Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_55.2158228428115280.0
Sklu_1159.128227610981e-152
Scas_699.442822769821e-135
YOR040W (GLO4)2852769581e-131
KLLA0F16016g2832749501e-130
YDR272W (GLO2)2742729471e-129
CAGL0I00924g2742719411e-129
ACR084C2932789291e-126
Kwal_23.386734772710.51
CAGL0I08349g667116710.59
CAGL0D04268g72130691.0
YCR032W (BPH1)216756662.3
ACL034W55074653.0
KLLA0B13739g76334653.2
YER082C (UTP7)55474653.3
CAGL0J03344g54344635.7
YLR219W (MSC3)72888628.2
Kwal_23.596255244618.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_55.21582
         (281 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_55.21582                                                         593   0.0  
Sklu_1159.1 YOR040W, Contig c1159 273-1121                            427   e-152
Scas_699.44                                                           382   e-135
YOR040W (GLO4) [4852] chr15 (407063..407920) Glyoxalase-II [858 ...   373   e-131
KLLA0F16016g complement(1486406..1487257) similar to sp|Q12320 S...   370   e-130
YDR272W (GLO2) [1103] chr4 (1009002..1009826) Glyoxalase-II [825...   369   e-129
CAGL0I00924g complement(75399..76223) similar to sp|Q05584 Sacch...   367   e-129
ACR084C [1131] [Homologous to ScYOR040W (GLO4) - SH; ScYDR272W (...   362   e-126
Kwal_23.3867                                                           32   0.51 
CAGL0I08349g complement(813728..815731) similar to sp|P23293 Sac...    32   0.59 
CAGL0D04268g complement(418104..420269) similar to sp|P49956 Sac...    31   1.0  
YCR032W (BPH1) [566] chr3 (179515..186018) Probable acetic acid ...    30   2.3  
ACL034W [1015] [Homologous to ScYER082C (KRE31) - SH] complement...    30   3.0  
KLLA0B13739g complement(1201317..1203608) similar to sp|P49956 S...    30   3.2  
YER082C (UTP7) [1514] chr5 complement(324268..325932) Component ...    30   3.3  
CAGL0J03344g complement(322226..323857) highly similar to sp|P40...    29   5.7  
YLR219W (MSC3) [3619] chr12 (574153..576339) Protein of unknown ...    28   8.2  
Kwal_23.5962                                                           28   8.4  

>Kwal_55.21582
          Length = 284

 Score =  593 bits (1528), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/281 (100%), Positives = 281/281 (100%)

Query: 1   MLSRFVQTRSMHVKAIKMRWLTGGVNYCYLLSTQDKTKSWLIDPAEPLEVMTALKAEEAN 60
           MLSRFVQTRSMHVKAIKMRWLTGGVNYCYLLSTQDKTKSWLIDPAEPLEVMTALKAEEAN
Sbjct: 1   MLSRFVQTRSMHVKAIKMRWLTGGVNYCYLLSTQDKTKSWLIDPAEPLEVMTALKAEEAN 60

Query: 61  TVQAVVNTHHHYDHSGGNSAIVGELRKMGVSHLDVICGSNTSPGATKIPKNLQEYSLGDL 120
           TVQAVVNTHHHYDHSGGNSAIVGELRKMGVSHLDVICGSNTSPGATKIPKNLQEYSLGDL
Sbjct: 61  TVQAVVNTHHHYDHSGGNSAIVGELRKMGVSHLDVICGSNTSPGATKIPKNLQEYSLGDL 120

Query: 121 KIKCIRTPCHTQDSVCYYVSDPNTGEKCIFTGDTLFTAGCGRFFEGTGEEMDVALNRSIL 180
           KIKCIRTPCHTQDSVCYYVSDPNTGEKCIFTGDTLFTAGCGRFFEGTGEEMDVALNRSIL
Sbjct: 121 KIKCIRTPCHTQDSVCYYVSDPNTGEKCIFTGDTLFTAGCGRFFEGTGEEMDVALNRSIL 180

Query: 181 DGVGEPNWDITKVYPGHEYTKSNVKFVRKAVYKTPGENSSLDRLEHVCNKHDVTTGMFTI 240
           DGVGEPNWDITKVYPGHEYTKSNVKFVRKAVYKTPGENSSLDRLEHVCNKHDVTTGMFTI
Sbjct: 181 DGVGEPNWDITKVYPGHEYTKSNVKFVRKAVYKTPGENSSLDRLEHVCNKHDVTTGMFTI 240

Query: 241 HDELAYNPFMRLDDPTVRDAIKDSNGSLSRAQVMDQLRKMK 281
           HDELAYNPFMRLDDPTVRDAIKDSNGSLSRAQVMDQLRKMK
Sbjct: 241 HDELAYNPFMRLDDPTVRDAIKDSNGSLSRAQVMDQLRKMK 281

>Sklu_1159.1 YOR040W, Contig c1159 273-1121
          Length = 282

 Score =  427 bits (1098), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 192/276 (69%), Positives = 235/276 (85%)

Query: 6   VQTRSMHVKAIKMRWLTGGVNYCYLLSTQDKTKSWLIDPAEPLEVMTALKAEEANTVQAV 65
           +  RSMHVKAIKMRWLTGGVNY YLLSTQDKTKSWLIDPAEPLEV+  L  +E  +++AV
Sbjct: 4   IYIRSMHVKAIKMRWLTGGVNYSYLLSTQDKTKSWLIDPAEPLEVLPKLTDKEIGSIEAV 63

Query: 66  VNTHHHYDHSGGNSAIVGELRKMGVSHLDVICGSNTSPGATKIPKNLQEYSLGDLKIKCI 125
           VNTHHHYDHSGGN  ++  L+K G + + VICGS+TSPGAT++P++LQ+Y LGDL++ CI
Sbjct: 64  VNTHHHYDHSGGNIPVIAALKKAGQNAVSVICGSHTSPGATEVPQDLQKYKLGDLEVLCI 123

Query: 126 RTPCHTQDSVCYYVSDPNTGEKCIFTGDTLFTAGCGRFFEGTGEEMDVALNRSILDGVGE 185
           RTPCHTQDSVCY+V D +TGE+CIFTGDTLFTAGCGRFFEGTGEEMD ALNR++L+  GE
Sbjct: 124 RTPCHTQDSVCYFVKDFDTGERCIFTGDTLFTAGCGRFFEGTGEEMDRALNRNLLEHTGE 183

Query: 186 PNWDITKVYPGHEYTKSNVKFVRKAVYKTPGENSSLDRLEHVCNKHDVTTGMFTIHDELA 245
            NW  TKVYPGHEYTKSNV+FVR A+YKTPGEN + D+LEH C+K++VTTG FT+ DEL 
Sbjct: 184 ENWSTTKVYPGHEYTKSNVEFVRAAIYKTPGENKAFDKLEHFCDKNEVTTGCFTLKDELD 243

Query: 246 YNPFMRLDDPTVRDAIKDSNGSLSRAQVMDQLRKMK 281
           +NPFMRL+ P VR ++ D+ G+  +A+VMD+LR+MK
Sbjct: 244 FNPFMRLNCPMVRKSVGDAQGAWPKARVMDKLRQMK 279

>Scas_699.44
          Length = 282

 Score =  382 bits (982), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 171/276 (61%), Positives = 218/276 (78%), Gaps = 1/276 (0%)

Query: 7   QTRSMHVKAIKMRWLTGGVNYCYLLSTQDKTKSWLIDPAEPLEVMTALKAEEANTVQAVV 66
           Q   M+VK IKMRW TGGVNY YLLS+QDK  SWLIDPAE  EV+  L  +E   ++A+V
Sbjct: 4   QVGKMYVKPIKMRWSTGGVNYSYLLSSQDKEHSWLIDPAESDEVIPHLDPQERLNIRAIV 63

Query: 67  NTHHHYDHSGGNSAIVGELRKMGVSHL-DVICGSNTSPGATKIPKNLQEYSLGDLKIKCI 125
           NTHHHYDHS GN +++ EL++ G  H+  +I GS +SPG ++IP +LQ+Y LG+L++ C+
Sbjct: 64  NTHHHYDHSDGNISMINELKQDGNQHIVKIIAGSKSSPGVSEIPTHLQKYQLGNLEVVCL 123

Query: 126 RTPCHTQDSVCYYVSDPNTGEKCIFTGDTLFTAGCGRFFEGTGEEMDVALNRSILDGVGE 185
           RTPCHTQDS+CYYV D +T E+C+FTGDTLFT GCGRFFEG G+EMD ALN++IL+GVGE
Sbjct: 124 RTPCHTQDSICYYVKDSDTNEQCLFTGDTLFTGGCGRFFEGNGQEMDQALNKTILEGVGE 183

Query: 186 PNWDITKVYPGHEYTKSNVKFVRKAVYKTPGENSSLDRLEHVCNKHDVTTGMFTIHDELA 245
           PNW++T+VYPGHEYTK NVKF+RK VY+  G+N +LD+LE  C  H+VTTG FT+ DEL 
Sbjct: 184 PNWNMTRVYPGHEYTKDNVKFIRKFVYQELGDNEALDKLEKFCKSHEVTTGEFTLDDELK 243

Query: 246 YNPFMRLDDPTVRDAIKDSNGSLSRAQVMDQLRKMK 281
           +NPFMRLDDP VR A+ D+     R++VM+ LRKMK
Sbjct: 244 FNPFMRLDDPIVRKAVGDAEEKWERSKVMETLRKMK 279

>YOR040W (GLO4) [4852] chr15 (407063..407920) Glyoxalase-II [858 bp,
           285 aa]
          Length = 285

 Score =  373 bits (958), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 169/276 (61%), Positives = 208/276 (75%), Gaps = 1/276 (0%)

Query: 7   QTRSMHVKAIKMRWLTGGVNYCYLLSTQDKTKSWLIDPAEPLEVMTALKAEEANTVQAVV 66
           Q R+MHVK IKMRWLTGGVNY YLLST+D+  SWLIDPAEPLEV   L AEE  ++ A+V
Sbjct: 7   QIRNMHVKPIKMRWLTGGVNYSYLLSTEDRRNSWLIDPAEPLEVSPKLSAEEKKSIDAIV 66

Query: 67  NTHHHYDHSGGNSAIVGELRKMGVSH-LDVICGSNTSPGATKIPKNLQEYSLGDLKIKCI 125
           NTHHHYDHSGGN A+   L +    H + +I GS +SPG T++P NLQ+Y LG+L++ CI
Sbjct: 67  NTHHHYDHSGGNLALYSILCQENSGHDIKIIGGSKSSPGVTEVPDNLQQYHLGNLRVTCI 126

Query: 126 RTPCHTQDSVCYYVSDPNTGEKCIFTGDTLFTAGCGRFFEGTGEEMDVALNRSILDGVGE 185
           RTPCHT+DS+CYY+ D  TGE+CIFTGDTLF AGCGRFFEGTG +MD+ALN+ +L  VGE
Sbjct: 127 RTPCHTKDSICYYIKDLETGEQCIFTGDTLFIAGCGRFFEGTGRDMDMALNQIMLRAVGE 186

Query: 186 PNWDITKVYPGHEYTKSNVKFVRKAVYKTPGENSSLDRLEHVCNKHDVTTGMFTIHDELA 245
            NW+  K+YPGHEYTK NV F+R  +Y   G+N   D LE  C  ++ TTG FT+ DEL 
Sbjct: 187 TNWNKVKIYPGHEYTKGNVSFIRAKIYSDIGQNKEFDALEQYCKSNECTTGHFTLRDELG 246

Query: 246 YNPFMRLDDPTVRDAIKDSNGSLSRAQVMDQLRKMK 281
           YNPFMRLDD  VR A+ D+ G+  R+ VM +LRK+K
Sbjct: 247 YNPFMRLDDRAVRLAVGDTAGTYPRSVVMQELRKLK 282

>KLLA0F16016g complement(1486406..1487257) similar to sp|Q12320
           Saccharomyces cerevisiae YOR040w GLO4 glyoxalase II
           (hydroxyacylglutathione hydrolase), start by similarity
          Length = 283

 Score =  370 bits (950), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 175/274 (63%), Positives = 203/274 (74%), Gaps = 1/274 (0%)

Query: 9   RSMHVKAIKMRWLTGGVNYCYLLSTQDKTKSWLIDPAEPLEVMTALKAEEANTVQAVVNT 68
           R MHVKAIKMRWLTGGVNY YLLSTQDK KSWLIDPAE LEVM  L ++EA +++A+VNT
Sbjct: 7   RKMHVKAIKMRWLTGGVNYSYLLSTQDKKKSWLIDPAETLEVMNDLGSDEAKSIEALVNT 66

Query: 69  HHHYDHSGGNSAIVGELRKMGVSHLDVICGSNTSPGATKIPKNLQEYSLGDLKIKCIRTP 128
           HHHYDH+GGN + +  L + G +   VI GS  SP A  IP NL EY+LG+LKI CIRTP
Sbjct: 67  HHHYDHAGGNVSTLAALNEKGNNISRVIAGSQRSPIANDIPDNLHEYTLGNLKILCIRTP 126

Query: 129 CHTQDSVCYYVSDPNTGEKCIFTGDTLFTAGCGRFFEGTGEEMDVALNRSILDGVGE-PN 187
           CHTQDS CYYV DP T E+ IFTGDTLFT GCGRFFEGT EEMD ALN  +L   G+  N
Sbjct: 127 CHTQDSTCYYVRDPETKEQAIFTGDTLFTGGCGRFFEGTAEEMDDALNFRLLGNTGDTSN 186

Query: 188 WDITKVYPGHEYTKSNVKFVRKAVYKTPGENSSLDRLEHVCNKHDVTTGMFTIHDELAYN 247
           W   KVYPGHEYT  NV F+R  +Y    +N   ++LE    +H+VTTG FTI DEL++N
Sbjct: 187 WKNVKVYPGHEYTAGNVSFIRNYIYLKKSDNDHFNKLESFTKEHEVTTGHFTIADELSFN 246

Query: 248 PFMRLDDPTVRDAIKDSNGSLSRAQVMDQLRKMK 281
           PFMRLDDP VR  + DS G  +RAQVMD+LR MK
Sbjct: 247 PFMRLDDPIVRRQVGDSQGCWTRAQVMDKLRNMK 280

>YDR272W (GLO2) [1103] chr4 (1009002..1009826) Glyoxalase-II [825
           bp, 274 aa]
          Length = 274

 Score =  369 bits (947), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 173/272 (63%), Positives = 208/272 (76%), Gaps = 2/272 (0%)

Query: 11  MHVKAIKMRWLTGGVNYCYLLSTQDKTKSWLIDPAEPLEVMTALKAEEANTVQAVVNTHH 70
           M VK+IKMRW +GGVNYCYLLS     KSWLIDPAEP EV+  L  +E  +V+A+VNTHH
Sbjct: 1   MQVKSIKMRWESGGVNYCYLLSDSKNKKSWLIDPAEPPEVLPELTEDEKISVEAIVNTHH 60

Query: 71  HYDHSGGNSAIVGELR-KMGVSHLDVICGSNTSPGATKIPKNLQEYSLGDLKIKCIRTPC 129
           HYDH+ GN+ I+  L+ K   S ++VI GS   P  T IP+NL++  LGDL+I CIRTPC
Sbjct: 61  HYDHADGNADILKYLKEKNPTSKVEVIGGSKDCPKVTIIPENLKKLHLGDLEITCIRTPC 120

Query: 130 HTQDSVCYYVSDPNTGEKCIFTGDTLFTAGCGRFFEGTGEEMDVALNRSILDGVGEPNWD 189
           HT+DS+CYYV DP T E+CIFTGDTLFTAGCGRFFEGTGEEMD+ALN SIL+ VG  NW 
Sbjct: 121 HTRDSICYYVKDPTTDERCIFTGDTLFTAGCGRFFEGTGEEMDIALNNSILETVGRQNWS 180

Query: 190 ITKVYPGHEYTKSNVKFVRKAVYKTPGENSSLDRLEHVCNKHDVTTGMFTIHDELAYNPF 249
            T+VYPGHEYT  NVKFVRK +Y   GEN +LD LE  C+KH+VT G FT+ DE+ +NPF
Sbjct: 181 KTRVYPGHEYTSDNVKFVRK-IYPQVGENKALDELEQFCSKHEVTAGRFTLKDEVEFNPF 239

Query: 250 MRLDDPTVRDAIKDSNGSLSRAQVMDQLRKMK 281
           MRL+DP V+ A  D+N S  RAQ+MD+LR MK
Sbjct: 240 MRLEDPKVQKAAGDTNNSWDRAQIMDKLRAMK 271

>CAGL0I00924g complement(75399..76223) similar to sp|Q05584
           Saccharomyces cerevisiae YDR272w GLO2 glyoxalase II,
           start by similarity
          Length = 274

 Score =  367 bits (941), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 171/271 (63%), Positives = 202/271 (74%)

Query: 11  MHVKAIKMRWLTGGVNYCYLLSTQDKTKSWLIDPAEPLEVMTALKAEEANTVQAVVNTHH 70
           MHVK IKMRW TGGVNY YL+S QD+T SWLIDPAEP EV   L   E  +V A+VNTHH
Sbjct: 1   MHVKPIKMRWHTGGVNYSYLVSNQDQTTSWLIDPAEPHEVWPELSESERESVVALVNTHH 60

Query: 71  HYDHSGGNSAIVGELRKMGVSHLDVICGSNTSPGATKIPKNLQEYSLGDLKIKCIRTPCH 130
           HYDH+GGN++++ + ++     L VI GS      T IP + Q+  +G+L + CIRTPCH
Sbjct: 61  HYDHAGGNTSLLKQFKETVGKPLQVIGGSEECDNVTLIPTHSQKLKIGNLDVTCIRTPCH 120

Query: 131 TQDSVCYYVSDPNTGEKCIFTGDTLFTAGCGRFFEGTGEEMDVALNRSILDGVGEPNWDI 190
           TQDSVCYY+ DP T E+CIFTGDTLFTAGCGRFFEGTGEEMD ALN+ IL+GVG+ NW  
Sbjct: 121 TQDSVCYYIRDPETDERCIFTGDTLFTAGCGRFFEGTGEEMDAALNKYILEGVGKNNWSS 180

Query: 191 TKVYPGHEYTKSNVKFVRKAVYKTPGENSSLDRLEHVCNKHDVTTGMFTIHDELAYNPFM 250
           T VYPGHEYTKSNVKFVR  +Y T   NS  D LE  CN+H+VTTG FT+ DEL +NPFM
Sbjct: 181 TLVYPGHEYTKSNVKFVRSKIYPTTNVNSRFDELERFCNEHEVTTGKFTLADELLFNPFM 240

Query: 251 RLDDPTVRDAIKDSNGSLSRAQVMDQLRKMK 281
           +LDDP VR A+ DS    + A VMD+LRKMK
Sbjct: 241 KLDDPIVRAAVGDSENQWTSAAVMDKLRKMK 271

>ACR084C [1131] [Homologous to ScYOR040W (GLO4) - SH; ScYDR272W
           (GLO2) - SH] (507338..508219) [882 bp, 293 aa]
          Length = 293

 Score =  362 bits (929), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 170/278 (61%), Positives = 213/278 (76%), Gaps = 4/278 (1%)

Query: 5   FVQTRSMHVKAIKMRWLTGGVNYCYLLSTQDKTKSWLIDPAEPLEVMTALKAEEANTVQA 64
           + Q R MHVKAIKMRWLTGGVNY YL+STQDK  SWLIDPAE LEV+ AL  +E  +++A
Sbjct: 16  YRQLRKMHVKAIKMRWLTGGVNYSYLVSTQDKKASWLIDPAEALEVLPALSHDEKQSIRA 75

Query: 65  VVNTHHHYDHSGGNSAIVGELRKMGVSHLDVICGSNTSPGATKIPKNLQEYSLGD-LKIK 123
           +VNTHHHYDH+GGN AI   L++ GV+ + VI GS TSP +T IP++LQ+Y+LGD +++ 
Sbjct: 76  IVNTHHHYDHAGGNLAIRAALKREGVA-VPVIAGSTTSPVSTDIPEHLQKYTLGDSVEVL 134

Query: 124 CIRTPCHTQDSVCYYVSDPNTGEKCIFTGDTLFTAGCGRFFEGTGEEMDVALNRSILDGV 183
           CIRTPCHTQDS+CY++ D  TG++ +FTGDTLFTAGCGRFFEGT EEMD ALN  +L+ V
Sbjct: 135 CIRTPCHTQDSICYFMRDTKTGQQALFTGDTLFTAGCGRFFEGTAEEMDAALNSRLLEHV 194

Query: 184 GEPNWDITKVYPGHEYTKSNVKFVRKAVYKTPGENSSLDRLEHVCNKHDVTTGMFTIHDE 243
            +     TKVYPGHEYTK NV F+R A+Y + G+N + DRLE   N + VTTG FT+ DE
Sbjct: 195 QDHA--ATKVYPGHEYTKGNVHFIRSAIYMSEGDNPAFDRLESFANANAVTTGQFTLQDE 252

Query: 244 LAYNPFMRLDDPTVRDAIKDSNGSLSRAQVMDQLRKMK 281
             YNPFMRLDDPT+R  + D + + +RA VM +LR MK
Sbjct: 253 TEYNPFMRLDDPTIRRRVGDLHRTWARADVMAKLRSMK 290

>Kwal_23.3867
          Length = 347

 Score = 32.0 bits (71), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 32/72 (44%), Gaps = 3/72 (4%)

Query: 183 VGEPNWDITKVYPGHEYTKSNVKFVRKA-VYKTPGENSSLDRLEHVCNKHDVTTGMFTIH 241
           +G   W   KV    E T+  +K V  A VYKT   N  +D +E VC+ HD    + T  
Sbjct: 251 LGRKTW--KKVVATLENTRLLIKSVSSAKVYKTVDLNDVVDSVEEVCSHHDTGFAVITYD 308

Query: 242 DELAYNPFMRLD 253
           + L +      D
Sbjct: 309 ERLKFRALNERD 320

>CAGL0I08349g complement(813728..815731) similar to sp|P23293
           Saccharomyces cerevisiae YPR161c SGV1 ser/thr protein
           kinase, hypothetical start
          Length = 667

 Score = 32.0 bits (71), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 47/116 (40%), Gaps = 24/116 (20%)

Query: 145 GEKCIFTGDTLFTAGC--GRFFEGT---GEEMDVALNRSILDGVGEPN---WDITKVYPG 196
           G+K   T   ++  GC    FFE       + D+     I   +G P+   W++ K  PG
Sbjct: 268 GDKYYTTAVDIWGVGCVFAEFFEKKPILQGKTDIDQGHVIFKLMGTPDERTWELAKYLPG 327

Query: 197 HEYTKSNVKFVRKAVYKTPGENSSLDRLEHVCNKHDVTTGMFTIHDELAYNPFMRL 252
            E TK+  K             S++D       KH   TG+  +   LA +P+ RL
Sbjct: 328 AELTKTEYK-------------STIDER---FGKHLTPTGLSFLKGLLALDPYKRL 367

>CAGL0D04268g complement(418104..420269) similar to sp|P49956
           Saccharomyces cerevisiae YMR078c CHL12, start by
           similarity
          Length = 721

 Score = 31.2 bits (69), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 19/30 (63%)

Query: 213 KTPGENSSLDRLEHVCNKHDVTTGMFTIHD 242
           + P +NS  +RL H+C K  +  GM TI++
Sbjct: 307 RKPSDNSVRERLTHICMKERINLGMKTINE 336

>YCR032W (BPH1) [566] chr3 (179515..186018) Probable acetic acid
           export pump, contains possible WD (WD-40) repeats in the
           C-terminal region [6504 bp, 2167 aa]
          Length = 2167

 Score = 30.0 bits (66), Expect = 2.3,   Method: Composition-based stats.
 Identities = 16/56 (28%), Positives = 30/56 (53%), Gaps = 2/56 (3%)

Query: 78  NSAIVGELRKMGVSHLDVICGSNTSPGATKIPKNLQEYSLGDLKIKCIRTPCHTQD 133
           N   +G+L+K+ +   +++   N S  +T + KNL E+ +  L + C  TP   Q+
Sbjct: 138 NKQTLGKLKKLRIRIFEILSNKNDSWKSTLLQKNLIEWYIFMLSVDC--TPLELQN 191

>ACL034W [1015] [Homologous to ScYER082C (KRE31) - SH]
           complement(302396..304048) [1653 bp, 550 aa]
          Length = 550

 Score = 29.6 bits (65), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 33/74 (44%)

Query: 149 IFTGDTLFTAGCGRFFEGTGEEMDVALNRSILDGVGEPNWDITKVYPGHEYTKSNVKFVR 208
           +F G+ + +     F +  G      +   I+ G GE N+D  +V P     +   + VR
Sbjct: 369 LFAGNKINSLAFVPFEDLLGVGHQTGVTNLIIPGAGEANYDALEVNPYETTKQRKEQEVR 428

Query: 209 KAVYKTPGENSSLD 222
             + K P ++ +LD
Sbjct: 429 SLLNKLPADSIALD 442

>KLLA0B13739g complement(1201317..1203608) similar to sp|P49956
           Saccharomyces cerevisiae YMR078c CHL12 required for
           accurate chromosome transmission in mitosis and
           maintenance of normal telomere length, hypothetical
           start
          Length = 763

 Score = 29.6 bits (65), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 1/34 (2%)

Query: 212 YKTPGENSSLDRLEHVCNKHDVTTGMFTIHDELA 245
           ++ P EN+ ++RLE+VC K  V     T+  ELA
Sbjct: 331 FQKPSENALMERLEYVCKKEKVHVSK-TLLKELA 363

>YER082C (UTP7) [1514] chr5 complement(324268..325932) Component of
           U3 snoRNP (also called small subunit processome), which
           is required for 18S rRNA biogenesis, has one WD (WD-40)
           domain [1665 bp, 554 aa]
          Length = 554

 Score = 29.6 bits (65), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 32/74 (43%)

Query: 149 IFTGDTLFTAGCGRFFEGTGEEMDVALNRSILDGVGEPNWDITKVYPGHEYTKSNVKFVR 208
           +F G+ +   G   F +  G      +   I+ G GE N+D  ++ P     +   + VR
Sbjct: 372 LFAGNKVENLGFVPFEDLLGVGHQTGITNLIVPGAGEANYDALELNPFETKKQRQEQEVR 431

Query: 209 KAVYKTPGENSSLD 222
             + K P +  +LD
Sbjct: 432 TLLNKLPADTITLD 445

>CAGL0J03344g complement(322226..323857) highly similar to sp|P40055
           Saccharomyces cerevisiae YER082c, hypothetical start
          Length = 543

 Score = 28.9 bits (63), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 23/44 (52%)

Query: 179 ILDGVGEPNWDITKVYPGHEYTKSNVKFVRKAVYKTPGENSSLD 222
           I+ G GE N+D  ++ P     +   + VR  + K P ++ SLD
Sbjct: 391 IIPGAGEANYDALEINPFETAKQRQEQEVRTLLNKLPADSISLD 434

>YLR219W (MSC3) [3619] chr12 (574153..576339) Protein of unknown
           function [2187 bp, 728 aa]
          Length = 728

 Score = 28.5 bits (62), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 38/88 (43%), Gaps = 17/88 (19%)

Query: 42  IDP-AEPLEVMTALKAEEANTVQAVVNTHHHYDHSG------GNSAIVGELRKMGVSHLD 94
           +DP  EP    T L  +E       +    +Y+  G       NS    + R++GVSHL 
Sbjct: 442 VDPVPEPKSANTGLTDKEMYDQALKIAQARYYNSHGIQPEAVDNSTTAAKPRQVGVSHL- 500

Query: 95  VICGSNTSPGATKIPKNLQEYSLGDLKI 122
              GS  S     IP N Q Y LGD +I
Sbjct: 501 ---GSTGS-----IPPNEQHY-LGDSEI 519

>Kwal_23.5962
          Length = 552

 Score = 28.1 bits (61), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 23/44 (52%)

Query: 179 ILDGVGEPNWDITKVYPGHEYTKSNVKFVRKAVYKTPGENSSLD 222
           I+ G GE N+D  +V P     +   + VR  + K P ++ +LD
Sbjct: 400 IIPGAGEANYDALEVNPFETAKQRQEQEVRTLLNKLPADSIALD 443

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.133    0.406 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,505,257
Number of extensions: 407540
Number of successful extensions: 941
Number of sequences better than 10.0: 24
Number of HSP's gapped: 933
Number of HSP's successfully gapped: 24
Length of query: 281
Length of database: 16,596,109
Length adjustment: 100
Effective length of query: 181
Effective length of database: 13,134,309
Effective search space: 2377309929
Effective search space used: 2377309929
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 61 (28.1 bits)