Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_55.2160657572199e-26
Scas_699.47*61401573e-16
ACR080C58401495e-15
YOR045W (TOM6)61401304e-12
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_55.21606
         (57 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_55.21606                                                          89   9e-26
Scas_699.47*                                                           65   3e-16
ACR080C [1127] [Homologous to ScYOR045W (TOM6) - SH] (503127..50...    62   5e-15
YOR045W (TOM6) [4856] chr15 (413851..414036) Mitochondrial integ...    55   4e-12

>Kwal_55.21606
          Length = 57

 Score = 89.0 bits (219), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 46/57 (80%), Positives = 46/57 (80%)

Query: 1  MSARFTXXXXXXXXXXXSRFEQFRQTPAFPVIVNLGLFVAGVAFIQSPLMEMMAPQL 57
          MSARFT           SRFEQFRQTPAFPVIVNLGLFVAGVAFIQSPLMEMMAPQL
Sbjct: 1  MSARFTAPGAGAPAKKASRFEQFRQTPAFPVIVNLGLFVAGVAFIQSPLMEMMAPQL 57

>Scas_699.47*
          Length = 61

 Score = 65.1 bits (157), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 31/40 (77%), Positives = 36/40 (90%)

Query: 18 SRFEQFRQTPAFPVIVNLGLFVAGVAFIQSPLMEMMAPQL 57
          SRFEQFR+TP F V++N  LFVAGVAFIQSPLM+M+APQL
Sbjct: 22 SRFEQFRETPVFTVLLNGTLFVAGVAFIQSPLMDMLAPQL 61

>ACR080C [1127] [Homologous to ScYOR045W (TOM6) - SH]
          (503127..503303) [177 bp, 58 aa]
          Length = 58

 Score = 62.0 bits (149), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 34/40 (85%)

Query: 18 SRFEQFRQTPAFPVIVNLGLFVAGVAFIQSPLMEMMAPQL 57
          S F+QFR +PA+PV+VNL LF  GVAF+QS LM+MMAPQL
Sbjct: 19 SMFQQFRDSPAYPVVVNLALFGVGVAFVQSSLMDMMAPQL 58

>YOR045W (TOM6) [4856] chr15 (413851..414036) Mitochondrial
          integral outer membrane protein associated with the
          protein translocation complex and the general import
          complex [186 bp, 61 aa]
          Length = 61

 Score = 54.7 bits (130), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 33/40 (82%)

Query: 18 SRFEQFRQTPAFPVIVNLGLFVAGVAFIQSPLMEMMAPQL 57
          SRF+ F+++P + + +N   FVAGVAFIQSPLM+M+APQL
Sbjct: 22 SRFQAFKESPLYTIALNGAFFVAGVAFIQSPLMDMLAPQL 61

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.333    0.140    0.404 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 1,126,043
Number of extensions: 22206
Number of successful extensions: 41
Number of sequences better than 10.0: 4
Number of HSP's gapped: 41
Number of HSP's successfully gapped: 4
Length of query: 57
Length of database: 16,596,109
Length adjustment: 30
Effective length of query: 27
Effective length of database: 15,557,569
Effective search space: 420054363
Effective search space used: 420054363
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.6 bits)
S2: 54 (25.4 bits)