Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_55.216031641638431e-117
ACR081C9630830.002
CAGL0L09999g13433650.68
YOR044W15737641.1
ADL094W25937631.6
AGR139C78965632.0
Kwal_55.2000061756622.7
Scas_702.985255622.8
Scas_639.1077280623.2
Kwal_27.1031892567597.0
Sklu_2377.186582589.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_55.21603
         (163 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_55.21603                                                         329   e-117
ACR081C [1128] [Homologous to ScYOR044W - SH] (503388..503678) [...    37   0.002
CAGL0L09999g 1072123..1072527 some similarities with tr|Q08416 S...    30   0.68 
YOR044W (YOR044W) [4855] chr15 (413006..413479) Protein of unkno...    29   1.1  
ADL094W [1647] [Homologous to ScYIL024C - SH] complement(517037....    29   1.6  
AGR139C [4450] [Homologous to ScYER151C (UBP3) - SH] (1010466..1...    29   2.0  
Kwal_55.20000                                                          28   2.7  
Scas_702.9                                                             28   2.8  
Scas_639.10                                                            28   3.2  
Kwal_27.10318                                                          27   7.0  
Sklu_2377.1 YPL126W, Contig c2377 154-2751                             27   9.0  

>Kwal_55.21603
          Length = 164

 Score =  329 bits (843), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 163/163 (100%), Positives = 163/163 (100%)

Query: 1   MEQMLELLGYGRLCAYILAQVARHALLTLAVLLVGPVIALYAYDFGLYMWRVVTNGWHTV 60
           MEQMLELLGYGRLCAYILAQVARHALLTLAVLLVGPVIALYAYDFGLYMWRVVTNGWHTV
Sbjct: 1   MEQMLELLGYGRLCAYILAQVARHALLTLAVLLVGPVIALYAYDFGLYMWRVVTNGWHTV 60

Query: 61  EENSLSSAGASEQHSGAQATHVSEGDSENDSDVESTYRSGSEWESSVTPAEIEEGELKPA 120
           EENSLSSAGASEQHSGAQATHVSEGDSENDSDVESTYRSGSEWESSVTPAEIEEGELKPA
Sbjct: 61  EENSLSSAGASEQHSGAQATHVSEGDSENDSDVESTYRSGSEWESSVTPAEIEEGELKPA 120

Query: 121 PLLGVIQGSYSRLSDLITVTVSTGADSRRVECYEHEVKLVSGR 163
           PLLGVIQGSYSRLSDLITVTVSTGADSRRVECYEHEVKLVSGR
Sbjct: 121 PLLGVIQGSYSRLSDLITVTVSTGADSRRVECYEHEVKLVSGR 163

>ACR081C [1128] [Homologous to ScYOR044W - SH] (503388..503678)
          [291 bp, 96 aa]
          Length = 96

 Score = 36.6 bits (83), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 22/30 (73%)

Query: 23 RHALLTLAVLLVGPVIALYAYDFGLYMWRV 52
          R     LA LL+GP++A+YAYDF LY+ R+
Sbjct: 23 RQVCKVLAWLLLGPLVAVYAYDFCLYVLRL 52

>CAGL0L09999g 1072123..1072527 some similarities with tr|Q08416
          Saccharomyces cerevisiae YOR044w, start by similarity
          Length = 134

 Score = 29.6 bits (65), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 21/33 (63%)

Query: 21 VARHALLTLAVLLVGPVIALYAYDFGLYMWRVV 53
          V +++      LL+ P + LYA+D  LY++R+V
Sbjct: 16 VVQYSCYAAVALLLIPFLGLYAFDLFLYVYRLV 48

>YOR044W (YOR044W) [4855] chr15 (413006..413479) Protein of
          unknown function [474 bp, 157 aa]
          Length = 157

 Score = 29.3 bits (64), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 11/37 (29%), Positives = 22/37 (59%)

Query: 17 ILAQVARHALLTLAVLLVGPVIALYAYDFGLYMWRVV 53
          ++ Q  ++   T    L+ P + LYA+D  LY++R++
Sbjct: 11 LVIQSLQYICRTCIAFLLIPFLGLYAFDLFLYVYRMI 47

>ADL094W [1647] [Homologous to ScYIL024C - SH]
           complement(517037..517816) [780 bp, 259 aa]
          Length = 259

 Score = 28.9 bits (63), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 23/37 (62%)

Query: 65  LSSAGASEQHSGAQATHVSEGDSENDSDVESTYRSGS 101
           L+S+G+SE HSG    H S+ DS+ ++ + S   S S
Sbjct: 131 LASSGSSEFHSGVSCVHSSDSDSDTEAAMRSMLTSAS 167

>AGR139C [4450] [Homologous to ScYER151C (UBP3) - SH]
           (1010466..1012835) [2370 bp, 789 aa]
          Length = 789

 Score = 28.9 bits (63), Expect = 2.0,   Method: Composition-based stats.
 Identities = 17/65 (26%), Positives = 32/65 (49%), Gaps = 5/65 (7%)

Query: 72  EQHSGAQATHVSEGDSENDSDVESTYRSGSEWESSVTPAEIEEGELKPAPLLGVIQGSYS 131
           +++  A     SEG SEN S+     + G +  ++V        EL+P+P++ +  G Y 
Sbjct: 532 DKYGSALEYDTSEG-SENSSEWHEVSKKGKKTRNTVK----RTTELEPSPIMSIFGGEYR 586

Query: 132 RLSDL 136
            + D+
Sbjct: 587 SVLDI 591

>Kwal_55.20000
          Length = 617

 Score = 28.5 bits (62), Expect = 2.7,   Method: Composition-based stats.
 Identities = 16/56 (28%), Positives = 27/56 (48%), Gaps = 1/56 (1%)

Query: 66  SSAGASEQHSGAQATHVSEGDSENDSDVESTYRSGSEWESSVTPAEIEEGELKPAP 121
           SS   +     A+A  V+   S N+S  + TY  G +  +S +PA ++  +  P P
Sbjct: 499 SSTKVNNVQPKAKAVPVTRKPSSNESSFKPTYLDGKQKSASSSPA-LDREKFPPLP 553

>Scas_702.9
          Length = 852

 Score = 28.5 bits (62), Expect = 2.8,   Method: Composition-based stats.
 Identities = 16/55 (29%), Positives = 30/55 (54%), Gaps = 7/55 (12%)

Query: 53  VTNGWHTVEENSLSSAGASEQHSGAQATHVSEGDSENDSDVESTYRSGSEWESSV 107
           ++N  H++ E S ++       SG   T + E ++E+D DV+   R+G  W+ S+
Sbjct: 665 ISNTLHSINEESTATIP-----SGNDDTIIVENEAEDDIDVD--LRNGLYWDRSI 712

>Scas_639.10
          Length = 772

 Score = 28.5 bits (62), Expect = 3.2,   Method: Composition-based stats.
 Identities = 23/80 (28%), Positives = 39/80 (48%), Gaps = 8/80 (10%)

Query: 72  EQHSGAQATHVSEGDSENDSDVESTYRSGSEWESSVTPAEIEEGELKPAPLLGVIQGSYS 131
           EQ S A +T  SE   + D+   +T  S ++ + + +P +++ GE    PL       ++
Sbjct: 612 EQKSPATSTTSSEIPKDTDNTTGTTEVSTTQQDDNSSPMDLQNGEEDETPL-------FT 664

Query: 132 RLSDLITVTVST-GADSRRV 150
           + S L+     T G DSR V
Sbjct: 665 QRSKLMVFNPETKGYDSRGV 684

>Kwal_27.10318
          Length = 925

 Score = 27.3 bits (59), Expect = 7.0,   Method: Composition-based stats.
 Identities = 15/67 (22%), Positives = 33/67 (49%), Gaps = 3/67 (4%)

Query: 53  VTNGWHTVEENSLSSAGASEQHSGAQATHVSEGDSENDSDVESTYRSGSEWESSVTPAEI 112
           V+   H VE   +  A   +     +    S+ D+E+++D++ + + G E + S   A +
Sbjct: 704 VSTPVHVVENPQVQGANKLDGEHQVEPVFESDTDTESETDLQGSLKQGFEVKQS---ASV 760

Query: 113 EEGELKP 119
           E+ + +P
Sbjct: 761 EKADTQP 767

>Sklu_2377.1 YPL126W, Contig c2377 154-2751
          Length = 865

 Score = 26.9 bits (58), Expect = 9.0,   Method: Composition-based stats.
 Identities = 23/82 (28%), Positives = 35/82 (42%), Gaps = 15/82 (18%)

Query: 21  VARHALLTLAVLLVGPVIA---LYAYDFGLYMWRVVTNGWHTVEENSLSSAGASEQHSGA 77
           VA H  L    LL+G ++    LY Y  G+Y            +   L    A ++ SG 
Sbjct: 655 VATHNTLNAVNLLLGTIVKSFDLYPYVNGVY------------KSGHLDRLIACDEKSGR 702

Query: 78  QATHVSEGDSENDSDVESTYRS 99
            A  +++    +DS  E +YRS
Sbjct: 703 IALVINQKLKSHDSKTELSYRS 724

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.313    0.129    0.371 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 5,028,877
Number of extensions: 200373
Number of successful extensions: 951
Number of sequences better than 10.0: 54
Number of HSP's gapped: 934
Number of HSP's successfully gapped: 68
Length of query: 163
Length of database: 16,596,109
Length adjustment: 94
Effective length of query: 69
Effective length of database: 13,342,017
Effective search space: 920599173
Effective search space used: 920599173
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 57 (26.6 bits)