Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_55.2159146946323040.0
KLLA0E12925g3842541262e-07
YDR370C4421521075e-05
Scas_676.6415163950.001
Sklu_2324.2383269950.001
CAGL0C01925g400280930.002
YGL246C (RAI1)387179880.009
Kwal_47.19276386266830.034
Kwal_27.970551551682.7
Kwal_47.17621144680665.9
Kwal_47.1820625751646.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_55.21591
         (463 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_55.21591                                                         892   0.0  
KLLA0E12925g complement(1140409..1141563) similar to sp|P53063 S...    53   2e-07
YDR370C (YDR370C) [1196] chr4 complement(1217770..1219098) Prote...    46   5e-05
Scas_676.6                                                             41   0.001
Sklu_2324.2 YGL246C, Contig c2324 2470-3621                            41   0.001
CAGL0C01925g complement(202920..204122) similar to sp|P53063 Sac...    40   0.002
YGL246C (RAI1) [1754] chr7 complement(37617..38780) Protein that...    39   0.009
Kwal_47.19276                                                          37   0.034
Kwal_27.9705                                                           31   2.7  
Kwal_47.17621                                                          30   5.9  
Kwal_47.18206                                                          29   6.5  

>Kwal_55.21591
          Length = 469

 Score =  892 bits (2304), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 430/463 (92%), Positives = 430/463 (92%)

Query: 1   MGRLPECLDTKPEVKATFEYHELPTSSPNVAPIVKALECSKYEDLAVYNDLDERFQDYLD 60
           MGRLPECLDTKPEVKATFEYHELPTSSPNVAPIVKALECSKYEDLAVYNDLDERFQDYLD
Sbjct: 1   MGRLPECLDTKPEVKATFEYHELPTSSPNVAPIVKALECSKYEDLAVYNDLDERFQDYLD 60

Query: 61  ANHCKSLRMLFNNEEPGNYNPKGISIASPRLIRLYLAATQKRYLPKNIDVLTNRGDLVDL 120
           ANHCKSLRMLFNNEEPGNYNPKGISIASPRLIRLYLAATQKRYLPKNIDVLTNRGDLVDL
Sbjct: 61  ANHCKSLRMLFNNEEPGNYNPKGISIASPRLIRLYLAATQKRYLPKNIDVLTNRGDLVDL 120

Query: 121 AVSFFPGKDNNFEKMNHVVYLKSGRLFLWHDRARDDTFSNSRSRKNWYSGHKFEHMCTHT 180
           AVSFFPGKDNNFEKMNHVVYLKSGRLFLWHDRARDDTFSNSRSRKNWYSGHKFEHMCTHT
Sbjct: 121 AVSFFPGKDNNFEKMNHVVYLKSGRLFLWHDRARDDTFSNSRSRKNWYSGHKFEHMCTHT 180

Query: 181 WPDDVKTWGPLPPLDEAAPPTLSLVQLPLSEDMNVLMMAEYDVRLPKRQGLSGFAELKCF 240
           WPDDVKTWGPLPPLDEAAPPTLSLVQLPLSEDMNVLMMAEYDVRLPKRQGLSGFAELKCF
Sbjct: 181 WPDDVKTWGPLPPLDEAAPPTLSLVQLPLSEDMNVLMMAEYDVRLPKRQGLSGFAELKCF 240

Query: 241 QPRMNNSKCDQISWHXXXXXXXXXXXXTNTTYMRFFKTLLQSRLSGCENLIYGIRNNKTS 300
           QPRMNNSKCDQISWH            TNTTYMRFFKTLLQSRLSGCENLIYGIRNNKTS
Sbjct: 241 QPRMNNSKCDQISWHKLSNSKILKLLITNTTYMRFFKTLLQSRLSGCENLIYGIRNNKTS 300

Query: 301 LVGVRRFHITQIELRLQQLQPDIYHSYYLKALKNVAEFLKYMYHNCEEGKFYLIQKQNAK 360
           LVGVRRFHITQIELRLQQLQPDIYHSYYLKALKNVAEFLKYMYHNCEEGKFYLIQKQNAK
Sbjct: 301 LVGVRRFHITQIELRLQQLQPDIYHSYYLKALKNVAEFLKYMYHNCEEGKFYLIQKQNAK 360

Query: 361 SPLSVTSTAREHLTFKNIFTDDFTLLLEKSEKTRRDFMHKSRPGLNRSQESKHLDKFEFK 420
           SPLSVTSTAREHLTFKNIFTDDFTLLLEKSEKTRRDFMHKSRPGLNRSQESKHLDKFEFK
Sbjct: 361 SPLSVTSTAREHLTFKNIFTDDFTLLLEKSEKTRRDFMHKSRPGLNRSQESKHLDKFEFK 420

Query: 421 PSSPDXXXXXXXXXXXXXXXXXXXXXLTSSLANLSLKQAEHIK 463
           PSSPD                     LTSSLANLSLKQAEHIK
Sbjct: 421 PSSPDRKKPATKRSRSRKAKKKEEETLTSSLANLSLKQAEHIK 463

>KLLA0E12925g complement(1140409..1141563) similar to sp|P53063
           Saccharomyces cerevisiae YGL246c RAI1 singleton, start
           by similarity
          Length = 384

 Score = 53.1 bits (126), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 62/254 (24%), Positives = 108/254 (42%), Gaps = 48/254 (18%)

Query: 108 IDVLTNRGDLVDLAVSFFPGKDNNFEKMNHVVYLKSGRLFLWHDRARDDTFSNSRSRKN- 166
           +D++T RG +  L  S F    + F  +N  +    G+LF+   +      S +++R++ 
Sbjct: 99  VDIITFRGIIRKLISSAFDS--SQFNPVNFRIVSFDGQLFIKEVKTDASETSINKNRESL 156

Query: 167 ----WYSGHKFEHMCTHTWPDDVKTWGPLPPLD--EAAPPTL--------SLVQLPLSED 212
               +YSG+KFE + T + P       PL P    E  P  +        S+V+  + + 
Sbjct: 157 QARAYYSGYKFEALATLSLP------LPLVPRTTLEKRPKKIINNGDQFISMVRTGIGK- 209

Query: 213 MNVLMMAE----YDVRLPKRQGLSGFAELKCFQPRMNNSKCDQISWHXXXXXXXXXXXXT 268
             +L+ AE    +D +      L  +AELKC    M N+  D   +              
Sbjct: 210 CKILIGAEVDCIFDFKEDSDDNLKHYAELKC--TTMVNTVSDAHKFER------------ 255

Query: 269 NTTYMRFFKTLLQSRLSGCENLIYGIRNNKTSLVGVRRFHITQIELRLQQLQPDIYHSYY 328
                + FKT LQ  L G   +IYG R++   L  V  F  +++ L L+   P +  +  
Sbjct: 256 -----KLFKTWLQCFLVGINRIIYGFRDDNFMLKTVEEFTTSEVPLILKNNNPQM-QTVC 309

Query: 329 LKALKNVAEFLKYM 342
           + A+K    F +++
Sbjct: 310 VDAIKWYGAFTEWL 323

>YDR370C (YDR370C) [1196] chr4 complement(1217770..1219098) Protein
           of unknown function [1329 bp, 442 aa]
          Length = 442

 Score = 45.8 bits (107), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 42/152 (27%), Positives = 67/152 (44%), Gaps = 21/152 (13%)

Query: 104 LPKNIDVLTNRGDLVDLAVSFFPGKDNNFEKMNHVVYLKSGRLFLWHDRARDDTFS---- 159
           + K   V+T R  +VDL +  F  ++     +  V Y+ +G L    +  +D   S    
Sbjct: 180 IGKKFTVVTTRHHIVDLTMHLFNRRNRQTSLI--VTYMGAGLLSFCRNVKKDSQMSKEGI 237

Query: 160 ---NSRSRKNWYSGHKFEHMCTHTWPDDVKTWGPLPPLDEAAPPTLSLVQLPLSEDMNVL 216
              +   +K  YSG +FE+  T            +  L  +  P  SLV+  LSE++ +L
Sbjct: 238 YSNDPNMKKICYSGFEFENWVTEN--------SKVADLTGSKCPIFSLVESKLSEEIGLL 289

Query: 217 MMAEYDVRLPKRQGLSGFAELKCFQP-RMNNS 247
           +  E D   P  +  +   ELKCF P  M+NS
Sbjct: 290 IRCEMDAFNPVSETNT---ELKCFAPLSMHNS 318

>Scas_676.6
          Length = 415

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/163 (25%), Positives = 71/163 (43%), Gaps = 24/163 (14%)

Query: 102 RYLP-KNIDVLTNRGDLVDLAVSFFPGKDNNFEKMN-------HVVYL--KSGRLFLWHD 151
           +Y P +  ++++ R  +V++ +  F GK NN+           +VVY   ++GRL    D
Sbjct: 135 KYKPGRKFNIVSTRHHIVEMTMKLFTGKTNNYNNTKKVQDYVLNVVYTGDETGRLLFTKD 194

Query: 152 RARDDTFSNSRS-------RKNWYSGHKFEHMCTHTWPDDVKTWGPLPPLDEAAPPTLSL 204
            +      N          ++  YSG   E + T T  +  K    L   ++A     ++
Sbjct: 195 WSNTGNSMNEGIYSKNIILKRICYSGFALEDLMTETTSELEKEGEKLTGGEKAV---FAV 251

Query: 205 VQLPLSEDMNVLMMAEYDVRLPKRQGLSGFAELKCFQP-RMNN 246
           V+  L +D+ +L+  E D           F ELKCF P +M+N
Sbjct: 252 VENKLDDDICILLRCELDAF---NGAEKKFTELKCFSPLKMSN 291

>Sklu_2324.2 YGL246C, Contig c2324 2470-3621
          Length = 383

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 60/269 (22%), Positives = 109/269 (40%), Gaps = 65/269 (24%)

Query: 100 QKRYLPKNIDVLTNRGDLVDLAVSFFPGKDN-NFEKMNHVVYLKSGRLFLWHDRARDDTF 158
           Q++      D++T RG +  L  S F   DN  + ++N  +    G+LF+   +   + F
Sbjct: 92  QRKNKKAKADIITFRGIIRKLISSAF---DNPRYNRVNLRIVSFDGQLFI---KEVGEPF 145

Query: 159 -----SNSRSRKNWYSGHKFEHMCTHTWPDDVKTWGPLP-PLDEAAPPTL---------- 202
                ++S   +++YSG+KFE + T            LP PL E +  TL          
Sbjct: 146 VPPKTTDSIEHRSYYSGYKFESLVT------------LPKPLGEVSRTTLEKRPKKIVNN 193

Query: 203 -----SLVQLPLSEDMNVLMMAE----YDVRLPKRQGLSGFAELKCFQPRMNNSKCDQIS 253
                S+V+  + +   +++ AE    +D +      L  + ELKC +     ++     
Sbjct: 194 GEQYISVVRTGVGKS-KLILGAEVDCVFDFKEDSGDNLKHYTELKCTKGVTTIAEARAFE 252

Query: 254 WHXXXXXXXXXXXXTNTTYMRFFKTLLQSRLSGCENLIYGIRNNKTSLVGVRRFHITQIE 313
                               + FKT LQ  L G   +IYG R++   L  V  F   +I 
Sbjct: 253 -------------------RKIFKTWLQCFLVGVNRVIYGFRDDNFILKSVEEFSTQEIP 293

Query: 314 LRLQQLQPDIYHSYYLKALKNVAEFLKYM 342
           + L+   P + ++  + A+K    F +++
Sbjct: 294 IILKNNNPQMTNA-CVDAIKWYGAFTEWL 321

>CAGL0C01925g complement(202920..204122) similar to sp|P53063
           Saccharomyces cerevisiae YGL246c RAI1, start by
           similarity
          Length = 400

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 66/280 (23%), Positives = 116/280 (41%), Gaps = 57/280 (20%)

Query: 91  LIRLYLAATQKRYLPKNIDVLTNRGDLVDLA-VSFFPGKDNNFEKMNHVVYLKSGRLFLW 149
           L+   +   +K+    N+D++T RG +  L   S  P    NF K++  +    G+LF+ 
Sbjct: 82  LLDTLMEYEKKKNKKSNVDIITFRGIMSKLIRASMEP---PNFNKVDLRIVSYDGQLFIK 138

Query: 150 ----HDRARDDTFSN----------SRSRKNWYSGHKFEHMCTHTWP-----DDVKTWGP 190
               ++ A +++ S+          SR + + Y+G+KFE + T   P      +V    P
Sbjct: 139 DVSDYNAATNESNSSGVNSRQQAGTSRQQIDTYTGYKFEGIATLDKPLPYVEREVIEKRP 198

Query: 191 LPPLDEAAPPTLSLVQLPLSEDMNVLMMAE----YDVRLPKRQGLSGFAELKCFQPRMNN 246
              L+      +++V+  + E   V++ AE    +D +   +  L  + ELKC       
Sbjct: 199 RKILNNG-DEYITVVRTGVGE-CKVVLGAEIDCIFDFKEEGKDNLKHYTELKC------- 249

Query: 247 SKCDQISWHXXXXXXXXXXXXTNTTYMRF----FKTLLQSRLSGCENLIYGIRNNKTSLV 302
               QIS              T     RF    F+  LQ  L G   +IYG R+++  L 
Sbjct: 250 --SSQIS--------------TTNDVRRFEKKMFRAWLQCFLVGVPRVIYGFRDDQYMLK 293

Query: 303 GVRRFHITQIELRLQQLQPDIYHSYYLKALKNVAEFLKYM 342
            V  F   +I + ++   P +  S  L A+K    F  ++
Sbjct: 294 TVEEFSTEEIPVIIKANNPTLGQS-CLDAIKWYGLFTDWL 332

>YGL246C (RAI1) [1754] chr7 complement(37617..38780) Protein that
           binds and enhances function of nuclear exonuclease Rat1p
           [1164 bp, 387 aa]
          Length = 387

 Score = 38.5 bits (88), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 42/179 (23%), Positives = 76/179 (42%), Gaps = 35/179 (19%)

Query: 166 NWYSGHKFEHMCTHTWPDDVKTWGPLPPLDEA-------APPTLSLVQLPLSEDMNVLMM 218
           N ++G+KFE + T + P     + P   +++            +S+V+  +  +  +++ 
Sbjct: 164 NVFTGYKFETLATLSNP---LQYTPREVIEKRTKRIVSHGDEYISVVRTGVG-NCKLILG 219

Query: 219 AE----YDVRLPKRQGLSGFAELKCFQPRMNNSKCDQISWHXXXXXXXXXXXXTNTTYMR 274
           AE    +D +   R  L  +AELKC Q   N S                    T+    +
Sbjct: 220 AEVDCIFDFKENGRDNLKHYAELKCTQQVANISD-------------------THKFERK 260

Query: 275 FFKTLLQSRLSGCENLIYGIRNNKTSLVGVRRFHITQIELRLQQLQPDIYHSYYLKALK 333
            F+T LQ  L G   +IYG +++   L  V  F   ++ + L+   P +  S  L+A+K
Sbjct: 261 LFRTWLQCFLVGIPRIIYGFKDDHYVLKTVEEFSTEEVPVLLKNNNPQV-GSACLEAIK 318

>Kwal_47.19276
          Length = 386

 Score = 36.6 bits (83), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 57/266 (21%), Positives = 109/266 (40%), Gaps = 50/266 (18%)

Query: 80  NPKGISIASPRLIRLYLAATQKRYLPKNIDVLTNRGDLVDLAVSFFPGKDNNFEKMNHV- 138
           NP+  +     L++   A  +++    + D++T RG +  L  S F        K NHV 
Sbjct: 72  NPEVDACTLDGLLKTVQAYEERKQSKVSADIITFRGIIRKLISSAFDSP-----KYNHVN 126

Query: 139 --VYLKSGRLFL-----WHDRARDDTFSNSRSRKNWYSGHKFEHMCTHTWPDDVKTWGPL 191
             V   +G+LF+      H+  ++   +++   +++YSG+KFE + T + P       P 
Sbjct: 127 LRVVSFNGQLFIREATPIHEPPKN---TDAMQYRSYYSGYKFESLATLSKP---LPQTPR 180

Query: 192 PPLDEAAPPT-------LSLVQLPLSEDMNVLMMAE----YDVRLPKRQGLSGFAELKCF 240
             L++ +          +++V+  +  +  +++ AE    +D        L  +AELKC 
Sbjct: 181 SSLEKRSKKICNNGDQFVTVVRSGVG-NCKLVLGAEVDCVFDFAEDTSNNLKHYAELKCT 239

Query: 241 QPRMNNSKCDQISWHXXXXXXXXXXXXTNTTYMRFFKTLLQSRLSGCENLIYGIRNNKTS 300
           +     ++                         + FKT LQ  L G   +IYG R+    
Sbjct: 240 KGVSTFAEARSFE-------------------RKLFKTWLQCFLVGINRIIYGFRDEHFI 280

Query: 301 LVGVRRFHITQIELRLQQLQPDIYHS 326
           L  V  +   +I L L+   P + ++
Sbjct: 281 LRSVEEYGSHEIPLLLKNNNPQLTNA 306

>Kwal_27.9705
          Length = 515

 Score = 30.8 bits (68), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 25/51 (49%), Gaps = 3/51 (5%)

Query: 343 YHNCEEGKFYLIQKQNAKSPLSVTSTAREH-LTFKNIFTDDFTLLLEKSEK 392
           + NCE G  Y+ Q ++    LS      E  L+  N+  D FTLL E  EK
Sbjct: 180 FQNCEAGVIYIYQSKSGH--LSTDVRINEIPLSISNVIDDGFTLLDENIEK 228

>Kwal_47.17621
          Length = 1446

 Score = 30.0 bits (66), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 33/80 (41%), Gaps = 1/80 (1%)

Query: 47  VYNDLDERFQDYLDANHCKSLRMLFNNEEPGNYNPKGISIASPRLIRLYLAATQKRYLPK 106
           V  DL   F D L +   +       NEEP    P+  S+    +  ++L   +   LP 
Sbjct: 787 VNTDLLMSFYDILKSRKFQDFDEELTNEEPKICEPEAFSLPRKTIFNIFLQFVRSMPLPL 846

Query: 107 N-IDVLTNRGDLVDLAVSFF 125
           N +D +T  G +V L   F 
Sbjct: 847 NLVDRITPLGQIVSLNSPFL 866

>Kwal_47.18206
          Length = 257

 Score = 29.3 bits (64), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 24/51 (47%), Gaps = 4/51 (7%)

Query: 329 LKALKNVAEFLKYMYHNCEEGKFYLIQKQNAKSPLSVTSTAREHLTFKNIF 379
           L+ LK     L Y      E  F++I+KQN  SP S T     ++   N++
Sbjct: 91  LRKLKGTEYILAY----VREPDFWIIRKQNRSSPTSATPLQNYYIIGANVY 137

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.135    0.408 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 14,855,344
Number of extensions: 644586
Number of successful extensions: 1589
Number of sequences better than 10.0: 13
Number of HSP's gapped: 1609
Number of HSP's successfully gapped: 14
Length of query: 463
Length of database: 16,596,109
Length adjustment: 105
Effective length of query: 358
Effective length of database: 12,961,219
Effective search space: 4640116402
Effective search space used: 4640116402
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 63 (28.9 bits)