Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_55.2160044243620370.0
ACR082C42243910731e-144
KLLA0F15972g45845210431e-139
YOR043W (WHI2)48648610071e-133
Scas_699.465125069861e-129
Scas_615.84474668491e-110
Sklu_1533.11921925413e-67
CAGL0C03894g62765682.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_55.21600
         (436 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_55.21600                                                         789   0.0  
ACR082C [1129] [Homologous to ScYOR043W (WHI2) - SH] (503954..50...   417   e-144
KLLA0F15972g complement(1481761..1483137) similar to sp|P12611 S...   406   e-139
YOR043W (WHI2) [4854] chr15 (410869..412329) Protein involved in...   392   e-133
Scas_699.46                                                           384   e-129
Scas_615.8                                                            331   e-110
Sklu_1533.1 YOR043W, Contig c1533 830-1408 reverse complement         213   3e-67
CAGL0C03894g complement(381514..383397) weakly similar to sp|P40...    31   2.8  

>Kwal_55.21600
          Length = 442

 Score =  789 bits (2037), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/436 (89%), Positives = 389/436 (89%)

Query: 1   MQSVITQVSADQGPIPVMQEQNQEFLDDDSLIHLNIQENHYYITRDQXXXXXXXXXXXXX 60
           MQSVITQVSADQGPIPVMQEQNQEFLDDDSLIHLNIQENHYYITRDQ             
Sbjct: 1   MQSVITQVSADQGPIPVMQEQNQEFLDDDSLIHLNIQENHYYITRDQLMSLPESLLLCLF 60

Query: 61  XXGVFMNRTGQVITNLTSQDEVYIGNFPPACFEYIMENYVRAQEDLLNFPVDEIFDRGLS 120
             GVFMNRTGQVITNLTSQDEVYIGNFPPACFEYIMENYVRAQEDLLNFPVDEIFDRGLS
Sbjct: 61  PSGVFMNRTGQVITNLTSQDEVYIGNFPPACFEYIMENYVRAQEDLLNFPVDEIFDRGLS 120

Query: 121 SPKEQSRFFGFPXXXXXXXXXXGGEAEILHEKPSIIVLREDLDYYCVPQMKLAYPPDTPQ 180
           SPKEQSRFFGFP          GGEAEILHEKPSIIVLREDLDYYCVPQMKLAYPPDTPQ
Sbjct: 121 SPKEQSRFFGFPSSHSSMQNSSGGEAEILHEKPSIIVLREDLDYYCVPQMKLAYPPDTPQ 180

Query: 181 ELRNELLDNFMAEVKLAAGSYLSQQTSVFQGLCSSNRLKRPQKNSNGENKQKLGPAEQHL 240
           ELRNELLDNFMAEVKLAAGSYLSQQTSVFQGLCSSNRLKRPQKNSNGENKQKLGPAEQHL
Sbjct: 181 ELRNELLDNFMAEVKLAAGSYLSQQTSVFQGLCSSNRLKRPQKNSNGENKQKLGPAEQHL 240

Query: 241 MDMLCSSGFHDSSTWGNRAQEPGKTVISSLSLCRLANETTQDFRDKVDAAKRKHEDELKS 300
           MDMLCSSGFHDSSTWGNRAQEPGKTVISSLSLCRLANETTQDFRDKVDAAKRKHEDELKS
Sbjct: 241 MDMLCSSGFHDSSTWGNRAQEPGKTVISSLSLCRLANETTQDFRDKVDAAKRKHEDELKS 300

Query: 301 LRGAQDSTYSLTPKGSRSSPSAQPDPKRKSRLSSLXXXXXXXXXXXXXXXXXXXXXXAPT 360
           LRGAQDSTYSLTPKGSRSSPSAQPDPKRKSRLSSL                      APT
Sbjct: 301 LRGAQDSTYSLTPKGSRSSPSAQPDPKRKSRLSSLADNVRSRSASRNRSSSRQRVDQAPT 360

Query: 361 LYELVPRPDINSKLLLFWKKPARKCWWGEEDTSLELKLYGELDSSTGELVLRQSGPVVSL 420
           LYELVPRPDINSKLLLFWKKPARKCWWGEEDTSLELKLYGELDSSTGELVLRQSGPVVSL
Sbjct: 361 LYELVPRPDINSKLLLFWKKPARKCWWGEEDTSLELKLYGELDSSTGELVLRQSGPVVSL 420

Query: 421 SVPVKLHIRRVWTLEL 436
           SVPVKLHIRRVWTLEL
Sbjct: 421 SVPVKLHIRRVWTLEL 436

>ACR082C [1129] [Homologous to ScYOR043W (WHI2) - SH]
           (503954..505222) [1269 bp, 422 aa]
          Length = 422

 Score =  417 bits (1073), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 230/439 (52%), Positives = 287/439 (65%), Gaps = 31/439 (7%)

Query: 2   QSVITQVSADQ--GPIPVMQEQNQ-EFLDDDSLIHLNIQENHYYITRDQXXXXXXXXXXX 58
           QS+ITQVS +Q  G   +M EQ + ++ D+++LIHLNIQ  HYYITR+Q           
Sbjct: 5   QSIITQVSPEQQLGGSQLMTEQIEPDYYDENTLIHLNIQGRHYYITREQLMSLPESLLLC 64

Query: 59  XXXXGVFMNRTGQVITNLTSQDEVYIGNFPPACFEYIMENYVRAQEDLLNFPVDEIFDRG 118
               GVFMNR GQVITNLT +DEVYI NFPP CFE IME Y  AQ DL NFPV E   R 
Sbjct: 65  FFPSGVFMNREGQVITNLTPEDEVYIANFPPKCFESIMETYTTAQRDLENFPVGEFGRRA 124

Query: 119 -LSSPKEQSRFFGFPXXXXXXXXXXGGEAEILHEKPSIIVLREDLDYYCVPQMKLAYPPD 177
             + PK    F G              E++ILHEKP+IIVLREDLDYYCVP + LA   D
Sbjct: 125 PHAGPKG---FLGLTPSQSQPM----SESQILHEKPAIIVLREDLDYYCVPSVSLALE-D 176

Query: 178 TPQELRNELLDNFMAEVKLAAGSYLSQQTSVFQGLCSSNRLKRPQKNSNGENKQKLGPAE 237
             +E ++ LL+  MA+VK AAGS+L QQ SVF+GL SSNR++RP      +   +LGPAE
Sbjct: 177 GSREGQDILLEQLMAQVKNAAGSHLCQQRSVFKGLYSSNRVRRPDAQHQPD---QLGPAE 233

Query: 238 QHLMDMLCSSGFHDSSTWGNRAQEPGKTVISSLSLCRLANETTQDFRDKVDAAKRKHEDE 297
           QHLMDMLC+SGF + S WGNR+QEPGKTVISSLSLCRL NET Q+FRD+V AA+R+++++
Sbjct: 234 QHLMDMLCASGFREHSDWGNRSQEPGKTVISSLSLCRLMNETVQEFRDQVAAARRRYDED 293

Query: 298 LKSLRGAQDSTYSLTPKGSRSSPSAQPDPKRKSRLSSLXXXXXXXXXXXXXXXXXXXXXX 357
                        +TP  + + PS   D KRKSRLS+                       
Sbjct: 294 ------------HVTPDAASAPPSR--DQKRKSRLSTFTDNVRSRSSSRTRSSSRAPRE- 338

Query: 358 APTLYELVPRPDINSKLLLFWKKPARKCWWGEEDTSLELKLYGELDSSTGELVLRQSGPV 417
            P+LY+LVPRP+IN+KLLLFWKKPARKCWWG E  +++++L G  DS +G LVL ++ P+
Sbjct: 339 -PSLYDLVPRPEINTKLLLFWKKPARKCWWGLETITVDVQLNGHYDSESGTLVLSRNSPL 397

Query: 418 VSLSVPVKLHIRRVWTLEL 436
             L++PV LHIRRVWTLEL
Sbjct: 398 CVLTIPVNLHIRRVWTLEL 416

>KLLA0F15972g complement(1481761..1483137) similar to sp|P12611
           Saccharomyces cerevisiae YOR043w WHI2 growth regulation
           protein singleton, start by similarity
          Length = 458

 Score =  406 bits (1043), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 229/452 (50%), Positives = 275/452 (60%), Gaps = 25/452 (5%)

Query: 2   QSVITQVSADQGPIPVMQE-QNQEFLD------DDSLIHLNIQENHYYITRDQXXXXXXX 54
           QS+ITQV+ D G        Q+  ++D      +D+LIHLNIQE HYYITR Q       
Sbjct: 9   QSIITQVTPDGGGASGALLGQDGSYIDYEQYNEEDTLIHLNIQEKHYYITRTQLMSLPES 68

Query: 55  XXXXXXXXGVFMNRTGQVITNLTSQDEVYIGNFPPACFEYIMENYVRAQEDLLNFPVDEI 114
                   GVFM+R GQ+ITNLT  DEVYI NF   CFEYIM+ Y +A  D LNFPV+EI
Sbjct: 69  LLLCLFPSGVFMDRDGQIITNLTPDDEVYIPNFSTECFEYIMDVYNQAHTDYLNFPVNEI 128

Query: 115 FDRGLSSPKEQSRFFGFPXXXXXXXXXXGGEAEILHEKPSIIVLREDLDYYCVPQMKLAY 174
           F+R   +    S    F             E+EILHEKP IIVLREDLDYYCVPQ+ + Y
Sbjct: 129 FNRK-GTNGSSSGGNNFFNFGSSNNSSSSQESEILHEKPGIIVLREDLDYYCVPQVSVEY 187

Query: 175 PPDTPQELRNELLDNFMAEVKLAAGSYLSQQTSVFQGLCSSNRLKRPQKNSNGENKQ--- 231
           P  +    + ELL N M ++KLAAGS+L +QTSVF GL SSNR K+P K++  +  +   
Sbjct: 188 PEGSSDMEKEELLHNLMVQIKLAAGSHLLKQTSVFLGLKSSNRAKKPTKSNQVDGTKSST 247

Query: 232 ---KLGPAEQHLMDMLCSSGFHDSSTWGNRAQEPGKTVISSLSLCRLANETTQDFRDKVD 288
              KLG AEQHLMDMLCSSGF   S WGNR+QE  KTVISSLSLCRLANETTQ+FRD V 
Sbjct: 248 GTVKLGSAEQHLMDMLCSSGFKTESVWGNRSQEMDKTVISSLSLCRLANETTQEFRDAVA 307

Query: 289 AAKRKHEDELKSLRGAQ----DSTYSLTPKGSRSSPSAQPDPKRKSRLSSLXXXXXXXXX 344
            AK K++D+ KS+         S   LTP  SR+      D KRKSRLS           
Sbjct: 308 VAKAKYDDDQKSIASTMTNDTSSNMKLTPTPSRT------DVKRKSRLSVFSENVRSRSR 361

Query: 345 XXXXXXXXXXXXXAPTLYELVPRPDINSKLLLFWKKPARKCWWGEEDTSLELKLYGELDS 404
                        +PTLYELVP+PDIN+KLLLFWKKPARKCWWG+E   LE+      ++
Sbjct: 362 SRNRSASRQRANESPTLYELVPKPDINTKLLLFWKKPARKCWWGQELVDLEVDFPAIFEN 421

Query: 405 STGELVLRQSGPVVSLSVPVKLHIRRVWTLEL 436
            T   +   +  +  L VPVK+HIRRVWTLEL
Sbjct: 422 DTLT-IFPDNSKIQKLKVPVKIHIRRVWTLEL 452

>YOR043W (WHI2) [4854] chr15 (410869..412329) Protein involved in
           growth regulation and stress response [1461 bp, 486 aa]
          Length = 486

 Score =  392 bits (1007), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 234/486 (48%), Positives = 288/486 (59%), Gaps = 56/486 (11%)

Query: 1   MQSVITQVSADQG-PIPVMQ----------EQNQEFLDDDSLIHLNIQENHYYITRDQXX 49
           M  +ITQVS D     P++Q          E N+E   D SLIHLNIQENHY+ITRDQ  
Sbjct: 1   MDDIITQVSPDNAESAPILQEQQQQQNSQYEGNEEDYGD-SLIHLNIQENHYFITRDQLM 59

Query: 50  XXXXXXXXXXXXXGVFMNRTGQVITNLTSQDEVYIGNFPPACFEYIMENYVRAQEDLLNF 109
                        GVF++R GQVITNLT  DEVYI NFPP CFEYIME Y +A +DL N 
Sbjct: 60  SLPESLLLCLFPSGVFLDRCGQVITNLTRDDEVYIVNFPPDCFEYIMEIYTKAHDDLYNH 119

Query: 110 PVDEIFDRGLSSPKEQSR-FFGFPXXXXXXXXXXGGEAEILHEKPSIIVLREDLDYYCVP 168
           PV++ FDR  SS    ++ FFG              E +ILH+KP+IIVLREDLDYYCVP
Sbjct: 120 PVEKFFDRPSSSFVSNAKGFFGL---SSNNSISSNNEQDILHQKPAIIVLREDLDYYCVP 176

Query: 169 QMKLAYPPDTPQELRNE-LLDNFMAEVKLAAGSYLSQQTSVFQGLCSSNRLKRPQKNSNG 227
           Q +  +  D+  E  NE LL +FMA+VK+AAGSYL+ +TS+FQGL SSNRLK+ Q+    
Sbjct: 177 QEEFQF--DSTNEENNEDLLRHFMAQVKMAAGSYLTSKTSIFQGLYSSNRLKQQQQQQKI 234

Query: 228 EN-----------KQKLGPAEQHLMDMLCSSGFHDSSTWGNRAQEPGKTVISSLSLCRLA 276
           E             +KLGPAEQHLMDMLCSSGF   + WGNR QE GKTVISSLSLCRLA
Sbjct: 235 EKGSNSSSNTKSTSKKLGPAEQHLMDMLCSSGFTKETCWGNRTQETGKTVISSLSLCRLA 294

Query: 277 NETTQDFRDKVDAAKRKHEDELK-----------------SLRGAQDSTYSLTPKG--SR 317
           NETT+ FR K + AK K E E K                 SL  ++ ++   T +   S 
Sbjct: 295 NETTEGFRQKFNEAKAKWEAEHKPSQDNFITPMQSNISINSLSASKSNSTISTARNLTSG 354

Query: 318 SSPSAQPDPKRKSRLSSLXXXXXXXXXXXXXXXXXXXXXXAPTLYELVPRPDINSKLLLF 377
           S+  A    KRKSRLS L                       P LY+LVP+P+IN+KLLLF
Sbjct: 355 STAPATARDKRKSRLSKLADNVRSHSSSRHSSQTRSKPPELPKLYDLVPKPNINAKLLLF 414

Query: 378 WKKPARKCWWGEEDTSLELKLYGELDSSTGELV-------LRQSGPVVSLSVPVKLHIRR 430
           W+KPARKCWWGEED  LE++++G     + +++       +     +  + VPV+LHIRR
Sbjct: 415 WRKPARKCWWGEEDIELEVEVFGSWKDESKKIIELILPTNVDPEAELHKIIVPVRLHIRR 474

Query: 431 VWTLEL 436
           VWTLEL
Sbjct: 475 VWTLEL 480

>Scas_699.46
          Length = 512

 Score =  384 bits (986), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 224/506 (44%), Positives = 291/506 (57%), Gaps = 70/506 (13%)

Query: 1   MQSVITQV-----SADQGPIPVMQEQNQEFLDDDS--------LIHLNIQENHYYITRDQ 47
           MQ++ITQV     +   G      +QN  F D+DS        LIHLNIQENHY+ITRDQ
Sbjct: 1   MQNIITQVPENNSTTTTGNPLTSSDQNTSFYDNDSNDKENGDSLIHLNIQENHYFITRDQ 60

Query: 48  XXXXXXXXXXXXXXXGVFMNRTGQVITNLTSQDEVYIGNFPPACFEYIMENYVRAQEDLL 107
                          GVF++R+GQVI+NL+  DEVYI NFPP CFEYIME Y +AQ+DLL
Sbjct: 61  LMSLPESLLLCLFPSGVFLDRSGQVISNLSPDDEVYIVNFPPDCFEYIMEVYTKAQDDLL 120

Query: 108 NFPVDEIFDRGLSSPKEQSR--FFGF------------PXXXXXXXXXXGGEAEILHEKP 153
           N+PV++ FD+  +     S   FFGF                         E ++LH+KP
Sbjct: 121 NYPVEKYFDKASNHKLINSAKGFFGFGSSNSLSNVNSNTSSGTAASTTTTSEHDLLHQKP 180

Query: 154 SIIVLREDLDYYCVPQMKLAYPPDTPQELRNELLDNFMAEVKLAAGSYLSQQTSVFQGLC 213
           +IIVLREDLDYYCVPQ    +  +   E  ++LL  FMA+VK+AAGSYL+++TS+F+GL 
Sbjct: 181 AIIVLREDLDYYCVPQETFQFAKNESFENNDDLLHYFMAQVKIAAGSYLTKKTSIFEGLF 240

Query: 214 SSNRLKRPQ---------KNSNGENKQKLGPAEQHLMDMLCSSGFHDSSTWGNRAQEPGK 264
           SSNRLK            KNS+   +QKLGPAEQHLMDMLCSSGF D S WGNR QE GK
Sbjct: 241 SSNRLKDSHRKTSQRNNGKNSHKSRRQKLGPAEQHLMDMLCSSGFGDRSIWGNRTQESGK 300

Query: 265 TVISSLSLCRLANETTQDFRDKVDAAKRKHEDELKSLRGAQDSTYSLTPKGSRSSPSAQP 324
           TVISSL+LCRLANE+TQ+FRD    AK K E E    +   D   S++ + + ++ S  P
Sbjct: 301 TVISSLALCRLANESTQEFRDMYHRAKTKWELEHNVNQDQIDDVSSVSLQNNNTTNSIVP 360

Query: 325 -----------------------DPKRKSRLSSLXXXXXXXXXXXXXXXXXXXXXXA--- 358
                                  + ++K+RL++L                      +   
Sbjct: 361 SRSSTSVNIASNSNSSSKQSGPRESRKKNRLATLADNVRSHSTSRNSSLTRLRSSKSLEL 420

Query: 359 PTLYELVPRPDINSKLLLFWKKPARKCWWGEEDTSLELKLYGELDSSTGELVLRQ----- 413
           P LY+LVP+PDIN+KLLLFW+KPARKCWWGEED  +E+++YG       +++  Q     
Sbjct: 421 PKLYDLVPKPDINAKLLLFWRKPARKCWWGEEDIEVEIEIYGHWVDQEKKIIKLQLPHED 480

Query: 414 ---SGPVVSLSVPVKLHIRRVWTLEL 436
                 +  + +PV+LHIRRVWTLEL
Sbjct: 481 KDIEQQLNKIRIPVRLHIRRVWTLEL 506

>Scas_615.8
          Length = 447

 Score =  331 bits (849), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 195/466 (41%), Positives = 267/466 (57%), Gaps = 55/466 (11%)

Query: 1   MQSVITQVSADQGPIP--------VMQEQNQEFLDDDSLIHLNIQENHYYITRDQXXXXX 52
           M+++ITQV  + G +P        + QE    + + +SL+HLNIQENHY++TRDQ     
Sbjct: 1   MENIITQVPQN-GAVPNGFINQSGLEQEDLSNYDNGNSLVHLNIQENHYFLTRDQLMTLP 59

Query: 53  XXXXXXXXXXGVFMNRTGQVITNLTSQDEVYIGNFPPACFEYIMENYVRAQEDLLNFPVD 112
                     GVF++R  QVITNLT++DEV+I NFP  CFEYIME Y++A +DLLNFPV 
Sbjct: 60  ESLLLCLFPSGVFLDRADQVITNLTAEDEVFITNFPATCFEYIMEFYMKANDDLLNFPVL 119

Query: 113 EIFDRGLSSPKEQSRFFGFPXXXXXXXXXXGGEAEILHEKPSIIVLREDLDYYCVPQMKL 172
           E F   + +    +R+                +  ILHE PSIIVLREDLDYYCVPQ++ 
Sbjct: 120 EQFP-SIRNANNHTRY------QHPQTQQQFEQDAILHENPSIIVLREDLDYYCVPQLEF 172

Query: 173 AYP------PDTPQELRNELLDNFMAEVKLAAGSYLSQQTSVFQGLCSSNRLKRPQKNS- 225
            +       P   Q ++++LL + M+++K+AAGSYL  QTS+FQGL  SN++ + + +  
Sbjct: 173 EFEPLPEGRPPLDQYMKDDLLQHCMSQLKVAAGSYLLNQTSIFQGLYLSNKIHQHEVSQV 232

Query: 226 --NGENKQK-LGPAEQHLMDMLCSSGFHDSSTWGNRAQEPGKTVISSLSLCRLANETTQD 282
             +G  K   LGPAEQHLMDMLCSSGF   S WGNR QE GKT+ISSLSLCRL NE+T+D
Sbjct: 233 PLHGSGKSSTLGPAEQHLMDMLCSSGFLPESQWGNRTQEFGKTIISSLSLCRLYNESTED 292

Query: 283 FRDKVDAAKRKHEDELKSLRGAQDSTYSLTPKGSRSSPSAQPDPKRKSRLSSLXXXXXXX 342
           FR+ V    +  +    S  G +  +  +   G  +S     D  R S + +        
Sbjct: 293 FRNAVTREMKNWKKNKDSNDGTKRFSMPIMEDG--NSGRNIDDNVRNSVMIA-------- 342

Query: 343 XXXXXXXXXXXXXXXAPTLYELVPRPDINSKLLLFWKKPARKCWWGEEDTSLELKLYGEL 402
                             +Y+LVP+P IN+KLLLFW+KPARK WW  E+  LE+++YG +
Sbjct: 343 -------DDININSMPDDVYKLVPKPTINNKLLLFWRKPARKSWWSAENVELEVEIYGSI 395

Query: 403 DSSTGELVLRQSGP------------VVSLSVPVKLHIRRVWTLEL 436
            +  G   +    P              ++ +P+KLHIRRVWTLEL
Sbjct: 396 VNVNGVNKVVLRVPQENANANDNEFVTNTVKIPIKLHIRRVWTLEL 441

>Sklu_1533.1 YOR043W, Contig c1533 830-1408 reverse complement
          Length = 192

 Score =  213 bits (541), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 112/192 (58%), Positives = 130/192 (67%), Gaps = 7/192 (3%)

Query: 18  MQEQNQEFLDDDSLIHLNIQENHYYITRDQXXXXXXXXXXXXXXXGVFMNRTGQVITNLT 77
           MQ  +QE+ DDDSLIHLNIQENHYYITRD                GVFM+R GQVITNLT
Sbjct: 1   MQPTSQEYSDDDSLIHLNIQENHYYITRDHLMSLPESLLLCLFPSGVFMDRMGQVITNLT 60

Query: 78  SQDEVYIGNFPPACFEYIMENYVRAQEDLLNFPVDEIFDRGLSSPKEQSRFFGFPXXXXX 137
           S DEVYIGNFPP CFEYIME Y  AQEDL+ +  DE F++   + KE  RFFGF      
Sbjct: 61  SDDEVYIGNFPPDCFEYIMETYSAAQEDLVKYTFDETFNKN-PNDKEHGRFFGF---SCS 116

Query: 138 XXXXXGGEAEILHEKPSIIVLREDLDYYCVPQMKLAYPPDTPQELRNELLDNFMAEVKLA 197
                  EA+ILHEKPSIIVLREDLDYYCV Q ++ +     +E ++ LL + MAEVK+A
Sbjct: 117 SAPSSSNEADILHEKPSIIVLREDLDYYCVRQPEVTF---ASEEEKDTLLTHLMAEVKIA 173

Query: 198 AGSYLSQQTSVF 209
           AGSYLS Q S+F
Sbjct: 174 AGSYLSNQCSIF 185

>CAGL0C03894g complement(381514..383397) weakly similar to sp|P40549
           Saccharomyces cerevisiae YIL014w MNT3, hypothetical
           start
          Length = 627

 Score = 30.8 bits (68), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 30/65 (46%), Gaps = 3/65 (4%)

Query: 261 EPGKT--VISSLSLCRLANETTQDFRDKVDAAKRKHEDELKSLRGAQDSTYSLTPKGSRS 318
           E GK   V   + +C+  N   +DF D  +  K +H+D    L+   DST +L    +  
Sbjct: 500 EDGKLDWVNGGMQVCKFKNAAMKDFTDDPEFFKSRHKDA-AVLQNFYDSTVTLDGYMTAD 558

Query: 319 SPSAQ 323
            PS Q
Sbjct: 559 PPSCQ 563

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.133    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 13,239,034
Number of extensions: 524848
Number of successful extensions: 1576
Number of sequences better than 10.0: 17
Number of HSP's gapped: 1581
Number of HSP's successfully gapped: 18
Length of query: 436
Length of database: 16,596,109
Length adjustment: 105
Effective length of query: 331
Effective length of database: 12,961,219
Effective search space: 4290163489
Effective search space used: 4290163489
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 63 (28.9 bits)