Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_55.2158746445819610.0
YOR042W (CUE5)4113755737e-69
KLLA0F15994g4273605154e-60
CAGL0L09933g4083814847e-56
Scas_699.454504044721e-53
ACR083C3753533532e-37
YDR273W (DON1)365771441e-09
Scas_615.8d581591164e-06
CAGL0M08580g197461108e-06
Scas_626.847539701.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_55.21587
         (458 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_55.21587                                                         759   0.0  
YOR042W (CUE5) [4853] chr15 (408424..409659) Protein containing ...   225   7e-69
KLLA0F15994g complement(1484383..1485666) weakly similar to sgd|...   202   4e-60
CAGL0L09933g 1067488..1068714 similar to tr|Q08412 Saccharomyces...   191   7e-56
Scas_699.45                                                           186   1e-53
ACR083C [1130] [Homologous to ScYOR042W - SH; ScYDR273W (DON1) -...   140   2e-37
YDR273W (DON1) [1104] chr4 (1010168..1011265) Component of the p...    60   1e-09
Scas_615.8d                                                            49   4e-06
CAGL0M08580g complement(855443..856036) weakly similar to tr|Q08...    47   8e-06
Scas_626.8                                                             32   1.3  

>Kwal_55.21587
          Length = 464

 Score =  759 bits (1961), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/458 (84%), Positives = 387/458 (84%)

Query: 1   MTESETKESVDEVSLSENVRASEPEQINDKAVEADLKVKETPESADSKAADXXXXXXXXX 60
           MTESETKESVDEVSLSENVRASEPEQINDKAVEADLKVKETPESADSKAAD         
Sbjct: 1   MTESETKESVDEVSLSENVRASEPEQINDKAVEADLKVKETPESADSKAADEIELEKPEP 60

Query: 61  XXXXXXXXXXXXXSATEANEPQENTKEAPVAPNDEEVRPALPKRKTSTQNVHENPILAQL 120
                        SATEANEPQENTKEAPVAPNDEEVRPALPKRKTSTQNVHENPILAQL
Sbjct: 61  KETPDKPQEETEKSATEANEPQENTKEAPVAPNDEEVRPALPKRKTSTQNVHENPILAQL 120

Query: 121 TEAFPGIDAKYVKAVLIASQGALDPAFNALLFLSDPSFEAEATVPTAVPQSSQSGNSRSP 180
           TEAFPGIDAKYVKAVLIASQGALDPAFNALLFLSDPSFEAEATVPTAVPQSSQSGNSRSP
Sbjct: 121 TEAFPGIDAKYVKAVLIASQGALDPAFNALLFLSDPSFEAEATVPTAVPQSSQSGNSRSP 180

Query: 181 TAVSQLQQDEILARQLDAQFNKGHARRGAPRSMDDXXXXXXXXXXXXXXXXXXXTAHGAG 240
           TAVSQLQQDEILARQLDAQFNKGHARRGAPRSMDD                   TAHGAG
Sbjct: 181 TAVSQLQQDEILARQLDAQFNKGHARRGAPRSMDDERRARERRIRERQREFERRTAHGAG 240

Query: 241 PLSPEEQRRYERMEAEDQEDNDFLSQLVDKDLPELREKVGRQVQETGRKVNDWLSGFRKN 300
           PLSPEEQRRYERMEAEDQEDNDFLSQLVDKDLPELREKVGRQVQETGRKVNDWLSGFRKN
Sbjct: 241 PLSPEEQRRYERMEAEDQEDNDFLSQLVDKDLPELREKVGRQVQETGRKVNDWLSGFRKN 300

Query: 301 WAXXXXXXXXXXXYPEFXXXXXXXXXXXXXXXXXXXEFEDYTRPEHRTARFNSFGAKVGD 360
           WA           YPEF                   EFEDYTRPEHRTARFNSFGAKVGD
Sbjct: 301 WAQDQSSQQQSSQYPEFSDRQQSQRRDTSSRRSSDSEFEDYTRPEHRTARFNSFGAKVGD 360

Query: 361 DSTTSSAKLASHGISLYNKGDKDVEDESDADIAPQLPSRNKAKDIQPETTYIDTPEAGTR 420
           DSTTSSAKLASHGISLYNKGDKDVEDESDADIAPQLPSRNKAKDIQPETTYIDTPEAGTR
Sbjct: 361 DSTTSSAKLASHGISLYNKGDKDVEDESDADIAPQLPSRNKAKDIQPETTYIDTPEAGTR 420

Query: 421 KKWQPLPPEPINVTPSKVNATASKNKRNSDVNDDDFLI 458
           KKWQPLPPEPINVTPSKVNATASKNKRNSDVNDDDFLI
Sbjct: 421 KKWQPLPPEPINVTPSKVNATASKNKRNSDVNDDDFLI 458

>YOR042W (CUE5) [4853] chr15 (408424..409659) Protein containing a
           CUE domain, has low similarity to uncharacterized C.
           albicans Orf6.1738p [1236 bp, 411 aa]
          Length = 411

 Score =  225 bits (573), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 150/375 (40%), Positives = 201/375 (53%), Gaps = 65/375 (17%)

Query: 98  RPALP-KRKTSTQNVHENPILAQLTEAFPGIDAKYVKAVLIASQGALDPAFNALLFLSDP 156
            P LP +RK+  +   ENPIL +L +AFP ++ KY+KAV+IASQG L PAFNALLFLSDP
Sbjct: 82  HPPLPARRKSEEEPSKENPILQELKDAFPNLEEKYIKAVIIASQGVLSPAFNALLFLSDP 141

Query: 157 SFEAEATVPTAVPQSSQSGNSRSPTAVSQLQQDEILARQLDAQFNKGHARRGAPRSMDDX 216
               +  +PT   + +    +R     +QL+QDE+LARQLD QFN  H+           
Sbjct: 142 ESGKDIELPTQPVRKNPEAPARR--RQTQLEQDELLARQLDEQFNSSHS----------- 188

Query: 217 XXXXXXXXXXXXXXXXXXTAHGAGPLSPEEQRRYER------MEAEDQEDNDFLSQLVDK 270
                                     S  EQRR            ED E+ D  SQ V+K
Sbjct: 189 ----------------RRRNRDRATRSMHEQRRRRHNPNEREQHHEDSEEEDSWSQFVEK 232

Query: 271 DLPELREKVGRQVQETGRKVNDWLS-GFRKNWAXXXXXXXXXXXYPEFXXXXXXXXXXXX 329
           DLPEL ++ GR +Q+T  KV++W+S  +R+N+A           + +             
Sbjct: 233 DLPELTDRAGRSLQDTANKVSNWISDAYRRNFASGNEQNDNQHGHQDQQEWEPEIVDLSQ 292

Query: 330 XXXXXXXEFEDYTRPEHRTARFNSFGAKVGDDSTTSSAKLASHGISLYNKGDKDVED--E 387
                  +     +PE R  RFNSFG +VGDDS      L SHGI+L+N      ED  E
Sbjct: 293 GGKNSRPQ-----QPERR--RFNSFGVQVGDDS------LESHGITLHN------EDGFE 333

Query: 388 SDADIAPQLPSRNKAKD----IQPETTYIDTPEAGTRKKWQPLPPEPINVTPSKVNATAS 443
            D D+ PQLP+R K+ +    +  ETTYIDTP+  T+KKWQPLPPEP++ TP+KVNA  S
Sbjct: 334 DDEDVPPQLPTRTKSGESTGKVVAETTYIDTPDTETKKKWQPLPPEPLDTTPTKVNA-VS 392

Query: 444 KNKRNSDVNDDDFLI 458
           +NK+N D  +D+FLI
Sbjct: 393 RNKKNPD--EDEFLI 405

>KLLA0F15994g complement(1484383..1485666) weakly similar to
           sgd|S0005568 Saccharomyces cerevisiae YOR042w, start by
           similarity
          Length = 427

 Score =  202 bits (515), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 144/360 (40%), Positives = 190/360 (52%), Gaps = 61/360 (16%)

Query: 99  PALPKRKTST---QNVHENPILAQLTEAFPGIDAKYVKAVLIASQGALDPAFNALLFLSD 155
           P LP RK+ +   Q+  ENP+L QL EAFP I+ KYVKAVLIASQG LDPAFNALLF+SD
Sbjct: 74  PPLPVRKSVSPEEQSEKENPMLKQLKEAFPNIEEKYVKAVLIASQGQLDPAFNALLFISD 133

Query: 156 PSFEAEATVPTAVPQSSQSGNSRSPTAVSQLQQDEILARQLDAQFNKGHARRGAPRSMDD 215
           P FE EA +PT   Q+   G  R P   +QL+QDE LARQLD +FNK H    + R+  +
Sbjct: 134 PDFEKEAPLPTRPVQAPTRGVRREPK--TQLEQDEELARQLDKKFNK-HGNSASERTARE 190

Query: 216 XXXXXXXXXXXXXXXXXXXTAHGAGPLSPEEQRRYERMEA-EDQEDNDFLSQLVDKDLPE 274
                                +GAG + P+ +R  +  +  ED  ++D  S  VDK+LP+
Sbjct: 191 RRIRQRERDYERR--------YGAGAIPPKGRRDSDGYDNFEDDGEDDVFSNFVDKELPQ 242

Query: 275 LREKVGRQVQETGRKVNDWLSGFRKNWAXXXXXXXXXXXYPEFXXXXXXXXXXXXXXXXX 334
           +RE + R +QETG+K++ W SG  KN              P +                 
Sbjct: 243 IRENLNRNIQETGKKISTWFSGITKNLVDDD---------PNYSE--------------- 278

Query: 335 XXEFEDYTRPEHRTARFNSFGAKV--GDDSTTSSAKLASHGISLYNKGDKDVEDESDADI 392
                  +RP++  +RFNSFG +   G+D+     KL + GISL+N     ++  SD DI
Sbjct: 279 -------SRPKYSQSRFNSFGDRYRDGNDNVDGQTKLQNAGISLHNDD---LDFGSDDDI 328

Query: 393 APQLPSRNKAKDIQPETTYIDTPE----AGTRKKWQPLPPE---PINVTP-SKVNATASK 444
            PQLPSR  AK +  ETTYIDTPE       R   + L P    P   TP SK+N +  K
Sbjct: 329 PPQLPSR--AKKVVAETTYIDTPEQVRGKNNRSPLKTLAPHSESPTRSTPTSKLNTSTDK 386

>CAGL0L09933g 1067488..1068714 similar to tr|Q08412 Saccharomyces
           cerevisiae YOR042w, hypothetical start
          Length = 408

 Score =  191 bits (484), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 143/381 (37%), Positives = 190/381 (49%), Gaps = 76/381 (19%)

Query: 106 TSTQNVHENPILAQLTEAFPGIDAKYVKAVLIASQGALDPAFNALLFLSDPSFEAEATVP 165
           T+T+ V ENP+L QL EAFP I+ +YVKAV+IASQGALDPAFNALLFLSDP    +  +P
Sbjct: 70  TTTKKV-ENPLLLQLKEAFPNIEEQYVKAVIIASQGALDPAFNALLFLSDPESGKDIELP 128

Query: 166 TAVPQSSQSGNSRSPTAVSQLQQDEILARQLDAQFNKGHARRGAPRSMDDXXXXXXXXXX 225
               Q + S   R     +QL+QDE+LARQLD ++N+   RRG  R  ++          
Sbjct: 129 REPVQQNPSLPPRRKQ--TQLEQDEMLARQLDKEYNR--KRRGERRHHNERE-------- 176

Query: 226 XXXXXXXXXTAHGAGPLSPEEQRRYERMEAEDQEDNDFLSQLVDKDLPELREKVGRQVQE 285
                        AG       R YER   +D E+ D  SQ V+KDLPE+  +    +QE
Sbjct: 177 -------------AG-------RNYERYNNDDLEE-DSWSQFVEKDLPEITARAKGSLQE 215

Query: 286 TGRKVNDWLSGFRKNWAXXXXXXXXXXXYPEFXXXXXXXXXXXXXXXXXXXEFEDYTRPE 345
           T  KV  W +G +KN+              +                    +      P 
Sbjct: 216 TATKVGTWFNGVKKNFIGEGEENDSAYYQDDSHGRDLDEDYGTYVEQQERRQRRGVQDPG 275

Query: 346 HRTA---------RFNSFGAKVGDDSTTSSAKLASHGISLYNKGDKDVEDESDADIAPQL 396
           +R           RFNSFGA   DD           GISL +   ++  ++ D ++ PQL
Sbjct: 276 YRRGDEQRLNARHRFNSFGASATDD--------VEGGISLRD---EEFGEDEDEEVPPQL 324

Query: 397 PSRNKAKD-------IQP----------ETTYIDTPE--AGTRKKWQPLPPEPINVTPSK 437
           PSR ++ D       ++P          ETTYIDTPE    T++KWQPLPPEP+N TP+K
Sbjct: 325 PSRARSNDSKKDSEEVKPQEGKKDKVVAETTYIDTPENKEKTKRKWQPLPPEPLNATPTK 384

Query: 438 VNATASKNKRNSDVNDDDFLI 458
           VNA+  KNK  S   +D+FLI
Sbjct: 385 VNASTKKNKNES---EDEFLI 402

>Scas_699.45
          Length = 450

 Score =  186 bits (472), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 143/404 (35%), Positives = 189/404 (46%), Gaps = 86/404 (21%)

Query: 93  NDEEVRPALPKRKTSTQNVHE--NPILAQLTEAFPGIDAKYVKAVLIASQGALDPAFNAL 150
           N+E+  P LP R+ +     E  NPIL QL EAFP I+ KYVK VLIASQGALDPAF AL
Sbjct: 89  NEEDEGPPLPTRRKTEPEAEESENPILKQLKEAFPNIEEKYVKTVLIASQGALDPAFEAL 148

Query: 151 LFLSDPSFEAEATVPT---------AVPQSSQSGNSRSPTAVSQLQQDEILARQLDAQFN 201
           LFLSDP+   +  +PT         A+PQ  +         ++QL+QD +LARQL+ ++N
Sbjct: 149 LFLSDPNSSKDIELPTKPIAANATPALPQRRK---------LTQLEQDALLARQLNEEYN 199

Query: 202 KGH-ARRGAPRSMDDXXXXXXXXXXXXXXXXXXXTAHGAGPLSPEEQRRYERMEAEDQED 260
           K H   RGA R                        +                     QED
Sbjct: 200 KAHDPPRGAVRDNGRRTRPQQQRRQRTANDDDLDFS---------------------QED 238

Query: 261 NDFLSQLVDKDLPELREKVGRQVQETGRKVNDWLSGFRKNWAXXXXXXXXXXXYPEFXXX 320
            D  +Q V+KDLP++  +    +QET  KV  W   F KN                    
Sbjct: 239 -DSWAQFVEKDLPDITARAKGSLQETAMKVGSW---FSKNVIGEEDPNQPQPQG--MNNR 292

Query: 321 XXXXXXXXXXXXXXXXEFEDYTR-------PEHRTARFNSFGAKVGDDSTTSSAKLASHG 373
                           E+  Y +       PE R  RFNSFGA+VG+DS      L SHG
Sbjct: 293 NGNSDFTDEQIKQQQKEWSYYQKQKKGPENPERR--RFNSFGAQVGEDS------LESHG 344

Query: 374 ISLYNKGDKDVEDESDADIAPQLPSRNKAKD-------------------IQPETTYIDT 414
           I+L++  +   EDE   D+ PQLP+R K+ D                   +  +TT+IDT
Sbjct: 345 IALHDNENLSDEDE---DVPPQLPTREKSVDSNTQNDETNATATPKDKAKVVAQTTFIDT 401

Query: 415 PEAGTRKKWQPLPPEPINVTPSKVNATASKNKRNSDVNDDDFLI 458
           PE   + KWQP+ PEP+N TP+K+NA+     +N D  D+DFLI
Sbjct: 402 PEGSAKPKWQPVAPEPLNGTPTKINASGQAKIKNPD-EDEDFLI 444

>ACR083C [1130] [Homologous to ScYOR042W - SH; ScYDR273W (DON1) -
           SH] (505794..506921) [1128 bp, 375 aa]
          Length = 375

 Score =  140 bits (353), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 117/353 (33%), Positives = 159/353 (45%), Gaps = 89/353 (25%)

Query: 113 ENPILAQLTEAFPGIDAKYVKAVLIASQGALDPAFNALLFLSDPSFEAEATVPTAVPQSS 172
           EN IL++L  AFP ++ K VKAV+IASQG LDPAF+ALLFLSDP+FE EA +      + 
Sbjct: 99  ENSILSELKAAFPNVEEKIVKAVIIASQGILDPAFSALLFLSDPTFEEEAAL-----PTQ 153

Query: 173 QSGNSRSPTAVSQLQQDEILARQLDAQFNKGHARRGAPRSMDDXXXXXXXXXXXXXXXXX 232
            +  +++   +SQLQQDE+LARQLD QFNK   R                          
Sbjct: 154 AAPAAQATVPISQLQQDEMLARQLDEQFNKKDLRAERAARERRIREREEEF--------- 204

Query: 233 XXTAHGAGPLSPEEQRRYERMEAE-----DQEDNDFLSQLVDKDLPELREKVGRQVQETG 287
                         QR+ +R+ +E      ++D DF+  L             R +QET 
Sbjct: 205 --------------QRKQQRLRSEYGGYGSEDDEDFIDVL------------NRGLQETS 238

Query: 288 RKVNDWLSGFRKNWAXXXXXXXXXXXYPEFXXXXXXXXXXXXXXXXXXXEFEDYTRPEHR 347
           +KV  W  G +KN+             P+                           P  R
Sbjct: 239 KKVGKWWDGIKKNF-------NEELDGPDARASAGP--------------------PRAR 271

Query: 348 TARFNSFGAKVGDDSTTSSAKLASHGISLYNKGDKDVEDESDADIAPQLPSRNKAKDIQP 407
             RFNSFGA+   D  T   +    G+SL+        DE D + AP+LP R  +    P
Sbjct: 272 QQRFNSFGAR---DDETYPTEQQLRGVSLH--------DEHDDEPAPRLPPRRTS--TGP 318

Query: 408 ETTYIDTPEAGTRKKWQPLPPEPINVTPSKVNATASKNKRNS--DVNDDDFLI 458
                D P    RK+WQPLPPEP++  P+KV A    + +N   D + DD+LI
Sbjct: 319 LPARPDGPNV-ERKRWQPLPPEPVSA-PTKVTAGGRNHAQNKKRDPDQDDYLI 369

>YDR273W (DON1) [1104] chr4 (1010168..1011265) Component of the
           prospore membrane [1098 bp, 365 aa]
          Length = 365

 Score = 60.1 bits (144), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 33/77 (42%), Positives = 44/77 (57%), Gaps = 4/77 (5%)

Query: 116 ILAQLTEAFPGIDAKYVKAVLIASQGALDPAFNALLFLSDPSFEAEATVPTAVPQSSQSG 175
           +L +L  AFP +D   +KA+LIASQG L+PAFN+LL+ S P    E     A+P    S 
Sbjct: 86  VLKELKIAFPEVDDTLIKAILIASQGVLEPAFNSLLYYSSP----EENTDFALPMKPISV 141

Query: 176 NSRSPTAVSQLQQDEIL 192
              S   VS++ Q EI 
Sbjct: 142 EDYSKINVSEILQREIF 158

>Scas_615.8d
          Length = 581

 Score = 49.3 bits (116), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 37/59 (62%), Gaps = 2/59 (3%)

Query: 112 HENPILAQLTEAFPGIDAKYVKAVLIASQGALDPAFNALLFLSDPSFEAEATVPTAVPQ 170
           H N  + +L +AFP +D   +K++L AS+G + PAF+ALLFL++       T+   +P+
Sbjct: 281 HSN--IPELAKAFPSVDINVIKSLLFASEGEVLPAFHALLFLTNQQNLETITITQVLPK 337

>CAGL0M08580g complement(855443..856036) weakly similar to tr|Q08412
           Saccharomyces cerevisiae YOR042w, hypothetical start
          Length = 197

 Score = 47.0 bits (110), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 22/46 (47%), Positives = 32/46 (69%), Gaps = 4/46 (8%)

Query: 109 QNVHENPILAQLTEAFPGIDAKYVKAVLIASQGALDPAFNALLFLS 154
           QNVH      +L +AFP +D   ++A+L+A++G L PAFNALL L+
Sbjct: 27  QNVH----YEKLVKAFPTVDKLIIRAILLAARGDLAPAFNALLSLT 68

>Scas_626.8
          Length = 475

 Score = 31.6 bits (70), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 22/39 (56%)

Query: 117 LAQLTEAFPGIDAKYVKAVLIASQGALDPAFNALLFLSD 155
           L  L   FPG+D + ++ V IA +  + P  + LL LSD
Sbjct: 437 LDTLQSMFPGMDKELIEDVCIAKKYRIGPCVDILLTLSD 475

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.306    0.124    0.344 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 13,388,354
Number of extensions: 533152
Number of successful extensions: 1798
Number of sequences better than 10.0: 31
Number of HSP's gapped: 1772
Number of HSP's successfully gapped: 38
Length of query: 458
Length of database: 16,596,109
Length adjustment: 105
Effective length of query: 353
Effective length of database: 12,961,219
Effective search space: 4575310307
Effective search space used: 4575310307
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (22.0 bits)
S2: 63 (28.9 bits)