQKYGVA 164
            G    + +++ ++ +L VVQDE     G+++ +   AE A G W   + ++    +G+ 
Sbjct: 86  VGVLVNQQQYLGRLPMLMVVQDEDA---GMSAELLRAAEHAAGRWTTVHGAAAWSHFGLE 142

Query: 165 QD-EVDAKIQQLVHDQKYWVSLNVKPNATSTLIESLQNSRASPFNSSAFFELFYESGRDP 223
           +D ++D  +Q L+   +YW++L+V+P AT  L  SL +  A  FNSS FF+++YE+ RD 
Sbjct: 143 EDADLDEYLQSLIRKHRYWMALHVRPGATEALRRSLDDPGAPVFNSSEFFKVYYETVRD- 201

Query: 224 TNLKSSILPIALSLESRYQNIYASTILPGILSNI--TQRVGDVSRNVAMAGNMVFAQVDN 281
            N   S+  +  +LE+ ++  Y  T LPG L     T  +     N+  AG+M ++ VD 
Sbjct: 202 FNAMGSVRKLMETLEANFRAYYLDTWLPGELRERANTIDLSSTGSNIVAAGSMRWSYVDL 261

Query: 282 RPFNDYVLLGPLQVGLIYCILLTFFQLALFGPIHALLGQKLKPVHMLLYRYVIAFVNYXX 341
            PF D  L G LQVG+I C+LLTFFQLA+   +H  L   L+  H+LLYRY++++ +Y  
Sbjct: 262 GPFYDPSLYGILQVGMIICLLLTFFQLAMISALHTELSLLLRTSHLLLYRYIVSYASYLL 321

Query: 342 XXXXXXXXXXXXQVDFTKAFGRAGFMVAWMSSWLLMAAVGGANENMLTIIMAFGPQYLGF 401
                        +D  KA+GRAGF+V WM++WL M A+GGANEN++++I  + P+++GF
Sbjct: 322 LSLFYSIVPIIYHLDMEKAYGRAGFLVFWMTTWLFMTALGGANENVISVIFEYCPRFVGF 381

Query: 402 WLIFWVVLNISPAFYPMELTHNFYRYGYMTPIYNGVGIFRVTFLDLYRGHLGRNYGILCA 461
           WL+FW+V NI+P FY + L ++FY+YGY+TPIYN    ++V   D  RG+L   Y +L A
Sbjct: 382 WLMFWIVFNITPTFYSLHLANDFYKYGYITPIYNARECYKVLLFDTDRGYLKVAYVVLVA 441

Query: 462 WIVLNMAIFPFVMKL 476
           W VLN A+FP  +K+
Sbjct: 442 WTVLNAALFPLALKI 456

>Scas_434.1
          Length = 357

 Score =  166 bits (421), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 90/265 (33%), Positives = 157/265 (59%), Gaps = 13/265 (4%)

Query: 62  KLSRVVTGFFSDRVKGERRKLIMRFLLNHFLLAMLIMSVFSLYWGATYQRSKHMHKVKIL 121
           +L+   T  FS  +   R+K+  +F+  + ++ +   +V  ++WG  Y  +++ HKV  L
Sbjct: 93  ELAPAKTTLFSPHLTQHRKKIFWKFISINAIIGLFCCTVLPIFWGCLYGTNQYFHKVHYL 152

Query: 122 AVVQDEPGTGTGI-----ASSIPTLAEQAPGTWHVYNTSSFQQKYGVAQ-DEVDAKIQQL 175
            VVQDEP    G+     AS +P +    PGTWHVYNTS+F   Y +    +++ K+  L
Sbjct: 153 MVVQDEPLQLGGLSVPSMASFLPEIVPSLPGTWHVYNTSTFMDHYHLTNASDINNKVVDL 212

Query: 176 VHDQKYWVSLNVKPNATSTLIESL-QNSRASP---FNSSAFFELFYESGRDPTNLKSSIL 231
           +  +++WV++NVKPNAT++L++SL Q    +P   FN++ FF++ YE+ RD T+++++++
Sbjct: 213 IFQERFWVAVNVKPNATASLMQSLVQPQSTTPETLFNATNFFQVIYETARDVTSVQAAMV 272

Query: 232 PIALSLESRYQNIYASTILPGILSNI--TQRVGDVS-RNVAMAGNMVFAQVDNRPFNDYV 288
            +   +ES Y+ IY    LP IL+ +  T ++  ++  +++ A N+ F   D R F +  
Sbjct: 273 LVVQEMESAYREIYMEQYLPTILAQMDPTNQISSLAPTSLSRATNINFQYWDYRSFYNRA 332

Query: 289 LLGPLQVGLIYCILLTFFQLALFGP 313
           L+GPL  G IY + +T FQ  +F P
Sbjct: 333 LMGPLLAGTIYSLTITVFQFLIFTP 357

>Scas_617.0d
          Length = 46

 Score = 57.0 bits (136), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 23/38 (60%), Positives = 29/38 (76%)

Query: 439 IFRVTFLDLYRGHLGRNYGILCAWIVLNMAIFPFVMKL 476
           +++V F DL R  +GRNYGIL AWIVLN  +FPF+MK 
Sbjct: 2   VYKVIFCDLERSKMGRNYGILVAWIVLNTCLFPFIMKF 39

>KLLA0A03905g complement(345818..350470) similar to sp|P19524
            Saccharomyces cerevisiae YOR326w MYO2 myosin heavy chain,
            start by similarity
          Length = 1550

 Score = 33.1 bits (74), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 21/42 (50%)

Query: 245  YASTILPGILSNITQRVGDVSRNVAMAGNMVFAQVDNRPFND 286
            Y   I P IL  + ++V + +    +  N VF  VDN PF D
Sbjct: 1465 YEEPIAPEILQYVAEKVKNDTSKAEVGNNDVFLPVDNGPFED 1506

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.326    0.139    0.425 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 13,655,986
Number of extensions: 549081
Number of successful extensions: 1811
Number of sequences better than 10.0: 16
Number of HSP's gapped: 1837
Number of HSP's successfully gapped: 16
Length of query: 488
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 382
Effective length of database: 12,926,601
Effective search space: 4937961582
Effective search space used: 4937961582
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 64 (29.3 bits)