Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_55.2157598997550590.0
KLLA0F07447g97598124700.0
YDR270W (CCC2)1004100421770.0
Scas_615.994292621380.0
CAGL0M08602g101296920080.0
ACR086C81082916120.0
KLLA0D04092g11529328382e-95
AGL041C123310188023e-90
YBR295W (PCA1)12166197477e-83
YGL008C (PMA1)9185702886e-26
YPL036W (PMA2)9476072762e-24
Scas_688.19136022725e-24
Scas_710.419045912627e-23
AGL085C9096002511e-21
Kwal_14.14989395922484e-21
Kwal_47.175228996072474e-21
KLLA0A09031g8995872431e-20
CAGL0I04312g9515912361e-19
CAGL0A00495g9025832224e-18
Kwal_23.316011002871706e-12
KLLA0A03157g9382951662e-11
Kwal_47.1754712402571643e-11
AEL301W9572741609e-11
Scas_707.48*7412331591e-10
YGL006W (PMC1)11732721563e-10
KLLA0A08910g12802591563e-10
YGL167C (PMR1)9502971553e-10
CAGL0J01870g9461581521e-09
CAGL0K12034g10872981402e-08
CAGL0A00517g11222611402e-08
AFL011W12422591403e-08
YDR038C (ENA5)10912951322e-07
YDR039C (ENA2)10912951312e-07
YDR040C (ENA1)10912951313e-07
Scas_297.1800601223e-06
AGL097C10962931205e-06
KLLA0E14630g10821711196e-06
KLLA0F20658g10821691171e-05
AFR567W1449491062e-04
CAGL0L01419g1214391044e-04
Scas_569.0d468741000.001
Scas_665.301439731000.001
KLLA0B08217g1439491000.001
YEL031W (SPF1)121559990.002
KLLA0E22352g120639980.002
Kwal_26.9207146977980.002
Scas_583.14*87559960.003
CAGL0M11308g145249930.009
AFR354C121039920.010
YOR291W147250880.029
Sklu_2193.1114348850.066
YIL048W (NEO1)115147840.092
KLLA0C08393g114843840.097
CAGL0L00715g114448790.39
AAR147W158033731.7
YKR029C (SET3)751137731.7
Scas_704.38116148731.9
CAGL0E01705g36251722.1
Kwal_23.5789113370722.4
Kwal_23.35561597155713.4
KLLA0E01650g155052687.2
CAGL0H04477g1626126687.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_55.21575
         (975 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_55.21575                                                        1953   0.0  
KLLA0F07447g 700685..703612 similar to sp|P38995 Saccharomyces c...   956   0.0  
YDR270W (CCC2) [1102] chr4 (1005667..1008681) Copper-transportin...   843   0.0  
Scas_615.9                                                            828   0.0  
CAGL0M08602g complement(856349..859387) similar to sp|P38995 Sac...   778   0.0  
ACR086C [1133] [Homologous to ScYDR270W (CCC2) - SH] (511968..51...   625   0.0  
KLLA0D04092g complement(344666..348124) some similarities with s...   327   2e-95
AGL041C [4270] [Homologous to ScYDR270W - NSH] (628428..632129) ...   313   3e-90
YBR295W (PCA1) [472] chr2 (792805..796455) P-type copper-transpo...   292   7e-83
YGL008C (PMA1) [1965] chr7 complement(479913..482669) H+-transpo...   115   6e-26
YPL036W (PMA2) [5403] chr16 (482839..485682) H[+]-transporting P...   110   2e-24
Scas_688.1                                                            109   5e-24
Scas_710.41                                                           105   7e-23
AGL085C [4226] [Homologous to ScYGL008C (PMA1) - SH; ScYPL036W (...   101   1e-21
Kwal_14.1498                                                          100   4e-21
Kwal_47.17522                                                         100   4e-21
KLLA0A09031g 787768..790467 gi|1346734|sp|P49380|PMA1_KLULA Kluy...    98   1e-20
CAGL0I04312g complement(382354..385209) highly similar to sp|P13...    96   1e-19
CAGL0A00495g complement(55014..57722) highly similar to sp|P0503...    90   4e-18
Kwal_23.3160                                                           70   6e-12
KLLA0A03157g complement(281313..284129) gi|3288523|emb|CAA04476....    69   2e-11
Kwal_47.17547                                                          68   3e-11
AEL301W [2204] [Homologous to ScYGL167C (PMR1) - SH] complement(...    66   9e-11
Scas_707.48*                                                           66   1e-10
YGL006W (PMC1) [1966] chr7 (485923..489444) Vacuolar Ca2+-transp...    65   3e-10
KLLA0A08910g complement(779526..783368) similar to sp|P38929 Sac...    65   3e-10
YGL167C (PMR1) [1823] chr7 complement(187620..190472) Ca2+-trans...    64   3e-10
CAGL0J01870g 181666..184506 highly similar to sp|P13586 Saccharo...    63   1e-09
CAGL0K12034g complement(1161299..1164562) highly similar to sp|P...    59   2e-08
CAGL0A00517g 58830..62198 similar to sp|P38929 Saccharomyces cer...    59   2e-08
AFL011W [3182] [Homologous to ScYGL006W (PMC1) - SH] complement(...    59   3e-08
YDR038C (ENA5) [891] chr4 complement(527417..530692) Member of t...    55   2e-07
YDR039C (ENA2) [892] chr4 complement(531302..534577) Member of t...    55   2e-07
YDR040C (ENA1) [893] chr4 complement(535187..538462) P-type ATPa...    55   3e-07
Scas_297.1                                                             52   3e-06
AGL097C [4215] [Homologous to ScYDR039C (ENA2 ) - NSH] (520915.....    51   5e-06
KLLA0E14630g complement(1297636..1300884) similar to sp|Q01896 S...    50   6e-06
KLLA0F20658g 1919851..1923099 similar to sp|Q12691 Saccharomyces...    50   1e-05
AFR567W [3759] [Homologous to ScYOR291W - SH] complement(1455295...    45   2e-04
CAGL0L01419g 156123..159767 highly similar to sp|P39986 Saccharo...    45   4e-04
Scas_569.0d                                                            43   0.001
Scas_665.30                                                            43   0.001
KLLA0B08217g complement(724364..728683) similar to sp|Q12697 Sac...    43   0.001
YEL031W (SPF1) [1394] chr5 (90258..93905) Putative Ca2+-transpor...    43   0.002
KLLA0E22352g 1984522..1988142 highly similar to sp|P39986 Saccha...    42   0.002
Kwal_26.9207                                                           42   0.002
Scas_583.14*                                                           42   0.003
CAGL0M11308g 1110211..1114569 similar to sp|Q12697 Saccharomyces...    40   0.009
AFR354C [3546] [Homologous to ScYEL031W (SPF1) - SH] (1078275..1...    40   0.010
YOR291W (YOR291W) [5075] chr15 (861172..865590) Member of the ca...    39   0.029
Sklu_2193.1 YIL048W, Contig c2193 334-3765 reverse complement          37   0.066
YIL048W (NEO1) [2619] chr9 (261436..264891) Member of the Drs2p-...    37   0.092
KLLA0C08393g 734655..738101 highly similar to sp|P40527 Saccharo...    37   0.097
CAGL0L00715g 86810..90244 highly similar to sp|P40527 Saccharomy...    35   0.39 
AAR147W [335] [Homologous to ScYOR191W (RIS1) - SH] complement(6...    33   1.7  
YKR029C (SET3) [3284] chr11 complement(497220..499475) Component...    33   1.7  
Scas_704.38                                                            33   1.9  
CAGL0E01705g complement(168356..169444) similar to sp|P22133 Sac...    32   2.1  
Kwal_23.5789                                                           32   2.4  
Kwal_23.3556                                                           32   3.4  
KLLA0E01650g complement(155975..160627) similar to sp|Q12674 Sac...    31   7.2  
CAGL0H04477g 421857..426737 similar to sp|Q12674 Saccharomyces c...    31   7.2  

>Kwal_55.21575
          Length = 989

 Score = 1953 bits (5059), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 953/975 (97%), Positives = 953/975 (97%)

Query: 1   MNGNRIAVLLVEGMTCGACVATIESQLKRIKGVDEVTVSLITGECEVRFEKEDTDEETLK 60
           MNGNRIAVLLVEGMTCGACVATIESQLKRIKGVDEVTVSLITGECEVRFEKEDTDEETLK
Sbjct: 1   MNGNRIAVLLVEGMTCGACVATIESQLKRIKGVDEVTVSLITGECEVRFEKEDTDEETLK 60

Query: 61  GAIIDCGFSATVLRVQDVEAGQIARQRKTAVLSVQHMTCGACVATITNNLEAQEGVLEVA 120
           GAIIDCGFSATVLRVQDVEAGQIARQRKTAVLSVQHMTCGACVATITNNLEAQEGVLEVA
Sbjct: 61  GAIIDCGFSATVLRVQDVEAGQIARQRKTAVLSVQHMTCGACVATITNNLEAQEGVLEVA 120

Query: 121 VSLATEECRVEFDPAVVTAAELKGIIDDSGFEAEIINDDAERPTRGSTVRKATLKVLGMT 180
           VSLATEECRVEFDPAVVTAAELKGIIDDSGFEAEIINDDAERPTRGSTVRKATLKVLGMT
Sbjct: 121 VSLATEECRVEFDPAVVTAAELKGIIDDSGFEAEIINDDAERPTRGSTVRKATLKVLGMT 180

Query: 181 CGACVSTVESALSQEPGVVSIQVSLATEEAQLEYNPAVIGVRAIASKIEDLGFESAPVNS 240
           CGACVSTVESALSQEPGVVSIQVSLATEEAQLEYNPAVIGVRAIASKIEDLGFESAPVNS
Sbjct: 181 CGACVSTVESALSQEPGVVSIQVSLATEEAQLEYNPAVIGVRAIASKIEDLGFESAPVNS 240

Query: 241 FNSVAQVNLLAKVREINFWKRTCVQSCCFMVLMLLLYKAGPLWIPARNLFFYKQTGIPGL 300
           FNSVAQVNLLAKVREINFWKRTCVQSCCFMVLMLLLYKAGPLWIPARNLFFYKQTGIPGL
Sbjct: 241 FNSVAQVNLLAKVREINFWKRTCVQSCCFMVLMLLLYKAGPLWIPARNLFFYKQTGIPGL 300

Query: 301 FYRDIIGFIITCYVQFWVGWHFYPAGWKSIRHGSGSMDTVVLLSTLCSFAFSLYSIAMNV 360
           FYRDIIGFIITCYVQFWVGWHFYPAGWKSIRHGSGSMDTVVLLSTLCSFAFSLYSIAMNV
Sbjct: 301 FYRDIIGFIITCYVQFWVGWHFYPAGWKSIRHGSGSMDTVVLLSTLCSFAFSLYSIAMNV 360

Query: 361 AKKSERMPNVIFDASVMLIGFISVGKLLENKAKSKTNNSLSKLMSLAPSTCTIIENGKAR 420
           AKKSERMPNVIFDASVMLIGFISVGKLLENKAKSKTNNSLSKLMSLAPSTCTIIENGKAR
Sbjct: 361 AKKSERMPNVIFDASVMLIGFISVGKLLENKAKSKTNNSLSKLMSLAPSTCTIIENGKAR 420

Query: 421 EIPVEFLQVGDTVEIKPGAKIPTDGVIIEGESEVDESLITGESLMVPRYKGFPVIAGSIN 480
           EIPVEFLQVGDTVEIKPGAKIPTDGVIIEGESEVDESLITGESLMVPRYKGFPVIAGSIN
Sbjct: 421 EIPVEFLQVGDTVEIKPGAKIPTDGVIIEGESEVDESLITGESLMVPRYKGFPVIAGSIN 480

Query: 481 GPNRFLLTATSVGDDTKLAQIIQTMKQAQLSKAPIQHYADYLASKFVPSVLVLAMITFVT 540
           GPNRFLLTATSVGDDTKLAQIIQTMKQAQLSKAPIQHYADYLASKFVPSVLVLAMITFVT
Sbjct: 481 GPNRFLLTATSVGDDTKLAQIIQTMKQAQLSKAPIQHYADYLASKFVPSVLVLAMITFVT 540

Query: 541 WTILSRVLSNPPSIFDSPNGKFFICLEMTISVIVVACPCALGLAAPTAIMVGTGLGAKHG 600
           WTILSRVLSNPPSIFDSPNGKFFICLEMTISVIVVACPCALGLAAPTAIMVGTGLGAKHG
Sbjct: 541 WTILSRVLSNPPSIFDSPNGKFFICLEMTISVIVVACPCALGLAAPTAIMVGTGLGAKHG 600

Query: 601 VLIKGGDILEKCSSLETFLFDKTGTLTTGHMTVEQFVPMGVRDNLTTEELLCINASEAVS 660
           VLIKGGDILEKCSSLETFLFDKTGTLTTGHMTVEQFVPMGVRDNLTTEELLCINASEAVS
Sbjct: 601 VLIKGGDILEKCSSLETFLFDKTGTLTTGHMTVEQFVPMGVRDNLTTEELLCINASEAVS 660

Query: 661 EHPVGKAIVEFTDSLIEDCDRTAVVTKSKTILGGGLICDCELDGKAYHVVIGNRNVMQDM 720
           EHPVGKAIVEFTDSLIEDCDRTAVVTKSKTILGGGLICDCELDGKAYHVVIGNRNVMQDM
Sbjct: 661 EHPVGKAIVEFTDSLIEDCDRTAVVTKSKTILGGGLICDCELDGKAYHVVIGNRNVMQDM 720

Query: 721 SLSADASSTLAYVKINGELVGRFEISDFIKKDAAEVVQYLTEKGHRVCMVTGDNHKSAMK 780
           SLSADASSTLAYVKINGELVGRFEISDFIKKDAAEVVQYLTEKGHRVCMVTGDNHKSAMK
Sbjct: 721 SLSADASSTLAYVKINGELVGRFEISDFIKKDAAEVVQYLTEKGHRVCMVTGDNHKSAMK 780

Query: 781 VALELGIEANNVYSELTPADKNQLVQDLQDGGRKNVAFIGDGINDSPALVTSDLGVSIST 840
           VALELGIEANNVYSELTPADKNQLVQDLQDGGRKNVAFIGDGINDSPALVTSDLGVSIST
Sbjct: 781 VALELGIEANNVYSELTPADKNQLVQDLQDGGRKNVAFIGDGINDSPALVTSDLGVSIST 840

Query: 841 GTDIAMEAADVIILNRSENNHVSLRELIYALDIAQKTFRRVKINFFWAICYNLFMLPIAM 900
           GTDIAMEAADVIILNRSENNHVSLRELIYALDIAQKTFRRVKINFFWAICYNLFMLPIAM
Sbjct: 841 GTDIAMEAADVIILNRSENNHVSLRELIYALDIAQKTFRRVKINFFWAICYNLFMLPIAM 900

Query: 901 GVLVPWEITMDPIXXXXXXXXXXXXXXXXXXXXXXWKPPKLDVSPKSQKPSAWSRISALF 960
           GVLVPWEITMDPI                      WKPPKLDVSPKSQKPSAWSRISALF
Sbjct: 901 GVLVPWEITMDPIVAVACMAASSVSVVGNSLLLNLWKPPKLDVSPKSQKPSAWSRISALF 960

Query: 961 RREKSVRPDDIELQT 975
           RREKSVRPDDIELQT
Sbjct: 961 RREKSVRPDDIELQT 975

>KLLA0F07447g 700685..703612 similar to sp|P38995 Saccharomyces
           cerevisiae YDR270w CCC2 probable copper-transporting
           ATPase, start by similarity
          Length = 975

 Score =  956 bits (2470), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 494/981 (50%), Positives = 679/981 (69%), Gaps = 28/981 (2%)

Query: 7   AVLLVEGMTCGACVATIESQLKRIKGVDEVTVSLITGECEVRFEKEDTDEETLKGAIIDC 66
           A++ V+GMTCGACV T+++Q+  + GV E  VSL+T EC V F+K  T    +   I +C
Sbjct: 6   ALISVQGMTCGACVKTVQTQVGNVDGVTECEVSLLTEECHVLFDKGRTTTSEILETIDEC 65

Query: 67  GFSATVLRVQDVEAGQIARQRKTAVLSVQHMTCGACVATITNNLEAQEGVLEVAVSLATE 126
           GF  +++  + ++      ++ + +L V  MTCGACV T+T  +    GVLE  VSL TE
Sbjct: 66  GFDGSLISEEPLDYDVTTTEQISGILLVSGMTCGACVKTVTGQVLKLSGVLECDVSLVTE 125

Query: 127 ECRVEFDPAVVTAAELKGIIDDSGFEAEIINDDAERPTRGSTVRKATLKVLGMTCGACVS 186
           EC+V+FDP   + AE+   IDD GF+A++I++++   +  S  ++  LK+ GM   +  +
Sbjct: 126 ECKVKFDPHFTSMAEIAECIDDCGFDAKVISENSS--SVPSNEKRLCLKIFGMLSESDRA 183

Query: 187 TVESALSQEPGVVSIQVSLATEEAQLEYNPAVIGVRAIASKIEDLGFESAPVNSFNSVAQ 246
            +ES +S+  GV+SI  SL +EEA + ++   IG R I   IE++GF++   N+ ++  Q
Sbjct: 184 DIESKVSELKGVISIDTSLQSEEATVIHDANEIGNRDIIDCIEEMGFQTFISNTLDNSTQ 243

Query: 247 VNLLAKVREINFWKRTCVQSCCFMVLMLLLYKAGPLWIPARNLFF-YKQTGIPGLFYRDI 305
           ++LL+K +EI FWK+ C++     +L++ LY   P+  PA    F + QT I GLFYRDI
Sbjct: 244 LSLLSKTKEIQFWKKNCIRGGISSILIMGLYMCVPMLFPAVLTHFPFVQTPIIGLFYRDI 303

Query: 306 IGFIITCYVQFWVGWHFYPAGWKSIRHGSGSMDTVVLLSTLCSFAFSLYSIAMNVAKKSE 365
           IG IIT YVQ +VG +FY A W S++HGSG+MDT++ LST+C++ FS YSI  ++  KS 
Sbjct: 304 IGIIITTYVQIYVGSYFYKAAWISLKHGSGTMDTLIGLSTVCAYIFSCYSIISSIYHKST 363

Query: 366 RMPNVIFDASVMLIGFISVGKLLENKAKSKTNNSLSKLMSLAPSTCTII-ENGKAREIPV 424
           +MP VIFD +VML+ FIS+GKLLENKAKS+T+ ++SKL+SL PS+C+I+  +G  REI V
Sbjct: 364 KMPKVIFDTAVMLLTFISLGKLLENKAKSETSTAMSKLISLTPSSCSIVLPDGSTREISV 423

Query: 425 EFLQVGDTVEIKPGAKIPTDGVIIEGESEVDESLITGESLMVPRYKGFPVIAGSINGPNR 484
           E LQ  D VE+ PG KIP DGV+I  E+EVDESLITGES++V +  G  VI GS+NGP  
Sbjct: 424 ELLQPNDIVEVVPGMKIPADGVVIRNETEVDESLITGESMLVEKIVGSQVIGGSVNGPGH 483

Query: 485 FLLTATSVGDDTKLAQIIQTMKQAQLSKAPIQHYADYLASKFVPSVLVLAMITFVTWTIL 544
           F   A  VG+DTKLA II TMK+AQLSKAPIQ YAD +A  FVP V+ L+ ITF+TW ++
Sbjct: 484 FYFRAIRVGEDTKLANIIATMKKAQLSKAPIQKYADKMAGIFVPFVISLSAITFITWMLV 543

Query: 545 SRVLSNPPSIFDSPNGKFFICLEMTISVIVVACPCALGLAAPTAIMVGTGLGAKHGVLIK 604
           S  +  PP IF+S NGKFF+C++M+ISVI+VACPCALGLAAPTAIMVGTG+GA HGVLIK
Sbjct: 544 SYTMKTPPLIFNSENGKFFMCMQMSISVIIVACPCALGLAAPTAIMVGTGVGASHGVLIK 603

Query: 605 GGDILEKCSSLETFLFDKTGTLTTGHMTVEQFVPMGVRDNLTTEELLCINASEAVSEHPV 664
           GGD+LEKCS+L+TFLFDKTGTLTTG M+VE F+      +++      I+  E++ EHPV
Sbjct: 604 GGDVLEKCSALQTFLFDKTGTLTTGRMSVENFI--NYNSDVSDLHWKMISLCESIGEHPV 661

Query: 665 GKAIVEFTDSLIEDCDRTAV----VTKSKTILGGGLICDC--ELDGKAYHVVIGNRNVMQ 718
            KAIV + DS +   +++++    ++  + ++G G+ C+   +   K + + IGN+ +  
Sbjct: 662 AKAIVNYADSHV---NKSSIFDLDLSNEEVLIGKGISCNITDKNTSKIHTITIGNKKLFP 718

Query: 719 DMSLSADASSTL--AYVKINGELVGRFEISDFIKKDAAEVVQYLTEKGHRVCMVTGDNHK 776
           D SLS  ASSTL  +YV I+G LVG+FEISD +K+DA  VV+YL   G + CMVTGD H+
Sbjct: 719 DESLSDIASSTLTESYVSIDGSLVGKFEISDRVKEDAHFVVEYLQNLGIKCCMVTGDAHQ 778

Query: 777 SAMKVALELGIEANNVYSELTPADKNQLVQDLQDGGRKNVAFIGDGINDSPALVTSDLGV 836
           SA+KVA +LGI AN+V+SE+TP  K  +V  LQ+ G + VAF+GDGINDSPALV +DLG+
Sbjct: 779 SALKVAQQLGISANDVFSEVTPEQKRDIVIQLQNNGTERVAFVGDGINDSPALVEADLGI 838

Query: 837 SISTGTDIAMEAADVIILNRSENNHVSLRELIYALDIAQKTFRRVKINFFWAICYNLFML 896
           SIS+GTDIA+EAAD++IL+ S+N + SL+ L+YALDIA+KTF RVK+NFFWA+CYN FM+
Sbjct: 839 SISSGTDIAIEAADIVILD-SDNKNNSLKGLVYALDIARKTFYRVKLNFFWAVCYNTFMI 897

Query: 897 PIAMGVLVPWEITMDPIXXXXXXXXXXXXXXXXXXXXXXWKPPKLDVSPKSQKPS---AW 953
           PIAMG+L PW IT+ P+                      W PP L++  KS + S   +W
Sbjct: 898 PIAMGLLAPWGITLHPMLSSAAMALSSVSVVCSSLMLKRWTPPSLNI--KSMEASGGLSW 955

Query: 954 SRISALFRREKSVRPDDIELQ 974
            R    F R  S R DDIELQ
Sbjct: 956 LR----FGR-NSNRGDDIELQ 971

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 39/69 (56%)

Query: 171 KATLKVLGMTCGACVSTVESALSQEPGVVSIQVSLATEEAQLEYNPAVIGVRAIASKIED 230
           +A + V GMTCGACV TV++ +    GV   +VSL TEE  + ++        I   I++
Sbjct: 5   QALISVQGMTCGACVKTVQTQVGNVDGVTECEVSLLTEECHVLFDKGRTTTSEILETIDE 64

Query: 231 LGFESAPVN 239
            GF+ + ++
Sbjct: 65  CGFDGSLIS 73

>YDR270W (CCC2) [1102] chr4 (1005667..1008681) Copper-transporting
           P-type ATPase, member of the heavy-metal transporting
           P-type ATPases in the superfamily of P-type ATPases
           [3015 bp, 1004 aa]
          Length = 1004

 Score =  843 bits (2177), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/1004 (45%), Positives = 647/1004 (64%), Gaps = 45/1004 (4%)

Query: 5   RIAVLLVEGMTCGACVATIESQLKRIKGVDEVTVSLITGECEVRFEKEDTDEETLKGAII 64
           R  +L V GMTC AC  TI +QL+ +KGV +  +SL+T EC+V ++ E T  +++K  I 
Sbjct: 2   REVILAVHGMTCSACTNTINTQLRALKGVTKCDISLVTNECQVTYDNEVT-ADSIKEIIE 60

Query: 65  DCGFSATVLRVQDVEAGQIARQRKTAVLSVQHMTCGACVATITNNLEAQEGVLEVAVSLA 124
           DCGF   +LR  ++ A       K  +LSVQ MTCG+CV+T+T  +E  EGV  V VSL 
Sbjct: 61  DCGFDCEILRDSEITA----ISTKEGLLSVQGMTCGSCVSTVTKQVEGIEGVESVVVSLV 116

Query: 125 TEECRVEFDPAVVTAAELKGIIDDSGFEAEIINDDAERP--TRGSTVRKATLKVLGMTCG 182
           TEEC V ++P+  T    + +I+D GF++ II D       T  + + K T K       
Sbjct: 117 TEECHVIYEPSKTTLETAREMIEDCGFDSNIIMDGNGNADMTEKTVILKVT-KAFEDESP 175

Query: 183 ACVSTVESALS--QEPGVVSIQVSLATEEAQLEYNPAVIGVRAIASKIEDLGFESAPVNS 240
             +S+V        + GV SI++S       ++Y    +G+R +   +E  G++    ++
Sbjct: 176 LILSSVSERFQFLLDLGVKSIEISDDMHTLTIKYCCNELGIRDLLRHLERTGYKFTVFSN 235

Query: 241 FNSVAQVNLLAKVREINFWKRTCVQSCCFMVLMLLLYKAGPLWIPA---RNLFFYKQTG- 296
            ++  Q+ LL+K  EI FWK+  ++S    ++ +LLY   P+  P      +F YK+T  
Sbjct: 236 LDNTTQLRLLSKEDEIRFWKKNSIKSTLLAIICMLLYMIVPMMWPTIVQDRIFPYKETSF 295

Query: 297 IPGLFYRDIIGFIITCYVQFWVGWHFYPAGWKSIRHGSGSMDTVVLLSTLCSFAFSLYSI 356
           + GLFYRDI+G I+  Y+QF VG++FY A W S++HGSG+MDT+V +ST C++ FS++S+
Sbjct: 296 VRGLFYRDILGVILASYIQFSVGFYFYKAAWASLKHGSGTMDTLVCVSTTCAYTFSVFSL 355

Query: 357 AMNVAKKSE--RMPNVIFDASVMLIGFISVGKLLENKAKSKTNNSLSKLMSLAPSTCTII 414
             N+   S   ++P ++FD S+M+I +IS+GK LE  AKS+T+ +LSKL+ L PS C+II
Sbjct: 356 VHNMFHPSSTGKLPRIVFDTSIMIISYISIGKYLETLAKSQTSTALSKLIQLTPSVCSII 415

Query: 415 ---ENGKAREIPVEFLQVGDTVEIKPGAKIPTDGVIIEGESEVDESLITGESLMVPRYKG 471
              E  + +EIP+E LQV D VEIKPG KIP DG+I  GESE+DESL+TGES++VP+  G
Sbjct: 416 SDVERNETKEIPIELLQVNDIVEIKPGMKIPADGIITRGESEIDESLMTGESILVPKKTG 475

Query: 472 FPVIAGSINGPNRFLLTATSVGDDTKLAQIIQTMKQAQLSKAPIQHYADYLASKFVPSVL 531
           FPVIAGS+NGP  F    T+VG++TKLA II+ MK+AQLSKAPIQ YADYLAS FVP +L
Sbjct: 476 FPVIAGSVNGPGHFYFRTTTVGEETKLANIIKVMKEAQLSKAPIQGYADYLASIFVPGIL 535

Query: 532 VLAMITFVTWTILSRVLSNPPSIF--DSPNGKFFICLEMTISVIVVACPCALGLAAPTAI 589
           +LA++TF  W  +  + +NPP  F  ++    FFICL+   SV++VACPCALGLA PTAI
Sbjct: 536 ILAVLTFFIWCFILNISANPPVAFTANTKADNFFICLQTATSVVIVACPCALGLATPTAI 595

Query: 590 MVGTGLGAKHGVLIKGGDILEKCSSLETFLFDKTGTLTTGHMTVEQFVP-MGVRDNLTTE 648
           MVGTG+GA++GVLIKGG++LEK +S+ TF+FDKTGTLTTG M V++F+       N+  +
Sbjct: 596 MVGTGVGAQNGVLIKGGEVLEKFNSITTFVFDKTGTLTTGFMVVKKFLKDSNWVGNVDED 655

Query: 649 ELL-CINASEAVSEHPVGKAIVEFTDSLIEDCDR--TAVVTKSKTILGGGLICDCELDGK 705
           E+L CI A+E++S+HPV KAI+ + D L  +C++   AVV +S+ +LG G++  C+++G 
Sbjct: 656 EVLACIKATESISDHPVSKAIIRYCDGL--NCNKALNAVVLESEYVLGKGIVSKCQVNGN 713

Query: 706 AYHVVIGNRNVMQDMSL--------SADASSTLAYVKINGELVGRFEISDFIKKDAAEVV 757
            Y + IGN  ++ + +L        + D  +T++YV +NG + G FEI+D +K D+   V
Sbjct: 714 TYDICIGNEALILEDALKKSGFINSNVDQGNTVSYVSVNGHVFGLFEINDEVKHDSYATV 773

Query: 758 QYLTEKGHRVCMVTGDNHKSAMKVALELGIEANNVYSELTPADKNQLVQDLQDG-GRKNV 816
           QYL   G+   M+TGDN+ +A +VA E+GI   NVYS+++P  K  LV+ +QD  G   V
Sbjct: 774 QYLQRNGYETYMITGDNNSAAKRVAREVGISFENVYSDVSPTGKCDLVKKIQDKEGNNKV 833

Query: 817 AFIGDGINDSPALVTSDLGVSISTGTDIAMEAADVIILNRSENNHVSLRELIYALDIAQK 876
           A +GDGIND+PAL  SDLG++ISTGT+IA+EAAD++IL  ++ N  SLR L  A+DI+ K
Sbjct: 834 AVVGDGINDAPALALSDLGIAISTGTEIAIEAADIVILCGNDLNTNSLRGLANAIDISLK 893

Query: 877 TFRRVKINFFWAICYNLFMLPIAMGVLVPWEITMDPIXXXXXXXXXXXXXXXXXXXXXXW 936
           TF+R+K+N FWA+CYN+FM+PIAMGVL+PW IT+ P+                      W
Sbjct: 894 TFKRIKLNLFWALCYNIFMIPIAMGVLIPWGITLPPMLAGLAMAFSSVSVVLSSLMLKKW 953

Query: 937 KPPKL------DVSPKSQKPSAWSRISALFRREKSVRPDDIELQ 974
            PP +      D   K    + WSR   LF         DIE Q
Sbjct: 954 TPPDIESHGISDFKSKFSIGNFWSR---LFSTRAIAGEQDIESQ 994

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 36/66 (54%), Gaps = 1/66 (1%)

Query: 169 VRKATLKVLGMTCGACVSTVESALSQEPGVVSIQVSLATEEAQLEYNPAVIGVRAIASKI 228
           +R+  L V GMTC AC +T+ + L    GV    +SL T E Q+ Y+  V    +I   I
Sbjct: 1   MREVILAVHGMTCSACTNTINTQLRALKGVTKCDISLVTNECQVTYDNEVTA-DSIKEII 59

Query: 229 EDLGFE 234
           ED GF+
Sbjct: 60  EDCGFD 65

>Scas_615.9
          Length = 942

 Score =  828 bits (2138), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/926 (47%), Positives = 607/926 (65%), Gaps = 46/926 (4%)

Query: 92  LSVQHMTCGACVATITNNLEAQEGVLEVAVSLATEECRVEFDPAVVTAAELKGIIDDSGF 151
           L+VQ MTC AC + I   +   +GV  V VSL T EC VEF    V+   ++  ++D GF
Sbjct: 15  LAVQGMTCSACTSAIIAQVGKLDGVGSVEVSLVTSECHVEFQLEKVSLELIRETVEDCGF 74

Query: 152 EAEIINDDAERPTRGSTVRKATLKVL--------GMTC--GACVSTVES-ALSQEPGVVS 200
           +A+++            VR  T KVL        G +   G  VS  ++  + ++ G++S
Sbjct: 75  DAQVLTSTPMGSADADIVRTVTFKVLRSNYDVSSGFSAESGDSVSMEDTEKVGKQDGILS 134

Query: 201 IQVSLATEEAQLEYNPAVIGVRAIASKIEDLGF----ESAPVNSFNSVAQVNLLAKVREI 256
           ++ +L      + Y+   IG+R +      LG+    ES+ + S +S  Q+ LL+K  EI
Sbjct: 135 LEPALEVNTFNITYDENKIGIRDLIYFFNYLGYDATVESSNIISVSSATQLALLSKWDEI 194

Query: 257 NFWKRTCVQSCCFMVLMLLLYKAGPLWIP---ARNLFFYKQTG-IPGLFYRDIIGFIITC 312
            FWK TC+++C   ++ + LY   P+  P     N F +K+T  + GLFYRDIIG+ I  
Sbjct: 195 QFWKFTCLKACVCAIVAMALYMWIPMIFPNLIKNNHFPFKETFFVHGLFYRDIIGWAIAT 254

Query: 313 YVQFWVGWHFYPAGWKSIRHGSGSMDTVVLLSTLCSFAFSLYSIAMNVA-----KKSERM 367
           Y QF +G +FY A W S++HGSG+MDT++ LST C++ FS++SI   +      ++S  +
Sbjct: 255 YSQFRLGIYFYKAAWSSMKHGSGTMDTLIALSTSCAYLFSIFSIIHTMVLSRGNEESPML 314

Query: 368 PNVIFDASVMLIGFISVGKLLENKAKSKTNNSLSKLMSLAPSTCTIIE---NGKAREIPV 424
           PNV+FD SVMLI FIS GKLLENKAK++T++SLSKL+ L PS C I++   N ++  I +
Sbjct: 315 PNVVFDTSVMLIAFISFGKLLENKAKAQTSSSLSKLIQLTPSKCIILQDKNNIQSSHIEI 374

Query: 425 E--FLQVGDTVEIKPGAKIPTDGVIIEGESEVDESLITGESLMVPRYKGFPVIAGSINGP 482
           E   LQ  D +EIKPG KIP DG+II+GESE+DESL+TGES++V + KG  VIAGS+NGP
Sbjct: 375 ETNLLQRNDIIEIKPGMKIPADGIIIQGESEIDESLMTGESILVHKQKGSQVIAGSLNGP 434

Query: 483 NRFLLTATSVGDDTKLAQIIQTMKQAQLSKAPIQHYADYLASKFVPSVLVLAMITFVTWT 542
             F   A ++GDDTKLAQIIQTMK AQL+KAPIQ+ ADYLAS FVP++L L++ITF+TW 
Sbjct: 435 GHFYFKAINIGDDTKLAQIIQTMKSAQLNKAPIQNNADYLASIFVPTILCLSIITFITWI 494

Query: 543 ILSRVLSNPPSIF-DSPNGKFFICLEMTISVIVVACPCALGLAAPTAIMVGTGLGAKHGV 601
            LS +L+ PP IF ++ NGKF+   ++ ISVIVVACPCALGLA PTAIMVGTG+GA+HGV
Sbjct: 495 TLSNLLTKPPVIFTNNNNGKFYTSFQIAISVIVVACPCALGLATPTAIMVGTGIGAQHGV 554

Query: 602 LIKGGDILEKCSSLETFLFDKTGTLTTGHMTVEQFVPMGVRDNLTTEELLCINASEAVSE 661
           LIKGGDILE+ +++   +FDKTGT+TTG MTV++F+P    D+L    L CI A++++SE
Sbjct: 555 LIKGGDILERFNTITKIVFDKTGTITTGQMTVQRFIPYS-NDDLPV--LPCIMAAQSISE 611

Query: 662 HPVGKAIVEFTDSLIEDCDRTAVVTKSKTILGGGLICDCELDGKAYHVVIGNRNVMQDMS 721
           HPV KAIV +     +DCD   +VTKS+ I+G G+ C+CE  G+ Y V +G++ +M D  
Sbjct: 612 HPVAKAIVNYCGESSQDCDAGVIVTKSEIIIGKGVRCECEYQGRNYTVTVGHKALMTDSM 671

Query: 722 LSADASST-----LAYVKINGELVGRFEISDFIKKDAAEVVQYLTEKGHRVCMVTGDNHK 776
             +++ +T      +YV IN  LVG+FEI D +K+D A+++QYL    + + MVTGD+H 
Sbjct: 672 FDSNSDNTSDDFTKSYVSINDTLVGKFEIRDSVKEDVADIIQYLQGLHYDIYMVTGDSHG 731

Query: 777 SAMKVALELGIEANNVYSELTPADKNQLVQDLQDGGRKNVAFIGDGINDSPALVTSDLGV 836
           +AMKVA ++GI ANNVYS +TP+ K ++V+ LQ      VAF+GDGINDSP LVTSD+GV
Sbjct: 732 AAMKVAQQVGIAANNVYSGVTPSGKCEIVESLQADSVGGVAFVGDGINDSPVLVTSDIGV 791

Query: 837 SISTGTDIAMEAADVIILNRSENNHVSLRELIYALDIAQKTFRRVKINFFWAICYNLFML 896
           ++STGTDIAMEAAD+++L   ++   SL+ LIYALDI+  TF RVK N FWA+ YN+FM+
Sbjct: 792 ALSTGTDIAMEAADIVVLGNDQDERESLKGLIYALDISAMTFSRVKWNLFWALGYNIFMI 851

Query: 897 PIAMGVLVPWEITMDPIXXXXXXXXXXXXXXXXXXXXXXWKPPKL-DVSPKS-----QKP 950
           PIAMG+LVPW IT+ P+                      WKPP + D  P S      K 
Sbjct: 852 PIAMGILVPWGITIHPMVAGLAMALSSVFVVLNSLRLKSWKPPVIGDEHPLSSDYYHHKG 911

Query: 951 SAWSRIS--ALFRREKSVRPDDIELQ 974
           ++W R     LF     V   D+ELQ
Sbjct: 912 TSWIRSGWRKLFGMSSEVVYQDLELQ 937

 Score = 65.9 bits (159), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 71/157 (45%), Gaps = 10/157 (6%)

Query: 9   LLVEGMTCGACVATIESQLKRIKGVDEVTVSLITGECEVRFEKEDTDEETLKGAIIDCGF 68
           L V+GMTC AC + I +Q+ ++ GV  V VSL+T EC V F+ E    E ++  + DCGF
Sbjct: 15  LAVQGMTCSACTSAIIAQVGKLDGVGSVEVSLVTSECHVEFQLEKVSLELIRETVEDCGF 74

Query: 69  SATVLRVQDVEA--GQIARQRKTAVLSVQHMTCGACVATI--------TNNLEAQEGVLE 118
            A VL    + +    I R     VL   +       A          T  +  Q+G+L 
Sbjct: 75  DAQVLTSTPMGSADADIVRTVTFKVLRSNYDVSSGFSAESGDSVSMEDTEKVGKQDGILS 134

Query: 119 VAVSLATEECRVEFDPAVVTAAELKGIIDDSGFEAEI 155
           +  +L      + +D   +   +L    +  G++A +
Sbjct: 135 LEPALEVNTFNITYDENKIGIRDLIYFFNYLGYDATV 171

 Score = 54.7 bits (130), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 43/74 (58%)

Query: 167 STVRKATLKVLGMTCGACVSTVESALSQEPGVVSIQVSLATEEAQLEYNPAVIGVRAIAS 226
           +T+ K TL V GMTC AC S + + + +  GV S++VSL T E  +E+    + +  I  
Sbjct: 8   TTLYKGTLAVQGMTCSACTSAIIAQVGKLDGVGSVEVSLVTSECHVEFQLEKVSLELIRE 67

Query: 227 KIEDLGFESAPVNS 240
            +ED GF++  + S
Sbjct: 68  TVEDCGFDAQVLTS 81

>CAGL0M08602g complement(856349..859387) similar to sp|P38995
           Saccharomyces cerevisiae YDR270w CCC2, start by
           similarity
          Length = 1012

 Score =  778 bits (2008), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/969 (44%), Positives = 618/969 (63%), Gaps = 52/969 (5%)

Query: 8   VLLVEGMTCGACVATIESQLKRIKGVDEVTVSLITGECEVRFEKEDTDEETLKGAIIDCG 67
           VL+V GMTC +CV  +  Q++ ++GV    VSL+T EC+V  E     +  ++ A+ DCG
Sbjct: 5   VLIVRGMTCASCVNAVVGQVEALEGVSSCDVSLVTSECKVVSEDSVATDGIIE-AVEDCG 63

Query: 68  FSATVLRVQDVEAGQIARQRKTAVLSVQHMTCGACVATITNNLEAQEGVLEVAVSLATEE 127
           F   ++R + + A  + R      + ++ MTC +CVAT+T  LEA EGV +V VSL TEE
Sbjct: 64  FDCELIREKSM-APALCR----GFIGIKGMTCSSCVATVTKQLEAIEGVSDVDVSLMTEE 118

Query: 128 CRVEFDPAVVTAAELKGIIDDSGFEAEIINDDAERPTRG--STVRKATLKVLGMTCGACV 185
           C V FDP +V   ++K  IDD GF+  +    +  P  G  S  +   L++LG       
Sbjct: 119 CTVVFDPQLVAIEDIKETIDDCGFDGTV---SSSEPVGGADSRAKYVDLRLLGFN----- 170

Query: 186 STVESALSQ---------EPGVVSIQVSLATEEAQL--EYNPAVIGVRAIASKIEDLGFE 234
           S  ++ L Q         +     + ++L TE+  L   ++  +IG+R I   +E LG  
Sbjct: 171 SKDDNELDQLTDKLRGFKQDNAGILDMALNTEDYCLSVHFDTQIIGIRKIIDILESLGIN 230

Query: 235 SAPVNSFNSVAQVNLLAKVREINFWKRTCVQSCCFMVLMLLLYKAGPLWIPA---RNLFF 291
           +    SF+   Q+NLL K  EI +WK  CV+SC    + ++LY   P   P+     +F 
Sbjct: 231 AVVDVSFDKHTQLNLLTKASEIRYWKSACVKSCIVAFVTMVLYMGLPALFPSLMKDKIFP 290

Query: 292 YKQTG-IPGLFYRDIIGFIITCYVQFWVGWHFYPAGWKSIRHGSGSMDTVVLLSTLCSFA 350
           Y   G + GL+YRDIIGF +  YVQF +G  FY + W S++H +G+MDT+V  ST C++ 
Sbjct: 291 YSSVGAVNGLYYRDIIGFFLASYVQFVIGATFYKSAWASLKHYAGTMDTLVCFSTTCAYL 350

Query: 351 FSLYSIAMNVAK--KSERMPNVIFDASVMLIGFISVGKLLENKAKSKTNNSLSKLMSLAP 408
           FSLYS+   +     S ++P VIFD SVM++ +IS+GK LENKAKSKT+ +LSKL+SL P
Sbjct: 351 FSLYSMTECIVSPPASGKLPKVIFDTSVMIVAYISIGKYLENKAKSKTSTALSKLISLTP 410

Query: 409 STCTIIE---NGKAREIPVEFLQVGDTVEIKPGAKIPTDGVIIEGESEVDESLITGESLM 465
           S+C I++   +   +EI +E L+VGD   +KPGAKIP+DG++ +G SEVDESL+TGE+ +
Sbjct: 411 SSCIIVDKDDDSITQEIGIELLEVGDIAMVKPGAKIPSDGIVTKGISEVDESLMTGETNL 470

Query: 466 VPRYKGFPVIAGSINGPNRFLLTATSVGDDTKLAQIIQTMKQAQLSKAPIQHYADYLASK 525
           V +  G  V  G+ING        TSVGDDTKLA II+ MK AQL KA IQ Y DY+AS 
Sbjct: 471 VVKEIGSVVTGGTINGSGLIYFEVTSVGDDTKLANIIKVMKNAQLKKASIQRYTDYVASI 530

Query: 526 FVPSVLVLAMITFVTWTILSR---VLSNPPSIFDSPNGKFFICLEMTISVIVVACPCALG 582
           FVP+VL+L+++TF+ WT L+R   ++S      ++   +F++CL++  SV++VACPCALG
Sbjct: 531 FVPTVLILSLLTFIVWTSLTRSEKIISKLSIFGETSESRFYMCLQIATSVVIVACPCALG 590

Query: 583 LAAPTAIMVGTGLGAKHGVLIKGGDILEKCSSLETFLFDKTGTLTTGHMTVEQFVPMG-V 641
           LA PTAIMVGTG+ +++GVLIKGGD+LEK + + TF+FDKTGTLTTGHMTV+QFV    +
Sbjct: 591 LATPTAIMVGTGVASENGVLIKGGDVLEKFNEVNTFVFDKTGTLTTGHMTVQQFVGNAEM 650

Query: 642 RDNLTTEELLCINASEAVSEHPVGKAIVEFTDSLI-EDCDRTAVVTKSKTIL-GGGLICD 699
             NL   E  CI  +EA+S+HPV KA+V++   L+ E  + T+++ + + ++ G G+ C 
Sbjct: 651 IKNLFYLE--CIERAEALSDHPVSKAVVKYCRDLLGESFEGTSMIIEDEQLITGKGIKCT 708

Query: 700 CELDGKAYHVVIGNRNVMQDMSLSA-------DASSTLAYVKINGELVGRFEISDFIKKD 752
            +   K   + +GN+++M + SL             T+ Y+ I+ ++ GRFE+ D +K D
Sbjct: 709 VKAADKTLRITVGNKSLMDEDSLGEFWQMYGRAGPCTVTYLAIDDKVCGRFELLDEVKSD 768

Query: 753 AAEVVQYLTEKGHRVCMVTGDNHKSAMKVALELGIEANNVYSELTPADKNQLVQDLQDGG 812
           A +V++YL    + V MVTGD HKSAMKVA  + I  NNVYSE+TP  K+Q V+ L++ G
Sbjct: 769 AKDVIRYLRNNNYEVFMVTGDTHKSAMKVAEMVDIPPNNVYSEVTPDGKSQTVEYLREEG 828

Query: 813 RKNVAFIGDGINDSPALVTSDLGVSISTGTDIAMEAADVIILNRSENNHVSLRELIYALD 872
           R  +AFIGDGINDS ALVTSDLG++IS+GT++A+EAA ++ILN  + +  +L+ ++ ALD
Sbjct: 829 RV-IAFIGDGINDSLALVTSDLGIAISSGTEVAIEAAGIVILNDPDTDEPTLKGVVNALD 887

Query: 873 IAQKTFRRVKINFFWAICYNLFMLPIAMGVLVPWEITMDPIXXXXXXXXXXXXXXXXXXX 932
           ++ +TFRRVK+N FWA+CYN+FMLPIAMG+LVPW IT+ P+                   
Sbjct: 888 LSIRTFRRVKLNLFWALCYNVFMLPIAMGILVPWGITLHPMVAGLAMAFSSVSVVVNSLM 947

Query: 933 XXXWKPPKL 941
              WK P+L
Sbjct: 948 LKWWKAPEL 956

 Score = 94.7 bits (234), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 57/164 (34%), Positives = 89/164 (54%), Gaps = 10/164 (6%)

Query: 88  KTAVLSVQHMTCGACVATITNNLEAQEGVLEVAVSLATEECRVEFDPAVVTAAELKGIID 147
           K  VL V+ MTC +CV  +   +EA EGV    VSL T EC+V  + +V T   ++  ++
Sbjct: 2   KEVVLIVRGMTCASCVNAVVGQVEALEGVSSCDVSLVTSECKVVSEDSVATDGIIEA-VE 60

Query: 148 DSGFEAEIINDDAERPTRGSTVRKATLKVLGMTCGACVSTVESALSQEPGVVSIQVSLAT 207
           D GF+ E+I + +  P     + +  + + GMTC +CV+TV   L    GV  + VSL T
Sbjct: 61  DCGFDCELIREKSMAP----ALCRGFIGIKGMTCSSCVATVTKQLEAIEGVSDVDVSLMT 116

Query: 208 EEAQLEYNPAVIGVRAIASKIEDLGFE-----SAPVNSFNSVAQ 246
           EE  + ++P ++ +  I   I+D GF+     S PV   +S A+
Sbjct: 117 EECTVVFDPQLVAIEDIKETIDDCGFDGTVSSSEPVGGADSRAK 160

 Score = 38.1 bits (87), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 34/66 (51%), Gaps = 1/66 (1%)

Query: 169 VRKATLKVLGMTCGACVSTVESALSQEPGVVSIQVSLATEEAQLEYNPAVIGVRAIASKI 228
           +++  L V GMTC +CV+ V   +    GV S  VSL T E ++    +V     I   +
Sbjct: 1   MKEVVLIVRGMTCASCVNAVVGQVEALEGVSSCDVSLVTSECKVVSEDSV-ATDGIIEAV 59

Query: 229 EDLGFE 234
           ED GF+
Sbjct: 60  EDCGFD 65

>ACR086C [1133] [Homologous to ScYDR270W (CCC2) - SH]
           (511968..514400) [2433 bp, 810 aa]
          Length = 810

 Score =  625 bits (1612), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/829 (43%), Positives = 513/829 (61%), Gaps = 31/829 (3%)

Query: 149 SGFEAEIINDDAERPTRGSTV-RKATLKVLGMTCGACVSTVESALSQEPGVVSIQVSLAT 207
           +G EAE+      R   GS     A L V GMTC ACV TV+ A+    GVV+ +VSL T
Sbjct: 4   TGLEAEM-----ARMGNGSMAGTTAVLSVRGMTCAACVKTVDEAVRAVDGVVNAEVSLVT 58

Query: 208 EEAQLEYNPAVIGVRAIASKIEDLGFESAPVNSFNSVAQVNLLAKVREINFWKRTCVQSC 267
           EE ++EY    +G+R I   IED GFE A V       QV  LA+  E   W+R   Q+ 
Sbjct: 59  EECRVEYERKRVGLRQIVETIEDCGFE-ARVGGCAREEQVRRLARAEETAQWRRRAAQAW 117

Query: 268 CFMVLMLLLYKAGPLWIPARNLFFYKQTGIPGLFYRDIIGFIITCYVQFWVGWHFYPAGW 327
               +M+ LY   PL            T + GLF+RD+ G  +   V    G  F   G 
Sbjct: 118 AAAAVMMGLYMVAPLEEA------LGPTPLAGLFWRDVAGLAVASGVLATAGRPFL-RGL 170

Query: 328 KSIRHGSGSMDTVVLLSTLCSFAFSLYSIAMNVAKKSERMPNVIFDASVMLIGFISVGKL 387
            ++RHG G+MDT+V LS+  ++ FS+ +I   V   S   P+   D +VML+ FI VGKL
Sbjct: 171 GALRHGRGTMDTLVALSSGVTYLFSVATICRGVWLGSADPPSTFLDTTVMLVAFICVGKL 230

Query: 388 LENKAKSKTNNSLSKLMSLAPSTCTIIENGKAREIPVEFLQVGDTVEIKPGAKIPTDGVI 447
           LE++A+++  +SL++++S APS CTI E+G  RE+ VE LQ GD V ++PG K+P DG +
Sbjct: 231 LESRARARAADSLARMVSSAPSMCTIRESGSDREVEVELLQAGDVVVMRPGTKLPADGTV 290

Query: 448 IEGESEVDESLITGESLMVPRYKGFPVIAGSINGPNRFLLTATSVGDDTKLAQIIQTMKQ 507
           +EGE+EVDESL+TGES +VP+Y G  V+ GS+NG   FL  A  VG++T+LA I+  MKQ
Sbjct: 291 LEGEAEVDESLMTGESTLVPKYPGSRVLCGSVNGAAGFLYRADLVGEETRLAGIVAAMKQ 350

Query: 508 AQLSKAPIQHYADYLASKFVPSVLVLAMITFVTWTILSRVLSNPPSIFDSPNGKFFICLE 567
           AQL+KAPIQ YAD+LAS F+PSVL+LA++TFV W ++  +L+ PPSIF++ N + ++C  
Sbjct: 351 AQLAKAPIQRYADFLASWFIPSVLILALLTFVCWMLICTLLATPPSIFNNSN-RLYVCSR 409

Query: 568 MTISVIVVACPCALGLAAPTAIMVGTGLGAKHGVLIKGGDILEKCSSLETFLFDKTGTLT 627
           + I+VIVVACPC LGLAAPTAIMVGTGLGA+ G+L KGGD++E  ++++  LFDKTGTLT
Sbjct: 410 IAITVIVVACPCPLGLAAPTAIMVGTGLGAERGLLFKGGDVIETAAAVQAILFDKTGTLT 469

Query: 628 TGHMTVEQFVPMGVRDNLTTEELLCINASEAVSEHPVGKAIVEFTDSLI--EDCDRTAVV 685
           TG +TV  F        LT ++   + A+E +SEHP+ +AIV + +     E   R  VV
Sbjct: 470 TGKLTVHNFTSES--KALTPDQWALVCAAERLSEHPIARAIVTYAEPYASPEAVARI-VV 526

Query: 686 TKSKTILGGGLICDCELDGKAYHVVIGNRNVMQDMSLSADASSTLAYVKINGELVGRFEI 745
              + ++G G+ C  +LDG  + + IG+  ++ +   S  + ST ++V +N  L+GRF++
Sbjct: 527 LNHEVLVGLGVRCVLQLDGVEHRITIGSARLLPERP-SKFSGSTASFVAVNDVLLGRFDL 585

Query: 746 SDFIKKDAAEVVQYLTEKGHRVCMVTGDNHKSAMKVALELGIEANNVYSELTPADKNQLV 805
           SD +++DA EVVQ L  +GH V MVTGDNH++AM V+  LGI  NNV+SE  P  K  ++
Sbjct: 586 SDSLREDAYEVVQALLSRGHYVGMVTGDNHEAAMHVSHALGIPLNNVFSERLPEGKCDVL 645

Query: 806 QDLQDGGRKNVAFIGDGINDSPALVTSDLGVSISTGTDIAMEAADVIILNRSENNHVSLR 865
           + L+      VAFIGDGINDS AL  SDLG+S+S  +DI  +AA +++L+ S  +   L 
Sbjct: 646 RQLRQ-KYDYVAFIGDGINDSVALAESDLGISLSGNSDIVADAAGIVVLDHS--SAPPLT 702

Query: 866 ELIYALDIAQKTFRRVKINFFWAICYNLFMLPIAMGVLVPWEITMDPIXXXXXXXXXXXX 925
            ++YA+D+A+ TF RVK+N FWA+ YN  MLP++MGVL+PW I + P+            
Sbjct: 703 RILYAIDLARATFNRVKLNIFWAVLYNSLMLPVSMGVLIPWGIQLPPMAAAAGMAMSSVS 762

Query: 926 XXXXXXXXXXWKPPKLDVSPKSQKPSAWSRISALFRREKSVRPDDIELQ 974
                     W+P      P + + +A       F+  K  R D +ELQ
Sbjct: 763 VVTSSLLLARWRP-----VPAASRKAAVGSWRNFFK--KGPRADQVELQ 804

 Score = 65.5 bits (158), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 44/67 (65%)

Query: 89  TAVLSVQHMTCGACVATITNNLEAQEGVLEVAVSLATEECRVEFDPAVVTAAELKGIIDD 148
           TAVLSV+ MTC ACV T+   + A +GV+   VSL TEECRVE++   V   ++   I+D
Sbjct: 22  TAVLSVRGMTCAACVKTVDEAVRAVDGVVNAEVSLVTEECRVEYERKRVGLRQIVETIED 81

Query: 149 SGFEAEI 155
            GFEA +
Sbjct: 82  CGFEARV 88

 Score = 59.7 bits (143), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 39/66 (59%)

Query: 7  AVLLVEGMTCGACVATIESQLKRIKGVDEVTVSLITGECEVRFEKEDTDEETLKGAIIDC 66
          AVL V GMTC ACV T++  ++ + GV    VSL+T EC V +E++      +   I DC
Sbjct: 23 AVLSVRGMTCAACVKTVDEAVRAVDGVVNAEVSLVTEECRVEYERKRVGLRQIVETIEDC 82

Query: 67 GFSATV 72
          GF A V
Sbjct: 83 GFEARV 88

>KLLA0D04092g complement(344666..348124) some similarities with
            sp|P38995 Saccharomyces cerevisiae YDR270w CCC2 probable
            copper-transporting ATPase P16.2.f2.1, hypothetical start
          Length = 1152

 Score =  327 bits (838), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 276/932 (29%), Positives = 460/932 (49%), Gaps = 99/932 (10%)

Query: 73   LRVQDVEAGQIARQRKTAVLSVQHMTCGACVATITNNLEAQEGVLEVAVSLATEECRVEF 132
            ++++D+      ++ K    S+  +TC AC ++ITN +   + V +VAV++ ++      
Sbjct: 173  IQLKDILPVHTEKKYKVTA-SIGGITCAACASSITNAVSDLDFVSDVAVNVVSKVGVFIL 231

Query: 133  DPAVVTAA-ELKGIIDDSGFEAEIINDDA--ERPTRGSTVRKATLKVLGMTCGAC-VSTV 188
            D    +   +LK  ++D GF  E +         +  S  R  T+K+ GM C  C V T+
Sbjct: 232  DSDDQSKLDQLKETVEDCGFVYEAVGSPTLTNHISVKSPARHVTVKIEGMFCSNCPVRTI 291

Query: 189  ESALSQEPGVVSI----QVSLATEEAQLEYNPAV---IGVRAIASKI-EDLGFESAPVNS 240
            +S L      + I    +++L     +  Y P V   I +R I SKI E+L  E      
Sbjct: 292  KSLLDIANAELIIDNTDELTLKHPYIKFTYIPNVERGITIRNIFSKITEELTTEEHKDIK 351

Query: 241  FNSVAQVNLLAKVREI---NFWK--RTCVQSCCFMVLMLLLYKAGPLWIPARNLF--FYK 293
               V +V L   ++E+     W   +  +      +        G   +P+ N F  +  
Sbjct: 352  VVIVKEVTLEEHLKEMAKKETWSIAKRLIAVTVMAIPTFAFGIVGMALLPSSNKFREWVD 411

Query: 294  QTGIPGLFYRDI-IGFIITCYVQFWVGWHFYPAGWKSI----RHGS---------GSMDT 339
            +    G   R + I FII+  V F+V   F+    K I    +H +         GSM+ 
Sbjct: 412  EPTWVGNVSRVVWILFIISTPVYFFVADIFHRKAVKEIYSLWKHSNNWKRRLFRFGSMNL 471

Query: 340  VVLLSTLCSF--AFSLYSIAMNVAKKSE--RM----PNVIFDASVMLIGFISVGKLLENK 391
            ++ L T  ++  + +L  IA +  + +   RM        FD+ V L  F+ +G+LLE+ 
Sbjct: 472  LMSLGTTVAYFASIALLGIAASRPRDTSDSRMHKGLSTTYFDSVVFLTFFLLIGRLLESL 531

Query: 392  AKSKTNNSLSKLMSLAPSTCTIIEN-----GKAREIPVEFLQVGDTVEIKPGAKIPTDGV 446
            AK+KT +++S L S    T T+++       +   + +++L++GD ++I PG   P D +
Sbjct: 532  AKTKTASAISNLSSFKQETATLMQKVGDQYQEVETVQIQYLELGDYIKISPGQSPPLDSI 591

Query: 447  IIEGESEVDESLITGESLMVPRYKGFPVIAGSIN-GPNRFLLTATSVGDDTKLAQIIQTM 505
            I+EGE+E DES +TGES+ + R +G  + AG++N G +  +   +S   ++ L QI+ T+
Sbjct: 592  ILEGETEFDESALTGESIPMVRLRGDQIFAGTVNVGSSSVIAKVSSFDGESLLDQIVNTV 651

Query: 506  KQAQLSKAPIQHYADYLASKFVPSVLVLAMITFVTWTILSRVLSNPPSIFDSPNGKFFI- 564
            +  QL++API+  AD L   FVP ++ LA++T+V W  L      P    D+  G + + 
Sbjct: 652  RDGQLNRAPIERLADILTGYFVPIIIFLAILTWVVWLSLGLSGKLPEHYLDTDIGGWPVW 711

Query: 565  CLEMTISVIVVACPCALGLAAPTAIMVGTGLGAKHGVLIKGGD-ILEKCSSLETFLFDKT 623
             LE  ISV V+ACPC +GLAAPTA+ VG+G+ AK G+L +GG    ++   +    FDKT
Sbjct: 712  SLEFAISVFVIACPCGIGLAAPTALFVGSGMAAKFGILCRGGGAAFQEGCKIAIVCFDKT 771

Query: 624  GTLTTGH-MTVEQFVPMGVRDNLTTEELLCINASEAVSEHPVGKAIVEFTDSLIEDCDRT 682
            GTLT G+ M V  +   G  + L    +      E+ S HP+   + +F D+       T
Sbjct: 772  GTLTLGNEMKVTNYSLHG-DEKLAKIGIEVTRDMESGSRHPLAIGVKKFIDNTFGKKTGT 830

Query: 683  AVVTKSKTILGGGL----ICDCEL---DGKAYH------VVIGNRNVMQDMS--LSADAS 727
              V     I GGGL    I D +L   D + +        ++GN  +++D    L+++  
Sbjct: 831  VKVPDPVEITGGGLKGEIIIDNDLSLPDARIWKEVDPEMAIVGNERLLRDYKCHLTSEQL 890

Query: 728  STLAYVKINGELVGRFEI-------------------SDFIKKDAAEVVQYLTEKGHRVC 768
              LA  K  G+ +    I                    D I+ +A +V++ L   G    
Sbjct: 891  KLLAEWKARGKSLMVTAIKSRSYFGNDNFYPVMMCAAKDEIRPEAKDVIKELRRSGIECW 950

Query: 769  MVTGDNHKSAMKVALELGIEANNVYSELTPADKNQLVQDLQ------DGGRKNVAFIGDG 822
            M++GDN  +A  VA EL I+  NV +E+ P +K   V+ +Q      +G  K VA +GDG
Sbjct: 951  MISGDNEVTARAVAQELDID--NVIAEVLPEEKAAKVKWIQHNNIGANGHHKVVAMVGDG 1008

Query: 823  INDSPALVTSDLGVSISTGTDIAMEAADVIILNRSENNHVSLRELIYALDIAQKTFRRVK 882
            IND+PAL  +D+G+++++G+++AM + D ++L+        L  L  +  +    F R+K
Sbjct: 1009 INDAPALAAADVGIALASGSELAMTSCDFVLLSPINTLVSLLALLKLSKTV----FNRIK 1064

Query: 883  INFFWAICYNLFMLPIAMGVLVPWEIT-MDPI 913
             NF WA+ YN+  LPIA GV+ P+  T + P+
Sbjct: 1065 FNFTWALVYNMLALPIAAGVIYPYHNTRLSPV 1096

>AGL041C [4270] [Homologous to ScYDR270W - NSH] (628428..632129) [3702
            bp, 1233 aa]
          Length = 1233

 Score =  313 bits (802), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 281/1018 (27%), Positives = 483/1018 (47%), Gaps = 130/1018 (12%)

Query: 29   RIKGVDEVTVSLITGECEVRFEKEDTDEETLKGAIIDCGFSATVLRVQDVEAGQIARQRK 88
            +   VDE  + L  G+  V    +    +++  A+ D  F A ++ ++ V      + + 
Sbjct: 229  KTSAVDENGMELTPGKLSVLLSNK-LYAQSVADALRDNNFQAQLVDMKPVV--NELKYKI 285

Query: 89   TAVLSVQHMTCGACVATITNNLEAQEGVLEVAVSLATEECRVEFDPAVVTAAE-LKGIID 147
            TA++    +TC +C  +IT      + + +VAV+  T+      D     A   L+ +++
Sbjct: 286  TAIIG--GITCASCCNSITAAASKLDFIADVAVNAVTKTAIFISDVNNERAINCLRDVVE 343

Query: 148  DSGFEAEIINDDAERPTRGSTV----RKATLKVLGMTCGACVSTVESALSQ--EPGVVSI 201
            + GFE E++     + T  S+V    R  T+++ GM C +C   V ++L    +  +   
Sbjct: 344  ECGFEFELVG--VPQSTIHSSVQTERRVVTIEIDGMYCQSCPQRVVASLENYNKANIEVT 401

Query: 202  QV-SLATEEAQLEYNPAVIGVRAIASKIEDLGFESAPVNSFNSVA----QVNLL-AKVRE 255
            QV +L +      Y P       I + +E +     P NS   ++    + +LL +K+++
Sbjct: 402  QVPTLKSPHLTFSYVPNQSNGTTIRALVEHVRTSILPANSSYQISVKVVEGSLLDSKLKD 461

Query: 256  INFWKRTCVQSCCF-------------MVLMLLL--------YKAGPLWIPARNLFFYKQ 294
            +N  ++  +  C               ++ M LL        +   PLW+          
Sbjct: 462  LNEREQKSIMRCLIFAAIVAIPTFVFGIIGMSLLPGEHRFRKWLEKPLWV---------- 511

Query: 295  TGIPGLFYRDIIGFIITCYVQFWVGWHF-------------YPAGWKSIRHGSGSMDTVV 341
              +P + +   I  I++  V F V   F             Y   W +     GSM+ +V
Sbjct: 512  KNVPRVIW---ILLILSTPVYFSVAEQFHAKACRELHFLWAYQKSWTARLFKFGSMNLLV 568

Query: 342  LLSTLCSFAFSLYSIAMNV----AKKSERMPNVIFDASVMLIGFISVGKLLENKAKSKTN 397
             L T  ++  S+  + ++     A   +  P+  FD+ V L  F+ +G+LLE+ +KSK  
Sbjct: 569  SLGTSVAYFASILLLILSALKKDANHHKGSPDTYFDSVVFLTLFLLIGRLLESLSKSKMV 628

Query: 398  NSLSKLMSLAPSTCTIIENGKARE------IPVEFLQVGDTVEIKPGAKIPTDGVIIEGE 451
             +L  L SL   T  +++   AR+      +  E L++GD + IKPGA    D +I++GE
Sbjct: 629  KTLESLTSLKQRTGILMQADGARDFKKETSVSAEMLELGDHILIKPGASPAVDALIVQGE 688

Query: 452  SEVDESLITGESLMVPRYKGFPVIAGSIN-GPNRFLLTATSVGDDTKLAQIIQTMKQAQL 510
            +E DES +TGES  +  + G  + AG++N G    +   ++   ++ L  +I  ++  QL
Sbjct: 689  TEFDESSLTGESRPITHFPGDQIFAGTVNVGQCAVIAKVSTAPGNSLLDHVISAVRDGQL 748

Query: 511  SKAPIQHYADYLASKFVPSVLVLAMITFVTWTIL--SRVLSNPPSIFDSPNGKFFICLEM 568
              API+  AD L   FVP +++LA++T+  W IL  + VLS    +  S  G  F  LE 
Sbjct: 749  RGAPIERIADVLTGYFVPFIVLLAILTWAIWLILGFAGVLSQE-KLDGSVGGWPFWSLEF 807

Query: 569  TISVIVVACPCALGLAAPTAIMVGTGLGAKHGVLIKGGD-ILEKCSSLETFLFDKTGTLT 627
             I+V V+ACPC +GLAAPTA+ VG  + AK+G+L +GG    +  S + T  FDKTGTLT
Sbjct: 808  AIAVFVIACPCGIGLAAPTALFVGANIAAKYGILARGGSAAFQMGSKVTTVCFDKTGTLT 867

Query: 628  TGHMTVEQFVPMGVRDNLTTEELL--CINASEAVSEHPVGKAIVEFT-DSLIEDCDRTAV 684
             G     +     +  +    ++L   ++     S+HP+  ++  F   +L ED     V
Sbjct: 868  KG--CAPEVTDYAIYPDPRIHKILGKVLHEFGLASKHPLSHSMKCFALKTLGEDLSDINV 925

Query: 685  VTKSKTILGGGLICDCELDGK----------AYHVVIGNRNVMQD--MSLSADASSTLAY 732
            + + K I G G+    E                 V++GN   M +    LS D  S L  
Sbjct: 926  L-EIKEIPGKGMTGVIEPSPAQPSGFRDELVPSEVIVGNEKFMAENGCQLSPDQESLLYS 984

Query: 733  VKINGE---LVGR----------------FEISDFIKKDAAEVVQYLTEKGHRVCMVTGD 773
             KI G    ++G                   + D ++ +A EVVQ L E+G    M++GD
Sbjct: 985  WKIEGRSIIIIGMNFPEGAATQCFIPTLFLAVRDELRPEAKEVVQALHERGIECWMISGD 1044

Query: 774  NHKSAMKVALELGIEANNVYSELTPADKNQLVQDLQDGGRKNV--AFIGDGINDSPALVT 831
            N  +A  VALE+GI+  +V +++ P  K + +Q +++   + V  A +GDG+ND+PA+  
Sbjct: 1045 NSLAANAVALEVGIK--HVIADVLPEGKAEKIQWIRETSGQGVAIAMVGDGMNDAPAIAA 1102

Query: 832  SDLGVSISTGTDIAMEAADVIILNRSENNHVSLRELIYALDIAQKTFRRVKINFFWAICY 891
            +D+G+S+++G+D+AM + D ++L++       L  ++  L +++K FRRVK NF WA+ Y
Sbjct: 1103 ADVGISLASGSDLAMISCDFVLLSKKN----PLTGIVVLLQLSKKVFRRVKFNFVWALVY 1158

Query: 892  NLFMLPIAMGVLVPW-EITMDPIXXXXXXXXXXXXXXXXXXXXXXWKPPKLDVSPKSQ 948
            N+  +PIA GVL P+ E  + P+                      ++P K  + P+SQ
Sbjct: 1159 NIICVPIAAGVLYPYKETRLSPVWASIAMAASSVSVVLSSNLLRFYRPSK--IVPRSQ 1214

>YBR295W (PCA1) [472] chr2 (792805..796455) P-type copper-transporting
            ATPase, involved in resistance to cadmium [3651 bp, 1216
            aa]
          Length = 1216

 Score =  292 bits (747), Expect = 7e-83,   Method: Compositional matrix adjust.
 Identities = 186/619 (30%), Positives = 319/619 (51%), Gaps = 43/619 (6%)

Query: 308  FIITCYVQFWVGWHFYPAGWKSIRHGSG-SMDTVVLLSTLCSFAFSLYSIAMNVAKKSER 366
             ++   +QF +   FY    KS+       MD +++LST  ++ FS+ S    V  +   
Sbjct: 595  MVLATIIQFVIAGPFYLNALKSLIFSRLIEMDLLIVLSTSAAYIFSIVSFGYFVVGRPLS 654

Query: 367  MPNVIFDASVMLIGFISVGKLLENKAKSKTNNSLSKLMSLAPSTCTIIENGKAREIPVEF 426
                 F+ S +L+  I VG+ +   A+ +   S+S     A S   + + GK  EI +  
Sbjct: 655  TEQ-FFETSSLLVTLIMVGRFVSELARHRAVKSISVRSLQASSAILVDKTGKETEINIRL 713

Query: 427  LQVGDTVEIKPGAKIPTDGVIIEGESEVDESLITGESLMVPRYKGFPVIAGSINGPNRFL 486
            LQ GD  ++ P ++IPTDG +I G SEVDE+LITGES+ VP+     V+AGS+NG     
Sbjct: 714  LQYGDIFKVLPDSRIPTDGTVISGSSEVDEALITGESMPVPKKCQSIVVAGSVNGTGTLF 773

Query: 487  LTATSVGDDTKLAQIIQTMKQAQLSKAPIQHYADYLASKFVPSVLVLAMITFVTWTILSR 546
            +  + +  +  ++ I   + +A+L+K  IQ+ AD +AS FVP+++ + ++TF  W  +  
Sbjct: 774  VKLSKLPGNNTISTIATMVDEAKLTKPKIQNIADKIASYFVPTIIGITVVTFCVWIAVGI 833

Query: 547  VLSNPPSIFDSPNGKFFICLEMTISVIVVACPCALGLAAPTAIMVGTGLGAKHGVLIKGG 606
             +        S +      +   I+V++V+CPC +GLA P   ++ +G+ AK GV+ K  
Sbjct: 834  RVEK-----QSRSDAVIQAIIYAITVLIVSCPCVIGLAVPIVFVIASGVAAKRGVIFKSA 888

Query: 607  DILEKCSSLETFLFDKTGTLTTGHMTVEQFVPMGVRDNLTTEELLCINASEAVSEHPVGK 666
            + +E   +    +FDKTGTLT G +TV      G R N    + L +  +E + +HPV  
Sbjct: 889  ESIEVAHNTSHVVFDKTGTLTEGKLTVVHETVRGDRHN---SQSLLLGLTEGI-KHPVSM 944

Query: 667  AIVEFTDSLIEDCDRTAVVTKSKTILGGGLICDCELDGKAY---HVVIGN-----RNVMQ 718
            AI  +   L E       V+ +K + G        ++G +Y    +  GN      N   
Sbjct: 945  AIASY---LKEKGVSAQNVSNTKAVTGK------RVEGTSYSGLKLQGGNCRWLGHNNDP 995

Query: 719  DMSLSADASSTLAYVKINGELVGRFEISDFIKKDAAEVVQYLTEKGHRVCMVTGDNHKSA 778
            D+  + +   ++    +NG +   + + D ++ DA   +  L ++G  + +++GD+  + 
Sbjct: 996  DVRKALEQGYSVFCFSVNGSVTAVYALEDSLRADAVSTINLLRQRGISLHILSGDDDGAV 1055

Query: 779  MKVALELGIEANNVYSELTPADKNQLVQDLQDG---------GRKNVAFIGDGINDSPAL 829
              +A  LGIE++N+ S  TPA+K++ ++D+ +G          R  V F GDG ND+  L
Sbjct: 1056 RSMAARLGIESSNIRSHATPAEKSEYIKDIVEGRNCDSSSQSKRPVVVFCGDGTNDAIGL 1115

Query: 830  VTSDLGVSISTGTDIAMEAADVIILNRSENNHVSLRELIYALDIAQKTFRRVKINFFWAI 889
              + +GV I+ G+++A  AADV++L    NN      ++  + ++QK   RVK+NF W+ 
Sbjct: 1116 TQATIGVHINEGSEVAKLAADVVMLKPKLNN------ILTMITVSQKAMFRVKLNFLWSF 1169

Query: 890  CYNLFMLPIAMGVLVPWEI 908
             YNLF + +A G  V + I
Sbjct: 1170 TYNLFAILLAAGAFVDFHI 1188

>YGL008C (PMA1) [1965] chr7 complement(479913..482669)
           H+-transporting P-type ATPase of the plasma membrane
           required for nutrient uptake and pH homeostasis,
           activity is rate limiting for growth at low pH [2757 bp,
           918 aa]
          Length = 918

 Score =  115 bits (288), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 140/570 (24%), Positives = 243/570 (42%), Gaps = 111/570 (19%)

Query: 409 STCTIIENGKAREIPVEFLQVGDTVEIKPGAKIPTDGVIIEGES--EVDESLITGESLMV 466
           +T  +I +G+  EIP   +  GD ++++ G  IPTDG I+  +   ++D+S ITGESL V
Sbjct: 178 NTAVVIRDGQLVEIPANEVVPGDILQLEDGTVIPTDGRIVTEDCFLQIDQSAITGESLAV 237

Query: 467 PRYKGFPVIAGSINGPNRFLLTATSVGDDTKLAQIIQTMKQAQLSKAPIQHYADYLAS-K 525
            ++ G    + S        +  T+ GD+T + +    + +A   +    H+ + L    
Sbjct: 238 DKHYGDQTFSSSTVKRGEGFMVVTATGDNTFVGRAAALVNKAAGGQG---HFTEVLNGIG 294

Query: 526 FVPSVLVLAMITFVTWTILSRVLSNPPSIFDSPNGKFFICLEMTISVIVVACPCALGLAA 585
            +  VLV+A +  V WT          + F   NG   I L  T+ + ++  P  L    
Sbjct: 295 IILLVLVIATLLLV-WT----------ACFYRTNGIVRI-LRYTLGITIIGVPVGLPAVV 342

Query: 586 PTAIMVGTGLGAKHGVLIKGGDILEKCSSLETFLFDKTGTLTTGHMTVEQFVPMGVRDNL 645
            T + VG    AK   +++    +E  + +E    DKTGTLT   +++ +  P  V + +
Sbjct: 343 TTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHE--PYTV-EGV 399

Query: 646 TTEELL---CINAS--------------EAVSEHPVGK------AIVEFTDSLIEDCDRT 682
           + ++L+   C+ AS              +++ ++P  K       ++EF          T
Sbjct: 400 SPDDLMLTACLAASRKKKGLDAIDKAFLKSLKQYPKAKDALTKYKVLEFHPFDPVSKKVT 459

Query: 683 AVVTKSKTILGGGLICDCELDGKAYHVVIGNRNVMQDMSLSADASST------------- 729
           AVV   +   G  ++C   + G    V+   + V +D  +  D                 
Sbjct: 460 AVVESPE---GERIVC---VKGAPLFVL---KTVEEDHPIPEDVHENYENKVAELASRGF 510

Query: 730 --LAYVKINGELVGRFEI------SDFIKKDAAEVVQYLTEKGHRVCMVTGDNHKSAMKV 781
             L   +  GE  G +EI       D  + D A+ V      G RV M+TGD    A + 
Sbjct: 511 RALGVARKRGE--GHWEILGVMPCMDPPRDDTAQTVSEARHLGLRVKMLTGDAVGIAKET 568

Query: 782 ALELGIEAN---------------------------NVYSELTPADKNQLVQDLQDGGRK 814
             +LG+  N                           + ++E+ P  K ++V+ LQ+ G  
Sbjct: 569 CRQLGLGTNIYNAERLGLGGGGDMPGSELADFVENADGFAEVFPQHKYRVVEILQNRGYL 628

Query: 815 NVAFIGDGINDSPALVTSDLGVSISTGTDIAMEAADVIILNRSENNHVSLRELIYALDIA 874
            VA  GDG+ND+P+L  +D G+++   TD A  AAD++ L         L  +I AL  +
Sbjct: 629 -VAMTGDGVNDAPSLKKADTGIAVEGATDAARSAADIVFLAP------GLSAIIDALKTS 681

Query: 875 QKTFRRVKINFFWAICYNLFMLPIAMGVLV 904
           ++ F R+     + I  +L  L I +G+ +
Sbjct: 682 RQIFHRMYSYVVYRIALSLH-LEIFLGLWI 710

>YPL036W (PMA2) [5403] chr16 (482839..485682) H[+]-transporting
           P-type ATPase of the plasma membrane, expression not
           detected under normal growth conditions [2844 bp, 947
           aa]
          Length = 947

 Score =  110 bits (276), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 144/607 (23%), Positives = 251/607 (41%), Gaps = 119/607 (19%)

Query: 370 VIFDASVMLIGFISVGKLLENKAKSKTNNSLSKLMSLAPSTCTIIENGKAREIPVEFLQV 429
           ++ +ASV  I     G +++   K+  N            T T+I +G+  EIP   +  
Sbjct: 180 LLLNASVGFIQEFQAGSIVDELKKTLAN------------TATVIRDGQLIEIPANEVVP 227

Query: 430 GDTVEIKPGAKIPTDGVIIEGES--EVDESLITGESLMVPRYKGFPVIAGSINGPNRFLL 487
           G+ ++++ G   P DG I+  +   ++D+S ITGESL   ++ G  V + S        +
Sbjct: 228 GEILQLESGTIAPADGRIVTEDCFLQIDQSAITGESLAAEKHYGDEVFSSSTVKTGEAFM 287

Query: 488 TATSVGDDTKLAQIIQTMKQAQLSKAPIQHYADYLAS-KFVPSVLVLAMITFVTWTILSR 546
             T+ GD+T + +    + QA   +    H+ + L     +  VLV+A +  V WT    
Sbjct: 288 VVTATGDNTFVGRAAALVGQASGVEG---HFTEVLNGIGIILLVLVIATLLLV-WT---- 339

Query: 547 VLSNPPSIFDSPNGKFFICLEMTISVIVVACPCALGLAAPTAIMVGTGLGAKHGVLIKGG 606
                 + F    G   I L  T+ + ++  P  L     T + VG    AK   +++  
Sbjct: 340 ------ACFYRTVGIVSI-LRYTLGITIIGVPVGLPAVVTTTMAVGAAYLAKKQAIVQKL 392

Query: 607 DILEKCSSLETFLFDKTGTLTTGHMTVEQFVPMGVRDNLTTEELLCINASEAVSEHPVGK 666
             +E  + +E    DKTGTLT   +++ +  P  V + ++ ++L+ + A  A S    G 
Sbjct: 393 SAIESLAGVEILCSDKTGTLTKNKLSLHE--PYTV-EGVSPDDLM-LTACLAASRKKKGL 448

Query: 667 AIVE--FTDSLIEDCDRTAVVTKSKTI-------------------LGGGLICDCELDGK 705
             ++  F  SLIE       +TK K +                    G  ++C   + G 
Sbjct: 449 DAIDKAFLKSLIEYPKAKDALTKYKVLEFHPFDPVSKKVTAVVESPEGERIVC---VKGA 505

Query: 706 AYHVVIGNRNVMQDMSLSADASST---------------LAYVKINGELVGRFEI----- 745
              V+   + V +D  +  D                   L   +  GE  G +EI     
Sbjct: 506 PLFVL---KTVEEDHPIPEDVHENYENKVAELASRGFRALGVARKRGE--GHWEILGVMP 560

Query: 746 -SDFIKKDAAEVVQYLTEKGHRVCMVTGDNHKSAMKVALELGIEAN-------------- 790
             D  + D A+ +      G R+ M+TGD    A +   +LG+  N              
Sbjct: 561 CMDPPRDDTAQTINEARNLGLRIKMLTGDAVGIAKETCRQLGLGTNIYNAERLGLGGGGD 620

Query: 791 -------------NVYSELTPADKNQLVQDLQDGGRKNVAFIGDGINDSPALVTSDLGVS 837
                        + ++E+ P  K ++V+ LQ+ G   VA  GDG+ND+P+L  +D G++
Sbjct: 621 MPGSELADFVENADGFAEVFPQHKYRVVEILQNRGYL-VAMTGDGVNDAPSLKKADTGIA 679

Query: 838 ISTGTDIAMEAADVIILNRSENNHVSLRELIYALDIAQKTFRRVKINFFWAICYNLFMLP 897
           +   TD A  AAD++ L         L  +I AL  +++ F R+     + I  +L  L 
Sbjct: 680 VEGATDAARSAADIVFLAP------GLSAIIDALKTSRQIFHRMYSYVVYRIALSLH-LE 732

Query: 898 IAMGVLV 904
           I +G+ +
Sbjct: 733 IFLGLWI 739

>Scas_688.1
          Length = 913

 Score =  109 bits (272), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 136/602 (22%), Positives = 253/602 (42%), Gaps = 109/602 (18%)

Query: 370 VIFDASVMLIGFISVGKLLENKAKSKTNNSLSKLMSLAPSTCTIIENGKAREIPVEFLQV 429
           ++ +A V  +     G ++E   K+  N+++            +I +G+  E+P   +  
Sbjct: 146 LLLNAGVGFVQEFQAGSIVEELKKTLANSAI------------VIRDGQLVEVPANEVVP 193

Query: 430 GDTVEIKPGAKIPTDGVIIEGES--EVDESLITGESLMVPRYKGFPVIAGSINGPNRFLL 487
           GD ++++ G  IP DG I+  +   ++D+S ITGESL   ++ G    + S        +
Sbjct: 194 GDILQLEDGVIIPADGRIVTEDCFVQIDQSAITGESLAADKHYGDQTFSSSTVKRGEAFM 253

Query: 488 TATSVGDDTKLAQIIQTMKQAQLSKAPIQHYADYLASKFVPSVLVLAMITFVTWTILSRV 547
             T+ GD+T + +    + +A   +    H+ + L    +  ++++ +   + WT     
Sbjct: 254 VITATGDNTFVGRAAALVNKASGGQG---HFTEVLNGIGIILLVLVIVTLLLVWT----- 305

Query: 548 LSNPPSIFDSPNGKFFICLEMTISVIVVACPCALGLAAPTAIMVGTGLGAKHGVLIKGGD 607
                + F   +G   I L  T+ + +V  P  L     T + VG    AK   +++   
Sbjct: 306 -----ASFYRTDGIVRI-LRYTLGITIVGVPVGLPAVVTTTMAVGAAYLAKKQAIVQKLS 359

Query: 608 ILEKCSSLETFLFDKTGTLTTGHMTVEQFVPMGVRDNLTTEELL---CINAS-------- 656
            +E  + +E    DKTGTLT   +++ +  P  V + ++ ++L+   C+ AS        
Sbjct: 360 AIESLAGVEILCSDKTGTLTKNKLSLHE--PYTV-EGVSADDLMLTACLAASRKKKGLDA 416

Query: 657 ------EAVSEHPVGK------AIVEFTDSLIEDCDRTAVVTKSKTILGGGLICDCELDG 704
                 ++++++P  K       ++EF          TAVV   +   G  +IC      
Sbjct: 417 IDKAFLKSLAQYPAAKNALTKYKVLEFHPFDPVSKKVTAVVESPE---GERIICVKGAPL 473

Query: 705 KAYHVVIGNRNVMQDM---------SLSADASSTLAYVKINGELVGRFEI------SDFI 749
                V  +  + +D+          L++     L   +  GE  G +EI       D  
Sbjct: 474 FVLKTVEEDHPIPEDIHENYENKVAELASRGFRALGVARKRGE--GHWEILGVMPCMDPP 531

Query: 750 KKDAAEVVQYLTEKGHRVCMVTGDNHKSAMKVALELGIEAN------------------- 790
           + D  E V      G RV M+TGD    A +   +LG+  N                   
Sbjct: 532 RDDTGETVAEARRLGLRVKMLTGDAVGIAKETCRQLGLGTNVYNAERLGLSGGGDMPGSE 591

Query: 791 --------NVYSELTPADKNQLVQDLQDGGRKNVAFIGDGINDSPALVTSDLGVSISTGT 842
                   + ++E+ P DK ++V+ LQ  G   VA  GDG+ND+P+L  +D G+++   T
Sbjct: 592 LADFVENADGFAEVFPQDKYRVVEILQTRGYL-VAMTGDGVNDAPSLKKADTGIAVEGAT 650

Query: 843 DIAMEAADVIILNRSENNHVSLRELIYALDIAQKTFRRVKINFFWAICYNLFMLPIAMGV 902
           D A  AAD++ L         L  +I AL  +++ F R+     + I  ++  L I +G+
Sbjct: 651 DAARSAADIVFLAP------GLSAIIDALKTSRQIFHRMYSYVVYRIALSIH-LEIFLGL 703

Query: 903 LV 904
            +
Sbjct: 704 WI 705

>Scas_710.41
          Length = 904

 Score =  105 bits (262), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 135/591 (22%), Positives = 244/591 (41%), Gaps = 104/591 (17%)

Query: 370 VIFDASVMLIGFISVGKLLENKAKSKTNNSLSKLMSLAPSTCTIIENGKAREIPVEFLQV 429
           ++ +ASV  I     G ++E   K+  N            T  +I +G  +EIP   +  
Sbjct: 138 LMLNASVGFIQEFQAGSIVEELKKTLAN------------TARVIRDGTLQEIPANEIVP 185

Query: 430 GDTVEIKPGAKIPTDGVIIEGES--EVDESLITGESLMVPRYKGFPVIAGSINGPNRFLL 487
           GD +E+  G  IP DG ++      +VD+S ITGESL V +  G    + S       ++
Sbjct: 186 GDILELDEGTIIPADGRLVTENRFLQVDQSAITGESLAVDKNYGDVTFSSSTVKTGTSVM 245

Query: 488 TATSVGDDTKLAQIIQTMKQAQLSKAPIQHYADYLASKFVPSVLVLAMITFVTWTILSRV 547
             T+ GD+T + +    + +A   +    H+ D L       ++++ +   + WT     
Sbjct: 246 VVTATGDNTFVGRAAALVGEASGGQG---HFTDILNDIGTILLVLVIITLLLVWT----- 297

Query: 548 LSNPPSIFDSPNGKFFICLEMTISVIVVACPCALGLAAPTAIMVGTGLGAKHGVLIKGGD 607
                + F   +G   I L  T+ + ++  P  L     T + VG    AK   +++   
Sbjct: 298 -----ACFYRTDGIVMI-LRFTLGITIIGVPVGLPAVVTTTMAVGAAYLAKKQAIVQKLS 351

Query: 608 ILEKCSSLETFLFDKTGTLTTGHMTVEQFVPMGVRDNLTTEELL---CINAS-------- 656
            +E  + +E    DKTGTLT   +++ +  P  V + ++ ++L+   C+ A+        
Sbjct: 352 AIESLAGVEILCSDKTGTLTKNKLSLHE--PYTV-EGVSADDLMLTACLAATRKKKGLDA 408

Query: 657 ------EAVSEHPVG------KAIVEFTDSLIEDCDRTAVVTKSKTILGGGLICDCELDG 704
                 ++++++P          I+EF          TAVV   K+  G  + C      
Sbjct: 409 IDRAFLKSLNQYPKAMNALPKYKILEFHPFDPVSKKVTAVV---KSPEGETITCVKGAPL 465

Query: 705 KAYHVVIGNRNVMQDM---------SLSADASSTLAYVKING----ELVGRFEISDFIKK 751
                V  +  V +D+          L++    +L   +  G    E++G     D  + 
Sbjct: 466 FVLKTVEEDHPVPEDVHENYENKVAELASRGFRSLGVARKRGEGYWEILGVMPCMDPPRD 525

Query: 752 DAAEVVQYLTEKGHRVCMVTGDNHKSAMKVALELGIEAN--------------------- 790
           D A  +      G RV M+TGD    A + + +LG+  N                     
Sbjct: 526 DTARTIAEARTLGLRVKMLTGDAVGIAKETSRQLGLGVNIYNAEKLGLGGGGDMPGSELA 585

Query: 791 ------NVYSELTPADKNQLVQDLQDGGRKNVAFIGDGINDSPALVTSDLGVSISTGTDI 844
                 + ++E+ P  K ++V+ LQ+ G   VA  GDG+ND+P+L  +D G+++   TD 
Sbjct: 586 DFVENADGFAEVFPQHKYKVVEILQNRGYL-VAMTGDGVNDAPSLKKADTGIAVEGATDA 644

Query: 845 AMEAADVIILNRSENNHVSLRELIYALDIAQKTFRRVKINFFWAICYNLFM 895
           A  AAD++ L         L  +I  L  +++ F R+     + I  +L +
Sbjct: 645 ARSAADIVFLAP------GLSAIIDGLKTSRQIFHRMYSYVVYRIALSLHL 689

>AGL085C [4226] [Homologous to ScYGL008C (PMA1) - SH; ScYPL036W
           (PMA2) - NSH] (546285..549014) [2730 bp, 909 aa]
          Length = 909

 Score =  101 bits (251), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 139/600 (23%), Positives = 243/600 (40%), Gaps = 105/600 (17%)

Query: 370 VIFDASVMLIGFISVGKLLENKAKSKTNNSLSKLMSLAPSTCTIIENGKAREIPVEFLQV 429
           ++ +A+V  I     G ++E   K+  N+++            +I +G   EIP   +  
Sbjct: 132 LLLNAAVGFIQEFQAGSIVEELKKTLANSAV------------VIRDGSLVEIPANEVVP 179

Query: 430 GDTVEIKPGAKIPTDGVII-EG-ESEVDESLITGESLMVPRYKGFPVIAGSINGPNRFLL 487
           GD ++++ G  IP DG I+ EG   ++D+S ITGESL V +  G    + S        +
Sbjct: 180 GDILQLEDGVIIPADGRIVTEGCFVQIDQSAITGESLAVDKRYGDATFSSSTVKRGEGFM 239

Query: 488 TATSVGDDTKLAQIIQTMKQAQLSKAPIQHYADYLASKFVPSVLVLAMITFVTWTILSRV 547
             T+ GD T + +    + +A           + + +  +  V++  ++ +V        
Sbjct: 240 IVTATGDSTFVGRAAALVNKASAGSGHFTEVLNGIGTILLILVILTLLVVYVA------- 292

Query: 548 LSNPPSIFDSPNGKFFICLEMTISVIVVACPCALGLAAPTAIMVGTGLGAKHGVLIKGGD 607
                  + S +      L  T+++ VV  P  L     T + VG    AK   +++   
Sbjct: 293 -----CFYRSID--IVTILRYTLAITVVGVPVGLPAVVTTTMAVGAAYLAKKKAIVQKLS 345

Query: 608 ILEKCSSLETFLFDKTGTLTTGHMTVEQFVPMGVRDNLTTEELLCINASEAVSEHPVGKA 667
            +E  + +E    DKTGTLT   +++ +  P  V + +  ++L+ + A  A S    G  
Sbjct: 346 AIESLAGVEILCSDKTGTLTKNKLSLHE--PYTV-EGVEADDLM-LTACLAASRKKKGLD 401

Query: 668 IVE--FTDSLIEDCDRTAVVTKSKTI-------------------LGGGLICDCELDGKA 706
            ++  F  SLI      A +TK K +                    G  ++C        
Sbjct: 402 AIDKAFLKSLINYPRAKAALTKYKVLEFHPFDPVSKKVTAIVESPEGERIVCVKGAPLFV 461

Query: 707 YHVVIGNRNVMQDMS---------LSADASSTLAYVKINGELVGRFEI------SDFIKK 751
              V  N  + +D+          L++     L   +  GE  G +EI       D  + 
Sbjct: 462 LKTVEENHLIPEDVKENYENKVAELASRGYRALGVARKRGE--GHWEILGVMPCMDPPRD 519

Query: 752 DAAEVVQYLTEKGHRVCMVTGDNHKSAMKVALELGIEAN--------------------- 790
           D A+ V      G RV M+TGD    A +   +LG+  N                     
Sbjct: 520 DTAQTVNEARHLGLRVKMLTGDAVGIAKETCRQLGLGTNIYNAERLGLGGGGDMPGSELA 579

Query: 791 ------NVYSELTPADKNQLVQDLQDGGRKNVAFIGDGINDSPALVTSDLGVSISTGTDI 844
                 + ++E+ P  K  +V+ LQ  G   VA  GDG+ND+P+L  +D G+++   TD 
Sbjct: 580 DFVENADGFAEVFPQHKYNVVEILQQRGYL-VAMTGDGVNDAPSLKKADTGIAVEGATDA 638

Query: 845 AMEAADVIILNRSENNHVSLRELIYALDIAQKTFRRVKINFFWAICYNLFMLPIAMGVLV 904
           A  AAD++ L         L  +I AL  +++ F R+     + I  +L  L I +G+ +
Sbjct: 639 ARSAADIVFLAP------GLSAIIDALKTSRQIFHRMYSYVVYRIALSLH-LEIFLGLWI 691

>Kwal_14.1498
          Length = 939

 Score =  100 bits (248), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 140/592 (23%), Positives = 239/592 (40%), Gaps = 154/592 (26%)

Query: 395 KTNNSLSKLMSLAPSTCTIIENGKAREIPVEFLQVGDTVEIKPGAKIPTDGVIIEG-ESE 453
           ++  SL  L  L P  C +I  G+  ++    L  GD V  + G +IP D  IIE  +  
Sbjct: 132 RSEKSLEALNRLVPDQCHLIRCGQESKLLASVLVPGDVVRFRVGDRIPADLRIIEAVDLS 191

Query: 454 VDESLITGESLMVPRYKGFPVIA--------GSI-----------------NGPNRFLLT 488
           ++ES +TGE+   P +K    +         GSI                  G  R ++ 
Sbjct: 192 IEESNLTGEN--EPVHKSTATVNKEFYKENLGSIVPVSERSCIAFMGTLVREGHGRGIVI 249

Query: 489 ATSVGDDTKLAQIIQTMKQAQLSKAPIQHYADYLASKFVPSVLVLAMITFVTWTILSRVL 548
            T+   +T   ++ + M   +  K P+Q   D L          L+ ++F+   I+    
Sbjct: 250 GTA--KNTAFGKVFEMMNAIEKPKTPLQTAMDKLGKD-------LSFMSFIVIGIIC--- 297

Query: 549 SNPPSIFDSPNGKFFI-CLEMTISVIVVACPCALGLAAPTAIMVGTGLGAKHGVLIKGGD 607
                +     G+ ++   ++++S+ V A P  L +     + +G    AK   +I+   
Sbjct: 298 -----LIGVIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRRAIIRRLP 352

Query: 608 ILEKCSSLETFLFDKTGTLTTGHMTVEQFVPMGVRDNLT-----------------TEEL 650
            +E   S+     DKTGTLT  HM+V +   +G   N +                 TE+L
Sbjct: 353 SVETLGSVNVICSDKTGTLTANHMSVNKVWCLGSMSNKSNILKLDKATSGSFKKNLTEDL 412

Query: 651 --------LCINASEAVSEH------PVGKAIVEF---------------TDSLIEDCDR 681
                   LC N++ +  EH      P   A++E                +D +  +  R
Sbjct: 413 RATLRTGNLCNNSTYS-HEHAKYLGNPTDIALLEVLHKFGLEDERPQVTRSDEISFNSKR 471

Query: 682 TAVVTKSKTILGGGLI----CDCELDGKAYH-------VVIGNRNVMQDMSLSADASS-- 728
             +  K K   G  ++       ++  K+ H       VV  + N+ Q ++ SADA +  
Sbjct: 472 KFMAVKVKEANGKFVVHVKGAYEKILEKSTHFINAENKVVKLDSNLRQAITDSADALASD 531

Query: 729 ---TLAYVK---------------ING-ELVGRFEISDFIKKDAAEVVQYLTEKGHRVCM 769
              TLA+ +               ING    G   ++D  +      V+ L+E    + M
Sbjct: 532 GLRTLAFAQLELSNGNSKKLTEDDINGLTFAGLLGMNDPPRPSVKAAVERLSEGSVHIIM 591

Query: 770 VTGDNHKSAMKVALELGI---------------------------EANNVYSELTPADKN 802
           +TGD   +A+ +A ++GI                           +  N+++  TP  K 
Sbjct: 592 ITGDAENTAVSIARQIGIPVVNPETAVLTGDKLDHMSEDQLASIIDHVNIFARATPEHKL 651

Query: 803 QLVQDLQDGGRKNVAFIGDGINDSPALVTSDLGVSI-STGTDIAMEAADVII 853
            +V+ LQ  G   VA  GDG+ND+PAL  +D+GVS+   GTD+A EA+D+++
Sbjct: 652 NIVRALQKRG-DIVAMTGDGVNDAPALKLADIGVSMGKMGTDVAKEASDMVL 702

>Kwal_47.17522
          Length = 899

 Score = 99.8 bits (247), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 138/607 (22%), Positives = 241/607 (39%), Gaps = 119/607 (19%)

Query: 370 VIFDASVMLIGFISVGKLLENKAKSKTNNSLSKLMSLAPSTCTIIENGKAREIPVEFLQV 429
           +  +A V  I     G +++   KS  N+++            ++ +G   EIP   +  
Sbjct: 132 LFLNAGVGFIQEYQAGSIVDELKKSLANSAV------------VVRDGNLVEIPANEVVP 179

Query: 430 GDTVEIKPGAKIPTDGVIIEGES--EVDESLITGESLMVPRYKGFPVIAGSINGPNRFLL 487
           GD ++++ G  I  DG ++  E   ++D+S ITGESL V ++ G    + S        +
Sbjct: 180 GDIMQLEDGVVICADGRLVTEECFLQIDQSAITGESLAVDKHYGDTTFSSSTVKRGEGFM 239

Query: 488 TATSVGDDTKLAQIIQTMKQAQLSKAPIQHYADYLASKFVPSVLVLAMITFVTWTILSRV 547
             T+ GD+T + +    + QA   +    H+ + L       ++++ +   + WT     
Sbjct: 240 IVTATGDNTFVGRAAALVNQAAGDQG---HFTEVLNGIGTILLVLVIVTLLLVWT----- 291

Query: 548 LSNPPSIFDSPNGKFFICLEMTISVIVVACPCALGLAAPTAIMVGTGLGAKHGVLIKGGD 607
                + F   + +    L  T+ + ++  P  L     T + VG    AK   +++   
Sbjct: 292 -----ACFYRTD-RIVRILRYTLGITIIGVPVGLPAVVTTTMAVGAAYLAKKQAIVQKLS 345

Query: 608 ILEKCSSLETFLFDKTGTLTTGHMTV-EQFVPMGVRDNLTTEELLCINASEAVSEHPVGK 666
            +E  + +E    DKTGTLT   +++ E +   GV       + L + A  A S    G 
Sbjct: 346 AIESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVE-----PDDLMLTACLAASRKKKGL 400

Query: 667 AIVE--FTDSLIEDCDRTAVVTKSKTI-------------------LGGGLICDCELDGK 705
             ++  F  SLI+       +TK K +                    G  +IC   + G 
Sbjct: 401 DAIDKAFLKSLIQYPRAKNALTKYKVLDFHPFDPVSKKVTAVVESPEGERIIC---VKGA 457

Query: 706 AYHVVIGNRNVMQDMSLSADASST---------------LAYVKINGELVGRFEI----- 745
              V+   + V +D  +  D                   L   +  GE  G +EI     
Sbjct: 458 PLFVL---KTVEEDHPIPEDVHENYENKVAELASRGFRALGVARKRGE--GHWEILGVMP 512

Query: 746 -SDFIKKDAAEVVQYLTEKGHRVCMVTGDNHKSAMKVALELGIEAN-------------- 790
             D  + D A+ V      G RV M+TGD    A +   +LG+  N              
Sbjct: 513 CMDPPRDDTAQTVHEARRLGLRVKMLTGDAVGIAKETCRQLGLGTNIYNAERLGLGGGGD 572

Query: 791 -------------NVYSELTPADKNQLVQDLQDGGRKNVAFIGDGINDSPALVTSDLGVS 837
                        + ++E+ P  K  +V+ LQ  G   VA  GDG+ND+P+L  +D G++
Sbjct: 573 MPGSELADFVENADGFAEVFPQHKYSVVEILQQRGYL-VAMTGDGVNDAPSLKKADTGIA 631

Query: 838 ISTGTDIAMEAADVIILNRSENNHVSLRELIYALDIAQKTFRRVKINFFWAICYNLFMLP 897
           +   TD A  AAD++ L         L  +I AL  +++ F R+     + I  +L  L 
Sbjct: 632 VEGATDAARSAADIVFLAP------GLSAIIDALKTSRQIFHRMYSYVVYRIALSLH-LE 684

Query: 898 IAMGVLV 904
           I +G+ +
Sbjct: 685 IFLGLWI 691

>KLLA0A09031g 787768..790467 gi|1346734|sp|P49380|PMA1_KLULA
           Kluyveromyces lactis Plasma membrane ATPase (Proton
           pump), start by similarity
          Length = 899

 Score = 98.2 bits (243), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 137/587 (23%), Positives = 241/587 (41%), Gaps = 97/587 (16%)

Query: 383 SVGKLLENKAKSKTNNSLSKLMSLAPSTCTIIENGKAREIPVEFLQVGDTVEIKPGAKIP 442
           +VG + E +A S  +  L K ++   ++  +I +G   E+P   +  GD ++++ G  IP
Sbjct: 137 AVGFIQEYQAGSIVDE-LKKTLA---NSAVVIRDGNLVEVPSNEVVPGDILQLEDGVVIP 192

Query: 443 TDGVIIEGES--EVDESLITGESLMVPRYKGFPVIAGSINGPNRFLLTATSVGDDTKLAQ 500
            DG ++  +   ++D+S ITGESL V +  G    + S        +  T+ GD T + +
Sbjct: 193 ADGRLVTEDCFIQIDQSAITGESLAVDKRFGDSTFSSSTVKRGEAFMIVTATGDSTFVGR 252

Query: 501 IIQTMKQAQLSKAPIQHYADYLASKFVPSVLVLAMITFVTWTILSRVLSNPPSIFDSPNG 560
               + +A        H+ + L       ++++ +   + W + S   +N          
Sbjct: 253 AAALVNKAAAGSG---HFTEVLNGIGTILLILVIVTLLLVW-VASFYRTN---------- 298

Query: 561 KFFICLEMTISVIVVACPCALGLAAPTAIMVGTGLGAKHGVLIKGGDILEKCSSLETFLF 620
           K    L  T+++ +V  P  L     T + VG    AK   +++    +E  + +E    
Sbjct: 299 KIVRILRYTLAITIVGVPVGLPAVVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCS 358

Query: 621 DKTGTLTTGHMTVEQFVPMGVRDNLTTEELLCINASEAVSEHPVGKAIVE--FTDSLIED 678
           DKTGTLT   +++ +  P  V + +  ++L+ + A  A S    G   ++  F  SLI  
Sbjct: 359 DKTGTLTKNKLSLHE--PYTV-EGVDPDDLM-LTACLAASRKKKGLDAIDKAFLKSLISY 414

Query: 679 CDRTAVVTKSKTI-------------------LGGGLICDCELDGKAYHVVIGNRNVMQD 719
               A +TK K +                    G  +IC           V     + +D
Sbjct: 415 PRAKAALTKYKLLEFHPFDPVSKKVTAIVESPEGERIICVKGAPLFVLKTVEEEHPIPED 474

Query: 720 M---------SLSADASSTLAYVKINGELVGRFEI------SDFIKKDAAEVVQYLTEKG 764
           +          L++     L   +  GE  G +EI       D  + D A+ V      G
Sbjct: 475 VRENYENKVAELASRGFRALGVARKRGE--GHWEILGVMPCMDPPRDDTAQTVNEARHLG 532

Query: 765 HRVCMVTGDNHKSAMKVALELGIEAN---------------------------NVYSELT 797
            RV M+TGD    A +   +LG+  N                           + ++E+ 
Sbjct: 533 LRVKMLTGDAVGIAKETCRQLGLGTNIYNAERLGLGGGGDMPGSELADFVENADGFAEVF 592

Query: 798 PADKNQLVQDLQDGGRKNVAFIGDGINDSPALVTSDLGVSISTGTDIAMEAADVIILNRS 857
           P  K  +V+ LQ  G   VA  GDG+ND+P+L  +D G+++   TD A  AAD++ L   
Sbjct: 593 PQHKYNVVEILQQRGYL-VAMTGDGVNDAPSLKKADTGIAVEGATDAARSAADIVFLAP- 650

Query: 858 ENNHVSLRELIYALDIAQKTFRRVKINFFWAICYNLFMLPIAMGVLV 904
                 L  +I AL  +++ F R+     + I  +L  L I +G+ +
Sbjct: 651 -----GLSAIIDALKTSRQIFHRMYSYVVYRIALSLH-LEIFLGLWI 691

>CAGL0I04312g complement(382354..385209) highly similar to sp|P13586
           Saccharomyces cerevisiae YGL167c PMR1 Ca2+-transporting
           P-type ATPase, start by similarity
          Length = 951

 Score = 95.5 bits (236), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 146/591 (24%), Positives = 236/591 (39%), Gaps = 153/591 (25%)

Query: 395 KTNNSLSKLMSLAPSTCTIIENGKAREIPVEFLQVGDTVEIKPGAKIPTDGVIIE-GESE 453
           ++  SL  L  L P  C +I  G+   +    L  GD V  + G +IP D  IIE  +  
Sbjct: 145 RSEKSLEALNKLVPQECHLIRGGRESNVLATNLVPGDLVRFRIGDRIPADIRIIECNDLT 204

Query: 454 VDESLITGESLMVPRYKGFPVIA-GSING-PNRFLLTA---------------------T 490
           +DES +TGE+   P +K +  ++  S N  PN  +  A                      
Sbjct: 205 IDESNLTGET--DPVHKSYKALSRDSYNDQPNSIVPVAERTNIAYMGTLVKEGNGRGIVV 262

Query: 491 SVGDDTKLAQIIQTMKQAQLSKAPIQHYADYLASKFVPSVLVLAMITFVTWTILSRVLSN 550
             G +T    + + M   +  K P+Q   D L          L++ +FV   I+  V   
Sbjct: 263 GTGRETSFGNVFEMMSSIEKPKTPLQLTMDKLGKD-------LSLASFVVIGIICVVGII 315

Query: 551 PPSIFDSPNGKFFI-CLEMTISVIVVACPCALGLAAPTAIMVGTGLGAKHGVLIKGGDIL 609
                    G+ ++   ++++S+ V A P  L +     + +G    AK   +++    +
Sbjct: 316 --------QGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSV 367

Query: 610 EKCSSLETFLFDKTGTLTTGHMTVEQFVPMG----------------------VRDNLTT 647
           E   S+     DKTGTLT+ HMTV +   +G                      + D++ T
Sbjct: 368 ETLGSVNVICSDKTGTLTSNHMTVSKIWCLGSMANKLNVLSLDKNKGGNLKNYLTDDVKT 427

Query: 648 EEL---LCINASEAVSEH------PVGKAIVEFTDSLIEDCDRTAVVTK-------SKTI 691
             L   LC NAS +  EH      P   A++E      E  D  +  TK       SK  
Sbjct: 428 TLLCGNLCNNASYS-QEHAKYLGNPTDVALLEQLQKF-ELADVRSEYTKVKELSFNSKRK 485

Query: 692 LGGGLICDCE--------------LD---------GKAYHVVIGNRNVMQD--MSLSADA 726
           +    I D E              LD         GK   +  G+R  + D   +L+++ 
Sbjct: 486 MMATKIQDNEKKTTLFIKGAFERILDKSSSYLTEKGKIEKLTAGHRETIIDCANTLASEG 545

Query: 727 SSTLAYVK-----INGELVGRFEISDFI-----------KKDAAEVVQYLTEKGHRVCMV 770
              LA+ K      + +LV   +ISD +           +      +    + G  + M+
Sbjct: 546 LRVLAFAKRAMTDSSSKLVED-DISDLVFTGLIGMNDPPRSSVKFAIDQFLQGGIHIIMI 604

Query: 771 TGDNHKSAMKVALELGIE----------------------AN-----NVYSELTPADKNQ 803
           TGD+  +A+ +A ++GI                       AN     N+++  TP  K  
Sbjct: 605 TGDSENTAVNIARQIGIPVIDPKLSVLSGDKLNEMTDDQLANVIDHVNIFARATPEHKLN 664

Query: 804 LVQDLQDGGRKNVAFIGDGINDSPALVTSDLGVSIS-TGTDIAMEAADVII 853
           +V+ L+  G   VA  GDG+ND+PAL  +D+GVS+   GTD+A EA+D+I+
Sbjct: 665 IVRALRRRG-DVVAMTGDGVNDAPALKLADIGVSMGRMGTDVAKEASDMIL 714

>CAGL0A00495g complement(55014..57722) highly similar to sp|P05030
           Saccharomyces cerevisiae YGL008c PMA1 or sp|P19657
           Saccharomyces cerevisiae YPL036w PMA2, hypothetical
           start
          Length = 902

 Score = 90.1 bits (222), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 134/583 (22%), Positives = 235/583 (40%), Gaps = 108/583 (18%)

Query: 384 VGKLLENKAKSKTNNSLSKLMSLAPSTCTIIENGKAREIPVEFLQVGDTVEIKPGAKIPT 443
           VG + E +A S  +     L ++A     +I +G+  E+P   +  GD ++++ G  IP 
Sbjct: 141 VGFIQEFQAGSIVDELKKTLANVA----VVIRDGQLVEVPANEVVPGDILQLEDGTIIPA 196

Query: 444 DGVIIEGES--EVDESLITGESLMVPRYKGFPVIAGSINGPNRFLLTATSVGDDTKLAQI 501
           DG ++      +VD+S ITGESL V +  G    + S        +  T+ GD+T + + 
Sbjct: 197 DGRLVTENCFLQVDQSAITGESLAVDKGYGDQTFSSSTVKRGEAFMVVTATGDNTFVGRA 256

Query: 502 IQTMKQAQLSKAPIQHYADYLASKFVPSVLVLAMITFVTWTILSRVLSNPPSIFDSPNGK 561
              + +A   +    H+ + L    +  ++++ +     W        N   I       
Sbjct: 257 AALVNKASGGQG---HFTEVLNGIGILLLVLVIVTLLGVWAACFYRTDNIVKI------- 306

Query: 562 FFICLEMTISVIVVACPCALGLAAPTAIMVGTGLGAKHGVLIKGGDILEKCSSLETFLFD 621
               L  T+ + ++  P  L     T + VG    AK   +++    +E  + +E    D
Sbjct: 307 ----LRFTLGITIIGVPVGLPAVVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSD 362

Query: 622 KTGTLTTGHMTVEQFVPMGVRDNLTTEELLCINASEAVSEHPVGKAIVE--FTDSLIEDC 679
           KTGTLT   +++ +  P  V + ++ ++L+ + A  A S    G   ++  F  SLI   
Sbjct: 363 KTGTLTKNKLSLHE--PYTV-EGVSADDLM-LTACLAASRKKKGLDAIDKAFLKSLINYP 418

Query: 680 DRTAVVTKSKTI-------------------LGGGLICDCELDGKAYHVVIGNRNVMQDM 720
                +TK K I                    G  ++C   + G    V+   + V +D 
Sbjct: 419 KAKDALTKYKVIEFHPFDPVSKKVTAVVESPEGERIVC---VKGAPLFVL---KTVEEDH 472

Query: 721 SLSADASST---------------LAYVKINGELVGRFEI------SDFIKKDAAEVVQY 759
            +  D                   L   +  GE  G +EI       D  + D AE V  
Sbjct: 473 PIPEDVHENYENKVAELASRGFRALGVARKRGE--GHWEILGVMPCMDPPRDDTAETVNE 530

Query: 760 LTEKGHRVCMVTGDNHKSAMKVALELGIEAN---------------------------NV 792
               G RV M+TGD    A +   +LG+  N                           + 
Sbjct: 531 ARRLGLRVKMLTGDAVGIAKETCRQLGLGTNIYNAERLGLGGGGDMPGSELADFVENADG 590

Query: 793 YSELTPADKNQLVQDLQDGGRKNVAFIGDGINDSPALVTSDLGVSISTGTDIAMEAADVI 852
           ++E+ P  K ++V+ LQ+ G   VA  GDG+ND+P+L  +D G+++   +D A  AAD++
Sbjct: 591 FAEVFPQHKYKVVEILQNRGYL-VAMTGDGVNDAPSLKKADTGIAVEGASDAARSAADIV 649

Query: 853 ILNRSENNHVSLRELIYALDIAQKTFRRVKINFFWAICYNLFM 895
            L         L  +I AL  +++ F R+     + I  +L +
Sbjct: 650 FLAP------GLSAIIDALKTSRQIFHRMYSYVVYRIALSLHL 686

>Kwal_23.3160
          Length = 1100

 Score = 70.1 bits (170), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 81/287 (28%), Positives = 126/287 (43%), Gaps = 34/287 (11%)

Query: 382 ISVGKLLENKAKSKTNNSLSKLMSLAPSTCTIIENGKAREIPVEFLQVGDTVEIKPGAKI 441
           +++G   E KA SKT NSL    SL+  +  +I +G    IP + L  GD   +K G  +
Sbjct: 111 VAIGSYQEYKA-SKTMNSLK---SLSTPSAHVIRDGNDETIPSKQLVPGDLCVVKAGDTV 166

Query: 442 PTDGVIIEGES-EVDESLITGESLMV--------PRYKGFPV-------IAGSINGPNRF 485
           P D  +IE  + E DE+L+TGESL +        P  +  PV        A S     R 
Sbjct: 167 PADLRLIECVNFETDEALLTGESLPIAKEASQVYPATEDTPVGDRLNLAFASSTVSKGRA 226

Query: 486 LLTATSVGDDTKLAQIIQTMKQAQLSKAPIQHYADYLASKFVPSVLVLAMITFVTWTILS 545
                  G +T++ +I Q++K      +  ++   +  +    +  + + +   T T L 
Sbjct: 227 TGIVVKTGLNTEIGKIAQSLKGDNSLISKDENKTFWANAGITLAATIGSFLGTTTGTPLH 286

Query: 546 RVLSNPP----------SIFDSPNGKFFICLEMTISVIVVAC---PCALGLAAPTAIMVG 592
           R LS             +I      KF +  E+ I  I VA    P +L +     + VG
Sbjct: 287 RKLSKLAVLLFFIAVVFAIVVMATQKFVVNKEVAIYAICVAVSMIPSSLVVVLTITMSVG 346

Query: 593 TGLGAKHGVLIKGGDILEKCSSLETFLFDKTGTLTTGHMTVEQ-FVP 638
             + A   V+++  D LE   ++     DKTGTLT G M V+Q +VP
Sbjct: 347 AKIMATRNVVVRKLDSLEALGAVNDVCSDKTGTLTQGKMIVKQAWVP 393

 Score = 53.5 bits (127), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 46/182 (25%), Positives = 82/182 (45%), Gaps = 38/182 (20%)

Query: 718 QDMSLSADASSTLAYVKINGELVGRFEISDFIKKDAAEVVQYLTEKGHRVCMVTGDNHKS 777
           Q + +S D      +V+ +    G   I D  +++ A  V+   + G  V M+TGD   +
Sbjct: 626 QALKVSEDLRKNRDFVESDLIFQGLVGIYDPPRQETAGAVKQFHKAGINVHMLTGDFPGT 685

Query: 778 AMKVALELGIEANNVYSE---------LTPADKNQLVQDLQDG----------------- 811
           A  +A E+GI   N+Y           +T A  +QL  +  D                  
Sbjct: 686 AKAIAQEVGILPRNLYHYPKEVVDSMVMTAAQFDQLTDEEIDNLLLLPLVIARCAPQTKV 745

Query: 812 --------GRKNVAFIGDGINDSPALVTSDLGVSIS-TGTDIAMEAADVIILNRSENNHV 862
                     K  A  GDG+NDSP+L  +++G+++   G+D+A +A+D+++   S++N  
Sbjct: 746 RMIDALHRREKFCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKDASDIVL---SDDNFA 802

Query: 863 SL 864
           S+
Sbjct: 803 SI 804

>KLLA0A03157g complement(281313..284129) gi|3288523|emb|CAA04476.1
           Kluyveromyces lactis Ca++ ATPase, start by similarity
          Length = 938

 Score = 68.6 bits (166), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 77/295 (26%), Positives = 122/295 (41%), Gaps = 47/295 (15%)

Query: 395 KTNNSLSKLMSLAPSTCTIIENGKAREIPVEFLQVGDTVEIKPGAKIPTDGVIIEG-ESE 453
           K+  SL  L  L P+ C +  +G+   +    L  GD V  K G +IP D  I+E  +  
Sbjct: 132 KSEKSLEALNKLVPAECHLTRSGQLSHVLASNLVPGDLVRFKVGDRIPADLRIVESIDLC 191

Query: 454 VDESLITGESLMVPRYKG------FPVIAGSI-----------------NGPNRFLLTAT 490
           VDES +TGE+  V +  G      +  I GSI                  G  + ++ AT
Sbjct: 192 VDESNLTGENEPVHKSSGAVDPKNYSHIPGSIIPVGDRNCIGFMGTLVREGHGKGIVIAT 251

Query: 491 SVGDDTKLAQIIQTMKQAQLSKAPIQHYADYLASKFVPSVLVLAMITFVTWTILSRVLSN 550
             G  T    + + M      K P+Q   D L          L+ ++FV   I+  +   
Sbjct: 252 --GKHTVFGSVFEMMSGIDKPKTPLQTAMDKLGQD-------LSYMSFVLIGIICLIGII 302

Query: 551 PPSIFDSPNGKFFI-CLEMTISVIVVACPCALGLAAPTAIMVGTGLGAKHGVLIKGGDIL 609
                    G+ ++   ++ +S+ V A P  L +     + +G    AK   +++    +
Sbjct: 303 --------QGRSWLEMFQIAVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSV 354

Query: 610 EKCSSLETFLFDKTGTLTTGHMTVEQFVPMGVRDNLTTEELLCINASEAVSEHPV 664
           E   S+     DKTGTLT  HMTV +   +G  +N T     C+  S+ V E P+
Sbjct: 355 ETLGSVNVICSDKTGTLTANHMTVSKIWCLGSMENKTN----CLALSK-VKERPI 404

 Score = 64.7 bits (156), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 52/198 (26%), Positives = 95/198 (47%), Gaps = 48/198 (24%)

Query: 703 DGKAYHVVIGNRNVMQD--MSLSADASSTLAYVKI-----------NGELV------GRF 743
           DGK + +   ++ ++ D  ++L+++   TLA+ ++           N ++V      G  
Sbjct: 505 DGKVHKLKPNDKAIINDAAVALASEGLRTLAFAELEVSATHGDKEFNEDMVEGLTFTGLI 564

Query: 744 EISDFIKKDAAEVVQYLTEKGHRVCMVTGDNHKSAMKVALELGI---------------- 787
            ++D  +      ++ L +    V M+TGD   +A+ +A ++GI                
Sbjct: 565 AMNDPPRPTVRSAIEELLQGSVHVIMITGDAENTAVSIARQIGIPVINPEYSVLSGDKLD 624

Query: 788 -----------EANNVYSELTPADKNQLVQDLQDGGRKNVAFIGDGINDSPALVTSDLGV 836
                      +  NV++  TP  K  +V+ LQ  G   VA  GDG+ND+PAL  +D+GV
Sbjct: 625 QMTDDQLASVIDHVNVFARATPEHKLNIVRALQKRGDI-VAMTGDGVNDAPALKLADIGV 683

Query: 837 SI-STGTDIAMEAADVII 853
           S+   GTD+A EA+D+++
Sbjct: 684 SMGKMGTDVAKEASDMVL 701

>Kwal_47.17547
          Length = 1240

 Score = 67.8 bits (164), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 69/257 (26%), Positives = 108/257 (42%), Gaps = 39/257 (15%)

Query: 413 IIENGKAREIPVEFLQVGDTVEIKPGAKIPTDGVIIEGESEVDESLITGESLMVP----- 467
           ++ NG    I +  + VGD + ++ G  +P D ++++G  E DES +TGES  +      
Sbjct: 190 VLRNGDEHLISIHDILVGDILSLQTGDVVPADCILVKGSCECDESALTGESATIKKAAID 249

Query: 468 ----RYKGFPVIAGSIN--------GPNRFLLTA------------TSVGDDTKLAQIIQ 503
               +YK       +I+         P+  L++             TSVG ++   + + 
Sbjct: 250 VCYEKYKQLSATDAAIDIGTPGAEKVPDPMLISGSKLLSGLGRAVVTSVGVNSMHGRTLM 309

Query: 504 TMKQAQLSKAPIQHYADYLASKFVPSVLVLAMITFVTWTILSRVLSNPPS---IFD---- 556
            +K  +    P+Q   D LA+    SV   A    + + +  R L+N      + D    
Sbjct: 310 ALK-VEAETTPLQERLDSLANSI--SVYGSAAALLLFFILFMRFLANLKKGGELHDLTPA 366

Query: 557 SPNGKFFICLEMTISVIVVACPCALGLAAPTAIMVGTGLGAKHGVLIKGGDILEKCSSLE 616
               +F     + I+VIVVA P  L LA   A+   T   AK G L++     E   S  
Sbjct: 367 QKGSRFMNIFIVGITVIVVAVPEGLPLAVTLALAFATTRMAKDGNLVRVLRACETMGSAT 426

Query: 617 TFLFDKTGTLTTGHMTV 633
               DKTGTLT   MTV
Sbjct: 427 AVCSDKTGTLTENRMTV 443

 Score = 54.3 bits (129), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 45/141 (31%), Positives = 68/141 (48%), Gaps = 32/141 (22%)

Query: 745 ISDFIKKDAAEVVQYLTEKGHRVCMVTGDNHKSAMKVALELGI----EANNVYSEL---- 796
           I D ++K   + V+   + G  V MVTGDN  +A  +A +  I    +A N  S +    
Sbjct: 723 IQDPLRKGVRKSVEQCQKAGVTVRMVTGDNILTATAIAKKCSILSEEQAENPESSMEGPR 782

Query: 797 ----------------------TPADKNQLVQDLQDGGRKNVAFIGDGINDSPALVTSDL 834
                                 +P DK  LV+ L+  G   VA  GDG ND+PAL  +D+
Sbjct: 783 FRKLSNKERVRILPNLRVLARSSPEDKRILVETLKKMG-DVVAVTGDGTNDAPALKLADV 841

Query: 835 GVSIS-TGTDIAMEAADVIIL 854
           G S+   GT++A EA+D+I++
Sbjct: 842 GFSMGIAGTEVAREASDIILM 862

>AEL301W [2204] [Homologous to ScYGL167C (PMR1) - SH]
           complement(75104..77977) [2874 bp, 957 aa]
          Length = 957

 Score = 66.2 bits (160), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 68/274 (24%), Positives = 107/274 (39%), Gaps = 40/274 (14%)

Query: 395 KTNNSLSKLMSLAPSTCTIIENGKAREIPVEFLQVGDTVEIKPGAKIPTDGVIIEG-ESE 453
           ++  SL  L  L P++C +I  G    +    L  GD V  K G +IP D  IIE  +  
Sbjct: 143 RSEKSLEALHKLVPASCHLIRFGAETHVLASCLVPGDLVYFKVGDRIPADVRIIESTDLS 202

Query: 454 VDESLITGESLMVPR---------YKGFP------------VIAGSI--NGPNRFLLTAT 490
           +DES +TGE+  V +         Y   P               G++   G  + ++ AT
Sbjct: 203 LDESTLTGETEPVHKSCTPVNSATYSDVPGGIIPIGERTSIAYMGTLVREGHGKGIVVAT 262

Query: 491 SVGDDTKLAQIIQTMKQAQLSKAPIQHYADYLASKFVPSVLVLAMITFVTWTILSRVLSN 550
             G  T    + + M   +  K P+Q   D L         VL+ I F+   I  R    
Sbjct: 263 --GKHTMFGAVFEMMNSIEKPKTPLQMAMDTLRRDLSYVRFVLSGIIFLLGVIQGR---- 316

Query: 551 PPSIFDSPNGKFFICLEMTISVIVVACPCALGLAAPTAIMVGTGLGAKHGVLIKGGDILE 610
                      +    ++++S+ V A P  L +     + +G    A    +++    +E
Sbjct: 317 ----------SWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMANRKAIVRRLPSVE 366

Query: 611 KCSSLETFLFDKTGTLTTGHMTVEQFVPMGVRDN 644
              S+     DKTGTLT  HMT  +   +G   N
Sbjct: 367 TLGSVNVICSDKTGTLTANHMTASKIWCLGSMAN 400

 Score = 66.2 bits (160), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 54/214 (25%), Positives = 99/214 (46%), Gaps = 53/214 (24%)

Query: 684 VVTKSKTILGGGLICDCELDGKAYHVVIGNRNVMQD--MSLSADASSTLAYVKI------ 735
           ++ +S + +GG         GK   +   +++++ D   SL+++   TLA+ ++      
Sbjct: 516 ILERSASFIGGA--------GKVEKLSDSHKSLINDCAKSLASEGLRTLAFAQLECSTNK 567

Query: 736 --------NGELVGRFEISDFIKKDAAEVVQYLTEKGHRVCMVTGDNHKSAMKVALELGI 787
                   N   VG   + D  +      ++ L + G  V M+TGD   +A+ +A ++GI
Sbjct: 568 PMNDSTIQNLTFVGLIGMKDPPRSTVRPAIEELLQGGVHVIMITGDAENTAVNIARQIGI 627

Query: 788 ---------------------------EANNVYSELTPADKNQLVQDLQDGGRKNVAFIG 820
                                      +  N+++  TP  K  +V+ LQ  G   VA  G
Sbjct: 628 PVINPEISVLTGDRLDQMTDDQLAGVIDHVNIFARATPEHKLNIVRALQKRG-DIVAMTG 686

Query: 821 DGINDSPALVTSDLGVSI-STGTDIAMEAADVII 853
           DG+ND+PAL  +D+GV++   GTD+A EA+D+++
Sbjct: 687 DGVNDAPALKLADIGVAMGHMGTDVAKEASDMVL 720

>Scas_707.48*
          Length = 741

 Score = 65.9 bits (159), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 57/233 (24%), Positives = 108/233 (46%), Gaps = 52/233 (22%)

Query: 704 GKAYHVVIGNRNVMQDM--SLSADASSTLAYVKIN-------------GELV--GRFEIS 746
           GK   +  G R+V+ +   SL+++    LA+ K               G+L+  G   ++
Sbjct: 513 GKTEKLTQGQRDVIIETANSLASEGLRMLAFAKTTLPDSPTLLTEESVGDLIFTGLIGMN 572

Query: 747 DFIKKDAAEVVQYLTEKGHRVCMVTGDNHKSAMKVALELGIE------------------ 788
           D  +      ++ L + G  + M+TGD+  +A+ +A ++GI                   
Sbjct: 573 DPPRPTVKPAIEQLLQGGVHIIMITGDSENTAVNIARQIGIPVLDPKLSVLSGDKLNEMS 632

Query: 789 ----AN-----NVYSELTPADKNQLVQDLQDGGRKNVAFIGDGINDSPALVTSDLGVSIS 839
               AN     N+++  TP  K  +V+ L+  G   VA  GDG+ND+PAL  +D+GVS+ 
Sbjct: 633 DDQLANVIDHVNIFARATPEHKLNIVRALRKRGDV-VAMTGDGVNDAPALKLADIGVSMG 691

Query: 840 -TGTDIAMEAADVIILNRSENNHVSLRELIYALDIAQKTFRRVKINFFWAICY 891
             GTD+A EA+D+++ +           ++ A++  +  F  ++    + +C+
Sbjct: 692 RMGTDVAKEASDMVLTDD------DFSTILTAIEEGKGIFNNIQNFLTFQLCW 738

 Score = 63.2 bits (152), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 67/272 (24%), Positives = 108/272 (39%), Gaps = 52/272 (19%)

Query: 395 KTNNSLSKLMSLAPSTCTIIENGKAREIPVEFLQVGDTVEIKPGAKIPTDGVIIEG-ESE 453
           ++  SL  L  L P+ C +I  G+   +    L  GD V  K G +IP D  IIE  +  
Sbjct: 137 RSEKSLEALNKLVPAECHLIRCGQESHVLASGLVPGDLVHFKIGDRIPADLRIIEAVDLS 196

Query: 454 VDESLITGESLMVPR---------------------------YKGFPVIAGSINGPNRFL 486
           +DES +TGE+  V +                           Y G  V  G   G     
Sbjct: 197 IDESNLTGENEPVHKSAKEVNKDSFNDQPNSIIPISDRTCVAYMGTLVKEGHGKG----- 251

Query: 487 LTATSVGDDTKLAQIIQTMKQAQLSKAPIQHYADYLASKF-VPSVLVLAMITFVTWTILS 545
                +G +T    I + +   +  K P+Q+  D L     + S +V+ +I  V   IL 
Sbjct: 252 -IVVGIGKNTSFGAIFEMLSNIEKPKTPLQNAMDKLGKDLSLFSFIVIGLICLVG--IL- 307

Query: 546 RVLSNPPSIFDSPNGKFFI-CLEMTISVIVVACPCALGLAAPTAIMVGTGLGAKHGVLIK 604
                         G+ ++   ++++S+ V A P  L +     + +G    AK   +++
Sbjct: 308 -------------QGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVR 354

Query: 605 GGDILEKCSSLETFLFDKTGTLTTGHMTVEQF 636
               +E   S+     DKTGTLT+ HMT  + 
Sbjct: 355 RLPSVETLGSVNVICSDKTGTLTSNHMTASKI 386

>YGL006W (PMC1) [1966] chr7 (485923..489444) Vacuolar
           Ca2+-transporting P-type ATPase, member of the cation
           transporting (E1-E2) P-type ATPase superfamily,
           functions to pump Ca2+ into the vacuole [3522 bp, 1173
           aa]
          Length = 1173

 Score = 64.7 bits (156), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 73/272 (26%), Positives = 111/272 (40%), Gaps = 51/272 (18%)

Query: 413 IIENGKAREIPVEFLQVGDTVEIKPGAKIPTDGVIIEGESEVDESLITGESLMVPR---- 468
           +I N +   I +  + VGD + ++ G  +P D V+I G+ E DES ITGES  + +    
Sbjct: 196 VIRNDQEILISIHHVLVGDVISLQTGDVVPADCVMISGKCEADESSITGESNTIQKFPVD 255

Query: 469 -----YKGF----------PVIAGSIN-------------------GPNRFLLTATSVGD 494
                +K F          P+  G +N                   G  R ++  TSVG 
Sbjct: 256 NSLRDFKKFNSIDSHNHSKPLDIGDVNEDGNKIADCMLISGSRILSGLGRGVI--TSVGI 313

Query: 495 DTKLAQIIQTMKQAQLSKAPIQHYADYLASKF----VPSVLVLAMITFVTWTILSRVLSN 550
           ++   Q + ++  A+    P+Q +   LA         S ++L ++ F  +  L  ++  
Sbjct: 314 NSVYGQTMTSL-NAEPESTPLQLHLSQLADNISVYGCVSAIILFLVLFTRY--LFYIIPE 370

Query: 551 PPSIFD----SPNGKFFICLEMTISVIVVACPCALGLAAPTAIMVGTGLGAKHGVLIKGG 606
                D        KF      +I+VIVVA P  L LA   A+   T    K G L++  
Sbjct: 371 DGRFHDLDPAQKGSKFMNIFITSITVIVVAVPEGLPLAVTLALAFATTRMTKDGNLVRVL 430

Query: 607 DILEKCSSLETFLFDKTGTLTTGHMTVEQFVP 638
              E   S      DKTGTLT   MTV +  P
Sbjct: 431 RSCETMGSATAVCSDKTGTLTENVMTVVRGFP 462

 Score = 57.4 bits (137), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 47/147 (31%), Positives = 68/147 (46%), Gaps = 32/147 (21%)

Query: 739 LVGRFEISDFIKKDAAEVVQYLTEKGHRVCMVTGDNHKSAMKVALELGIEANNVYSEL-- 796
           L G   I D ++    E VQ     G  V MVTGDN  +A  +A    I + ++ SE   
Sbjct: 730 LDGLLGIQDPLRAGVRESVQQCQRAGVTVRMVTGDNILTAKAIARNCAILSTDISSEAYS 789

Query: 797 ----------------------------TPADKNQLVQDLQDGGRKNVAFIGDGINDSPA 828
                                       +P DK  LV+ L+  G   VA  GDG ND+PA
Sbjct: 790 AMEGTEFRKLTKNERIRILPNLRVLARSSPEDKRLLVETLKGMGDV-VAVTGDGTNDAPA 848

Query: 829 LVTSDLGVSIS-TGTDIAMEAADVIIL 854
           L  +D+G S+  +GT++A EA+D+I++
Sbjct: 849 LKLADVGFSMGISGTEVAREASDIILM 875

>KLLA0A08910g complement(779526..783368) similar to sp|P38929
           Saccharomyces cerevisiae YGL006w PMC1 Ca2+-transporting
           P-type ATPase, start by similarity
          Length = 1280

 Score = 64.7 bits (156), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 77/259 (29%), Positives = 110/259 (42%), Gaps = 42/259 (16%)

Query: 413 IIENGKAREIPVEFLQVGDTVEIKPGAKIPTDGVIIEGESEVDESLITGESLMVPR---- 468
           +I NG    I +  L VGD + ++ G  +P D V+I G  E DES +TGES  + +    
Sbjct: 243 VIRNGDEHLISIHDLLVGDVISLQTGDVVPADAVLISGSCECDESALTGESDTIKKVALK 302

Query: 469 -----YKGF----PVIAGSING-----PNRFLLTA------------TSVGDDTKLAQII 502
                YK      P I    +G     P+  L++             TSVG+++   +I+
Sbjct: 303 PALEKYKQIFEKDPTIDIGSHGVGEKVPDPLLISGSKLLSGIGNAVITSVGENSVNGRIM 362

Query: 503 QTMKQAQLSKAPIQ----HYADYLASKFVPSVLVLAMITFVTWTILSRVLSNPPSIFDSP 558
             +K    S  P+Q    + AD ++     + LVL +I F+ +      L N     D P
Sbjct: 363 MALKTESES-TPLQERLSNLADNISIYGCMAALVLFIILFIRFLTY---LPNGKKYHDLP 418

Query: 559 ----NGKFFICLEMTISVIVVACPCALGLAAPTAIMVGTGLGAKHGVLIKGGDILEKCSS 614
                 KF       ++VIVVA P  L LA   A+   T    K G L++     E   S
Sbjct: 419 PAQKGSKFMNIFITAVTVIVVAVPEGLPLAVTLALAFATTRMTKDGNLVRVLRACETMGS 478

Query: 615 LETFLFDKTGTLTTGHMTV 633
                 DKTGTLT   MTV
Sbjct: 479 ATAICSDKTGTLTENRMTV 497

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 67/141 (47%), Gaps = 32/141 (22%)

Query: 745 ISDFIKKDAAEVVQYLTEKGHRVCMVTGDNHKSAMKVALELGIEANNVYSE--------- 795
           + D +++   E V+     G  V MVTGDN  +A  ++    I +   Y++         
Sbjct: 760 LQDPLREGVKESVEQCQRAGVTVRMVTGDNILTARAISRNCNILSEEGYNDPECAMEGPT 819

Query: 796 ---------------------LTPADKNQLVQDLQDGGRKNVAFIGDGINDSPALVTSDL 834
                                 +P DK  LV+ L+  G + VA  GDG ND+PAL  +D+
Sbjct: 820 FRKLPYKKMLRVIPKLRVLARSSPEDKRILVETLKKMG-EVVAVTGDGTNDAPALKLADV 878

Query: 835 GVSIS-TGTDIAMEAADVIIL 854
           G S+  +GT++A EA+D+I++
Sbjct: 879 GFSMGISGTEVAREASDIILM 899

>YGL167C (PMR1) [1823] chr7 complement(187620..190472)
           Ca2+-transporting P-type ATPase of Golgi membrane
           involved in Ca2+ and Mn2+ import into Golgi [2853 bp,
           950 aa]
          Length = 950

 Score = 64.3 bits (155), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 75/297 (25%), Positives = 121/297 (40%), Gaps = 48/297 (16%)

Query: 367 MPNVIFDASVMLIGFI--SVGKLLENKAKSKTNNSLSKLMSLAPSTCTIIENGKAREIPV 424
           M N+    S+ L  FI  +VG + E +++     SL  L  L P+ C ++  G+   +  
Sbjct: 111 MGNIDDAVSITLAIFIVVTVGFVQEYRSEK----SLEALNKLVPAECHLMRCGQESHVLA 166

Query: 425 EFLQVGDTVEIKPGAKIPTDGVIIEG-ESEVDESLITGESLMVPRYKGFPVIAGSI--NG 481
             L  GD V  + G +IP D  IIE  +  +DES +TGE+   P +K    I  S   + 
Sbjct: 167 STLVPGDLVHFRIGDRIPADIRIIEAIDLSIDESNLTGEN--EPVHKTSQTIEKSSFNDQ 224

Query: 482 PNRFLLTA---------------------TSVGDDTKLAQIIQTMKQAQLSKAPIQHYAD 520
           PN  +  +                        G +T    + + M   +  K P+Q   D
Sbjct: 225 PNSIVPISERSCIAYMGTLVKEGHGKGIVVGTGTNTSFGAVFEMMNNIEKPKTPLQLTMD 284

Query: 521 YLASKF-VPSVLVLAMITFVTWTILSRVLSNPPSIFDSPNGKFFICLEMTISVIVVACPC 579
            L     + S +V+ MI  V   I  R               +    ++++S+ V A P 
Sbjct: 285 KLGKDLSLVSFIVIGMICLV-GIIQGR--------------SWLEMFQISVSLAVAAIPE 329

Query: 580 ALGLAAPTAIMVGTGLGAKHGVLIKGGDILEKCSSLETFLFDKTGTLTTGHMTVEQF 636
            L +     + +G    AK   +++    +E   S+     DKTGTLT+ HMTV + 
Sbjct: 330 GLPIIVTVTLALGVLRMAKRKAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKL 386

 Score = 63.5 bits (153), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 43/143 (30%), Positives = 73/143 (51%), Gaps = 29/143 (20%)

Query: 739 LVGRFEISDFIKKDAAEVVQYLTEKGHRVCMVTGDNHKSAMKVALELGIE---------- 788
             G   ++D  + +    ++ L + G  + M+TGD+  +A+ +A ++GI           
Sbjct: 572 FTGLIGMNDPPRPNVKFAIEQLLQGGVHIIMITGDSENTAVNIAKQIGIPVIDPKLSVLS 631

Query: 789 ------------AN-----NVYSELTPADKNQLVQDLQDGGRKNVAFIGDGINDSPALVT 831
                       AN     N+++  TP  K  +V+ L+  G   VA  GDG+ND+PAL  
Sbjct: 632 GDKLDEMSDDQLANVIDHVNIFARATPEHKLNIVRALRKRGDV-VAMTGDGVNDAPALKL 690

Query: 832 SDLGVSIST-GTDIAMEAADVII 853
           SD+GVS+   GTD+A EA+D+++
Sbjct: 691 SDIGVSMGRIGTDVAKEASDMVL 713

>CAGL0J01870g 181666..184506 highly similar to sp|P13586
           Saccharomyces cerevisiae YGL167c PMR1, hypothetical
           start
          Length = 946

 Score = 63.2 bits (152), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 43/158 (27%), Positives = 81/158 (51%), Gaps = 30/158 (18%)

Query: 725 DASSTLAYVKING-ELVGRFEISDFIKKDAAEVVQYLTEKGHRVCMVTGDNHKSAMKVAL 783
           D+ + ++   ING    G F ++D  + +    ++ L   G  + M+TGD+  +A+ +A 
Sbjct: 553 DSDNVISEDDINGLTFTGLFGLADPPRPNVKASIEKLHRGGVHIIMITGDSVNTAVSIAE 612

Query: 784 ELG---------------------------IEANNVYSELTPADKNQLVQDLQDGGRKNV 816
           ++G                           I+  N+++  TP +K  +V+ L+  G   V
Sbjct: 613 KIGLSVQDRESSVMTGDKVSELTEDELSKVIDKVNIFARATPENKLNIVKALRKRG-DIV 671

Query: 817 AFIGDGINDSPALVTSDLGVSIS-TGTDIAMEAADVII 853
           A  GDG+ND+PAL  +D+G+++  +GTD+A E +D+I+
Sbjct: 672 AMTGDGVNDAPALKLADIGIAMGISGTDVAKEVSDMIL 709

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 67/282 (23%), Positives = 113/282 (40%), Gaps = 46/282 (16%)

Query: 376 VMLIGFISVGKLLENKAKSKTNNSLSKLMSLAPSTCTIIENGKAREIPVEFLQVGDTVEI 435
           V+ +GFI          + ++  SL  L  L P+ C +I  G+        L  GD V  
Sbjct: 137 VVTVGFIQ---------EYRSEKSLEALNKLVPTKCHLIRYGRESNTLASELVPGDLVRF 187

Query: 436 KPGAKIPTDGVIIEG-ESEVDESLITGESLMVPR-----------YKGFPVIAGSI---- 479
           K G +IP D  IIE  +  +DES +TGE+  + +            +  PV   S     
Sbjct: 188 KIGDRIPADVRIIEAVDLSIDESNLTGETEPLHKDAQTIDPEEYDNRNVPVSERSCIAYM 247

Query: 480 -----NGPNRFLLTATSVGDDTKLAQIIQTMKQAQLSKAPIQHYADYLASKFVPSVLVLA 534
                 G  + ++  T  G +T    I + +   +  K P+Q   D L ++   S +   
Sbjct: 248 GTLVKEGHGKGIVIGT--GTNTSYGAIFEMVNSIEKPKTPLQETMDRLGTEL--SYISFF 303

Query: 535 MITFVTWTILSRVLSNPPSIFDSPNGKFFICLEMTISVIVVACPCALGLAAPTAIMVGTG 594
           +I  ++   + R                 +  ++++S+ V A P  L +     + +G  
Sbjct: 304 IIAIISIVGIIR------------GNSLLMMFQVSVSLAVAAIPEGLPIIVTVTLALGVL 351

Query: 595 LGAKHGVLIKGGDILEKCSSLETFLFDKTGTLTTGHMTVEQF 636
              K   +++    +E   S+     DKTGTLTT HMTV + 
Sbjct: 352 RMTKQNAIVRRLPSVETLGSVNVICTDKTGTLTTNHMTVSKL 393

>CAGL0K12034g complement(1161299..1164562) highly similar to
           sp|P13587 Saccharomyces cerevisiae YDR040c ENA1 or
           sp|Q01896 Saccharomyces cerevisiae YDR039c ENA2 or
           sp|Q12691 Saccharomyces cerevisiae YDR038c ENA5,
           hypothetical start
          Length = 1087

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 76/298 (25%), Positives = 124/298 (41%), Gaps = 47/298 (15%)

Query: 377 MLIGFISVGKLLENKAKSKTNNSLSKLMSLAPSTCTIIENGKAREIPVEFLQVGDTVEIK 436
            +IG   +  L++    SKT N+L  L S       +I NG +  +    +  GD V +K
Sbjct: 95  FVIGINVIIGLIQEYKASKTMNALRALSS---PNAHVIRNGNSEVVDSTDVVPGDLVVVK 151

Query: 437 PGAKIPTDGVIIEGES-EVDESLITGESLMVPR-------------------YKGFPVIA 476
            G  IP D  ++  ++ E DE+L+TGESL V +                   +    V+ 
Sbjct: 152 VGDTIPADLRLVSQQNFETDEALLTGESLPVSKDANEIFDDETPVGDRINLAFSSSTVVK 211

Query: 477 GSINGPNRFLLTATSVGDDTKLAQIIQTMKQAQ--LSKAPIQHYADYLASKFVPSVLVLA 534
           G   G       A   G +T++ +I ++++     +S+ P + +  Y  +       V A
Sbjct: 212 GRAQG------IAIKTGLNTEIGKIAKSLRGGNELISRDPAKTW--YQNAWISTKRTVGA 263

Query: 535 MITFVTWTILSRVLSNPP----------SIFDSPNGKFFICLEMTISVIVVAC---PCAL 581
            +     T L R LS             +I    + KF +   + I  + VA    P +L
Sbjct: 264 FLGTTQGTPLHRKLSKLAVLLFWIAVVFAIVVMASQKFDVDRGVAIYAVCVALSMIPSSL 323

Query: 582 GLAAPTAIMVGTGLGAKHGVLIKGGDILEKCSSLETFLFDKTGTLTTGHMTVEQ-FVP 638
            +     + VG  + A   V+I+  D LE   ++     DKTGTLT G M  +Q +VP
Sbjct: 324 VVVLTITMSVGAAVMASRNVIIRKLDSLEALGAVNDICSDKTGTLTQGKMIAKQIWVP 381

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 41/169 (24%), Positives = 77/169 (45%), Gaps = 40/169 (23%)

Query: 732 YVKINGELVGRFEISDFIKKDAAEVVQYLTEKGHRVCMVTGDNHKSAMKVALELGIEANN 791
           Y +     +G   I D  +++ A  V+   + G  V M+TGD   +A  +A E+GI   N
Sbjct: 629 YAETGLTFLGLIGIYDPPREETAGAVKKFHQAGINVRMLTGDFPGTAKAIAQEVGILPTN 688

Query: 792 VY-----------------------------------SELTPADKNQLVQDLQDGGRKNV 816
           +Y                                   +  +P  K ++++ L     K  
Sbjct: 689 LYHYSKEVVDIMVMTGKQFDNLSEDEIDNLPVLPLVIARCSPQTKVRMIEALHRR-EKFC 747

Query: 817 AFIGDGINDSPALVTSDLGVSIS-TGTDIAMEAADVIILNRSENNHVSL 864
           A  GDG+NDSP+L  +++G+++   G+D+A +A+D+++   S++N  S+
Sbjct: 748 AMTGDGVNDSPSLKMANVGIAMGINGSDVAKDASDIVL---SDDNFASI 793

>CAGL0A00517g 58830..62198 similar to sp|P38929 Saccharomyces
           cerevisiae YGL006w PMC1, hypothetical start
          Length = 1122

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 69/261 (26%), Positives = 105/261 (40%), Gaps = 41/261 (15%)

Query: 413 IIENGKAREIPVEFLQVGDTVEIKPGAKIPTDGVIIEGESEVDESLITGESLMVPR---- 468
           ++ +     I +  L VGD ++++ G  +P D V++ GE E DES +TGES  + +    
Sbjct: 161 VVRDAAESLISIHNLLVGDLLKLQTGDVVPADCVLVRGECETDESALTGESNTIKKLPLA 220

Query: 469 --------YKGFPVIAGSING----------PNRFLLTA------------TSVGDDTKL 498
                   + G  +   S +G          P+  L++             T+VG ++  
Sbjct: 221 DALEYHSAHGGRDIGDTSASGASGAADDSRCPDCMLISGSRVLSGLASAIVTNVGVNSVH 280

Query: 499 AQIIQTMKQAQLSKAPIQHYADYLASKFVPSVLVLAMITFVTW--TILSRVLSNPPSIFD 556
            + + ++K+      P+Q     L         V A+  FV      LS +L +     D
Sbjct: 281 GKTMASLKEDS-EDTPLQMRLSQLTDNISVYGCVAAITLFVVLFARYLSYILPSGGKYHD 339

Query: 557 SP----NGKFFICLEMTISVIVVACPCALGLAAPTAIMVGTGLGAKHGVLIKGGDILEKC 612
            P      KF       I+VIVVA P  L LA   A+   T    K G L++     E  
Sbjct: 340 LPPAEKGSKFMDIFITAITVIVVAVPEGLPLAVTLALAFATTRMTKDGNLVRVLRSCETM 399

Query: 613 SSLETFLFDKTGTLTTGHMTV 633
            S      DKTGTLT   MTV
Sbjct: 400 GSATAVCSDKTGTLTENIMTV 420

 Score = 56.6 bits (135), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 69/141 (48%), Gaps = 32/141 (22%)

Query: 745 ISDFIKKDAAEVVQYLTEKGHRVCMVTGDNHKSAMKVALELGIEANN------------- 791
           I D ++++    V    + G  V MVTGDN  +A  +A   GI ++              
Sbjct: 691 IQDPLRENVKNSVAQCQKAGVTVRMVTGDNLLTAKAIARNCGILSSKSLNDSACAMEGPA 750

Query: 792 -----------------VYSELTPADKNQLVQDLQDGGRKNVAFIGDGINDSPALVTSDL 834
                            V +  +P DK  LV+ L++ G + VA  GDG ND+PAL  +D+
Sbjct: 751 FRKLSDSERKRILPKLRVLARSSPEDKKILVRALKEMG-EVVAVTGDGTNDAPALKLADV 809

Query: 835 GVSIS-TGTDIAMEAADVIIL 854
           G S+  TGT++A EA+D+I++
Sbjct: 810 GFSMGITGTEVAREASDIILM 830

>AFL011W [3182] [Homologous to ScYGL006W (PMC1) - SH]
           complement(415265..418993) [3729 bp, 1242 aa]
          Length = 1242

 Score = 58.5 bits (140), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 74/259 (28%), Positives = 109/259 (42%), Gaps = 41/259 (15%)

Query: 413 IIENGKAREIPVEFLQVGDTVEIKPGAKIPTDGVIIEGESEVDESLITGESLMVPR---- 468
           ++ NG    I V  L VGD + ++ G  +P D +++EG+ E DES ITGES  + +    
Sbjct: 187 VVRNGDKHVISVHDLLVGDLLSLQTGDVVPVDCILVEGKCECDESGITGESDTIKKVSLA 246

Query: 469 -----YKGFPV------IAGSING----PNRFLLTA------------TSVGDDTKLAQI 501
                Y+          I  S NG    P+  L++             T+VG  +   ++
Sbjct: 247 MSLQVYRTVAADNPSADIGSSDNGHSLVPDPMLISGSKLLSGIGHAVVTAVGPHSVHGKM 306

Query: 502 IQTMKQAQLSKAPIQHYADYLASKFVPSVLVLAMITFVTWTILSRVLSNPPS---IFDSP 558
           +  +K ++    P+Q   + LA        V A + FV   +  R LS  P      D P
Sbjct: 307 MLALK-SEPETTPLQERLNTLADDISIYGSVAAFLLFVV--LFLRFLSYLPKGRLYHDLP 363

Query: 559 NGK----FFICLEMTISVIVVACPCALGLAAPTAIMVGTGLGAKHGVLIKGGDILEKCSS 614
           + +    F       ++VIVVA P  L LA   A+   T    K G L++     E   S
Sbjct: 364 SARKGSRFMDIFITAVTVIVVAVPEGLPLAVTLALAFATTRMTKDGNLVRVLRACETMGS 423

Query: 615 LETFLFDKTGTLTTGHMTV 633
             T   DKTGTLT   M V
Sbjct: 424 ATTVCSDKTGTLTQNKMVV 442

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 42/147 (28%), Positives = 66/147 (44%), Gaps = 32/147 (21%)

Query: 739 LVGRFEISDFIKKDAAEVVQYLTEKGHRVCMVTGDNHKSAMKVALELGIEANNVYSEL-- 796
           L G   I D ++    E V+   + G  V M+TGDN  +   +A   GI + + Y++   
Sbjct: 706 LDGVVGIHDPLRPGVKESVKNCQQSGVTVRMITGDNITTGRAIARACGILSESEYADHEC 765

Query: 797 ----------------------------TPADKNQLVQDLQDGGRKNVAFIGDGINDSPA 828
                                       +P DK   V D+     + VA  GDG ND+PA
Sbjct: 766 AMEGPVFRKLSRRQMMDAAPKLKVLARSSPEDKRIFV-DILKKMNEVVAVTGDGTNDAPA 824

Query: 829 LVTSDLGVSIS-TGTDIAMEAADVIIL 854
           L  +D+G S+  +GT +A EA+D+I++
Sbjct: 825 LTLADVGFSMGISGTGVAREASDIILM 851

>YDR038C (ENA5) [891] chr4 complement(527417..530692) Member of the
           Na[+]-transporting ATPases family in the superfamily of
           P-type ATPases [3276 bp, 1091 aa]
          Length = 1091

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 82/295 (27%), Positives = 123/295 (41%), Gaps = 54/295 (18%)

Query: 384 VGKLLENKAKSKTNNSLSKLMSLAPSTCTIIENGKAREIPVEFLQVGDTVEIKPGAKIPT 443
           +G + E KA +KT NSL  L S       +I NGK+  I  + +  GD   +K G  IP 
Sbjct: 107 IGLVQEYKA-TKTMNSLKNLSS---PNAHVIRNGKSETINSKDVVPGDICLVKVGDTIPA 162

Query: 444 DGVIIEGES-EVDESLITGESLMVPRYKGFPVIAGSINGPNRFLLTATSVGDDTKLAQ-- 500
           D  +IE ++ + DESL+TGESL  P  K   ++ G            TSVGD   LA   
Sbjct: 163 DLRLIETKNFDTDESLLTGESL--PVSKDANLVFGK--------EEETSVGDRLNLAFSS 212

Query: 501 -----------IIQTMKQAQLSKAPIQHYAD-----------YLASKFVPSVLVL-AMIT 537
                      +I+T   +++ K       D           +L + ++ +  V  A + 
Sbjct: 213 SAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDPSKSWLQNTWISTKKVTGAFLG 272

Query: 538 FVTWTILSRVLSNPP----------SIFDSPNGKFFICLEMTISVIVVAC---PCALGLA 584
               T L R LS             +I    + KF +   + I  I VA    P +L + 
Sbjct: 273 TNVGTPLHRKLSKLAVLLFWIAVLFAIIVMASQKFDVDKRVAIYAICVALSMIPSSLVVV 332

Query: 585 APTAIMVGTGLGAKHGVLIKGGDILEKCSSLETFLFDKTGTLTTGHMTVEQ-FVP 638
               + VG  +     V+++  D LE   ++     DKTGTLT G M   Q ++P
Sbjct: 333 LTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKMLARQIWIP 387

 Score = 50.8 bits (120), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 40/162 (24%), Positives = 75/162 (46%), Gaps = 40/162 (24%)

Query: 739 LVGRFEISDFIKKDAAEVVQYLTEKGHRVCMVTGDNHKSAMKVALELGIEANNVY----- 793
            +G   I D  + + A  V+   + G  V M+TGD   +A  +A E+GI   N+Y     
Sbjct: 641 FLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQE 700

Query: 794 ------------------------------SELTPADKNQLVQDLQDGGRKNVAFIGDGI 823
                                         +  +P  K ++++ L    +K  A  GDG+
Sbjct: 701 IVDSMVMTGSQFDGLSEEEVDDLPVLPLVIARCSPQTKVRMIEALHRR-KKFCAMTGDGV 759

Query: 824 NDSPALVTSDLGVSIS-TGTDIAMEAADVIILNRSENNHVSL 864
           NDSP+L  +++G+++   G+D++ EA+D+++   S++N  S+
Sbjct: 760 NDSPSLKMANVGIAMGINGSDVSKEASDIVL---SDDNFASI 798

>YDR039C (ENA2) [892] chr4 complement(531302..534577) Member of the
           Na[+]-transporting ATPases family in the superfamily of
           P-type ATPases [3276 bp, 1091 aa]
          Length = 1091

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 82/295 (27%), Positives = 123/295 (41%), Gaps = 54/295 (18%)

Query: 384 VGKLLENKAKSKTNNSLSKLMSLAPSTCTIIENGKAREIPVEFLQVGDTVEIKPGAKIPT 443
           +G + E KA +KT NSL  L S       +I NGK+  I  + +  GD   +K G  IP 
Sbjct: 107 IGLVQEYKA-TKTMNSLKNLSS---PNAHVIRNGKSETINSKDVVPGDICLVKVGDTIPA 162

Query: 444 DGVIIEGES-EVDESLITGESLMVPRYKGFPVIAGSINGPNRFLLTATSVGDDTKLAQ-- 500
           D  +IE ++ + DESL+TGESL  P  K   ++ G            TSVGD   LA   
Sbjct: 163 DLRLIETKNFDTDESLLTGESL--PVSKDANLVFGK--------EEETSVGDRLNLAFSS 212

Query: 501 -----------IIQTMKQAQLSKAPIQHYAD-----------YLASKFVPSVLVL-AMIT 537
                      +I+T   +++ K       D           +L + ++ +  V  A + 
Sbjct: 213 SAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDPSKSWLQNTWISTKKVTGAFLG 272

Query: 538 FVTWTILSRVLSNPP----------SIFDSPNGKFFICLEMTISVIVVAC---PCALGLA 584
               T L R LS             +I    + KF +   + I  I VA    P +L + 
Sbjct: 273 TNVGTPLHRKLSKLAVLLFWIAVLFAIIVMASQKFDVDKRVAIYAICVALSMIPSSLVVV 332

Query: 585 APTAIMVGTGLGAKHGVLIKGGDILEKCSSLETFLFDKTGTLTTGHMTVEQ-FVP 638
               + VG  +     V+++  D LE   ++     DKTGTLT G M   Q ++P
Sbjct: 333 LTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKMLARQIWIP 387

 Score = 50.8 bits (120), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 40/162 (24%), Positives = 75/162 (46%), Gaps = 40/162 (24%)

Query: 739 LVGRFEISDFIKKDAAEVVQYLTEKGHRVCMVTGDNHKSAMKVALELGIEANNVY----- 793
            +G   I D  + + A  V+   + G  V M+TGD   +A  +A E+GI   N+Y     
Sbjct: 641 FLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQE 700

Query: 794 ------------------------------SELTPADKNQLVQDLQDGGRKNVAFIGDGI 823
                                         +  +P  K ++++ L    +K  A  GDG+
Sbjct: 701 IVDSMVMTGSQFDGLSEEEVDDLPVLPLVIARCSPQTKVRMIEALHRR-KKFCAMTGDGV 759

Query: 824 NDSPALVTSDLGVSIS-TGTDIAMEAADVIILNRSENNHVSL 864
           NDSP+L  +++G+++   G+D++ EA+D+++   S++N  S+
Sbjct: 760 NDSPSLKMANVGIAMGINGSDVSKEASDIVL---SDDNFASI 798

>YDR040C (ENA1) [893] chr4 complement(535187..538462) P-type ATPase
           involved in Na+ and Li+ efflux, required for Na+
           tolerance [3276 bp, 1091 aa]
          Length = 1091

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 82/295 (27%), Positives = 123/295 (41%), Gaps = 54/295 (18%)

Query: 384 VGKLLENKAKSKTNNSLSKLMSLAPSTCTIIENGKAREIPVEFLQVGDTVEIKPGAKIPT 443
           +G + E KA +KT NSL  L S       +I NGK+  I  + +  GD   +K G  IP 
Sbjct: 107 IGLVQEYKA-TKTMNSLKNLSS---PNAHVIRNGKSETINSKDVVPGDICLVKVGDTIPA 162

Query: 444 DGVIIEGES-EVDESLITGESLMVPRYKGFPVIAGSINGPNRFLLTATSVGDDTKLAQ-- 500
           D  +IE ++ + DESL+TGESL  P  K   ++ G            TSVGD   LA   
Sbjct: 163 DLRLIETKNFDTDESLLTGESL--PVSKDANLVFGK--------EEETSVGDRLNLAFSS 212

Query: 501 -----------IIQTMKQAQLSKAPIQHYAD-----------YLASKFVPSVLVL-AMIT 537
                      +I+T   +++ K       D           +L + ++ +  V  A + 
Sbjct: 213 SAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDPSKSWLQNTWISTKKVTGAFLG 272

Query: 538 FVTWTILSRVLSNPP----------SIFDSPNGKFFICLEMTISVIVVAC---PCALGLA 584
               T L R LS             +I    + KF +   + I  I VA    P +L + 
Sbjct: 273 TNVGTPLHRKLSKLAVLLFWIAVLFAIIVMASQKFDVDKRVAIYAICVALSMIPSSLVVV 332

Query: 585 APTAIMVGTGLGAKHGVLIKGGDILEKCSSLETFLFDKTGTLTTGHMTVEQ-FVP 638
               + VG  +     V+++  D LE   ++     DKTGTLT G M   Q ++P
Sbjct: 333 LTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKMLARQIWIP 387

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 39/162 (24%), Positives = 74/162 (45%), Gaps = 40/162 (24%)

Query: 739 LVGRFEISDFIKKDAAEVVQYLTEKGHRVCMVTGDNHKSAMKVALELGIEANNVY----- 793
            +G   I D  + + A  V+   + G  V M+TGD   +A  +A E+GI   N+Y     
Sbjct: 641 FLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQE 700

Query: 794 ------------------------------SELTPADKNQLVQDLQDGGRKNVAFIGDGI 823
                                         +  +P  K ++++ L    +K     GDG+
Sbjct: 701 IVDSMVMTGSQFDGLSEEEVDDLPVLPLVIARCSPQTKVRMIEALHRR-KKFCTMTGDGV 759

Query: 824 NDSPALVTSDLGVSIS-TGTDIAMEAADVIILNRSENNHVSL 864
           NDSP+L  +++G+++   G+D++ EA+D+++   S++N  S+
Sbjct: 760 NDSPSLKMANVGIAMGINGSDVSKEASDIVL---SDDNFASI 798

>Scas_297.1
          Length = 800

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 37/60 (61%)

Query: 413 IIENGKAREIPVEFLQVGDTVEIKPGAKIPTDGVIIEGESEVDESLITGESLMVPRYKGF 472
           +I N +     +  L VGD + ++ G  IP DGV++EG+ EVDES ITGES  + + K F
Sbjct: 602 VIRNSQELLTSIHNLLVGDIITLQTGDVIPADGVLVEGQCEVDESSITGESDTIKKVKVF 661

 Score = 50.1 bits (118), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 50/88 (56%), Gaps = 2/88 (2%)

Query: 768 CMVTGDNHKSAMKVALELGIEANNVYSELTPADKNQLVQDLQDGGRKNVAFIGDGINDSP 827
           C + G   ++  K      +    V +  +P DK  LV+ L+  G   VA  GDG ND+P
Sbjct: 27  CAIEGPKFRTLTKQERIKMLPNLRVMARSSPEDKRLLVETLKGMG-DVVAVTGDGTNDAP 85

Query: 828 ALVTSDLGVSIS-TGTDIAMEAADVIIL 854
           AL  +D+G S+  +GT++A EA+D+I++
Sbjct: 86  ALKLADVGFSMGISGTEVAREASDIILM 113

>AGL097C [4215] [Homologous to ScYDR039C (ENA2 ) - NSH]
           (520915..524205) [3291 bp, 1096 aa]
          Length = 1096

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 73/293 (24%), Positives = 126/293 (43%), Gaps = 48/293 (16%)

Query: 382 ISVGKLLENKAKSKTNNSLSKLMSLAPSTCTIIENGKAREIPVEFLQVGDTVEIKPGAKI 441
           +S+G   E  A  KT NSL  L +  PS   +I NG+   +    +  GD V+++ G  +
Sbjct: 109 VSIGAYQEYNA-CKTMNSLKDLST--PS-ARVIRNGEDVVMASAQVVPGDIVQVRVGDTV 164

Query: 442 PTDGVIIEGES-EVDESLITGESLMVPR------YKGFPV-------IAGSINGPNRFLL 487
           P D  ++E  + E DE+L+TGE+L V +       +  PV        A S     R   
Sbjct: 165 PADLRLVEALNLETDEALLTGEALPVAKDPAAVFEQDTPVGDRLNLAFASSTVSKGRATG 224

Query: 488 TATSVGDDTKLAQIIQTM--KQAQLS---------------KAPIQHY-ADYLASKFVPS 529
                G  +++ +I +++  KQ+ +S               KA +  +    + +     
Sbjct: 225 IVVRTGLRSEIGKIAESLQGKQSLISRDENKSGLQNTVLTVKASVGSFLGTNVGTPLHRK 284

Query: 530 VLVLAMITFVTWTILSRVLSNPPSIFDSPNGKFFICLEMTISVIVVAC---PCALGLAAP 586
           +  LA+I F    + + ++            KF +  E+ I  I VA    P +L +   
Sbjct: 285 LAKLALILFAIAVLFALIV--------MATQKFIVNREVAIYAICVALSMIPSSLVVVLT 336

Query: 587 TAIMVGTGLGAKHGVLIKGGDILEKCSSLETFLFDKTGTLTTGHMTVEQ-FVP 638
             +  G  + +   V+++  D LE   ++     DKTGTLT G M ++Q +VP
Sbjct: 337 ITMSAGAKVMSTRNVIVRRLDSLEALGAVNDICSDKTGTLTQGKMILKQLWVP 389

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 42/159 (26%), Positives = 72/159 (45%), Gaps = 38/159 (23%)

Query: 741 GRFEISDFIKKDAAEVVQYLTEKGHRVCMVTGDNHKSAMKVALELGIEANNVY------- 793
           G   I D  + + A  V+     G  V M+TGD   +A  +A E+GI  +N+Y       
Sbjct: 638 GLVGIYDPPRVETAGAVKKCHRAGINVHMLTGDFPGTAKAIAQEVGILPHNLYHYPKEVV 697

Query: 794 ----------SELTPADKNQL-----------------VQDLQDGGRKNVAFIGDGINDS 826
                       LT  + +QL                 + D      K  A  GDG+NDS
Sbjct: 698 DIMVMTATQFDSLTDEELDQLPVLPLVIARCAPQTKVRMIDALHRREKFCAMTGDGVNDS 757

Query: 827 PALVTSDLGVSIS-TGTDIAMEAADVIILNRSENNHVSL 864
           P+L  +++G+++   G+D+A +A+D+++   S++N  S+
Sbjct: 758 PSLKKANVGIAMGINGSDVAKDASDIVL---SDDNFASI 793

>KLLA0E14630g complement(1297636..1300884) similar to sp|Q01896
           Saccharomyces cerevisiae YDR039c ENA2 P-type ATPase
           involved in Na+ efflux, hypothetical start
          Length = 1082

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 42/171 (24%), Positives = 80/171 (46%), Gaps = 44/171 (25%)

Query: 732 YVKINGELVGRFEISDFIKKDAAEVVQYLTEKGHRVCMVTGDNHKSAMKVALELGIEANN 791
           +V+ N   +G   I D  ++++   V+     G  V M+TGD   +A  +A E+GI  +N
Sbjct: 623 FVENNLTFLGLVGIYDPPRRESLAAVKKCHLAGINVHMLTGDFPGTAKSIAQEVGILPHN 682

Query: 792 VY-----------------------------------SELTPADKNQLVQDLQDGGRKN- 815
           +Y                                   +   P  K ++++ L    R+N 
Sbjct: 683 LYHYPKEVVNFMVMTATDFDALSDKEIDELPVLPLVIARCAPQTKVRMIEALH---RRNR 739

Query: 816 -VAFIGDGINDSPALVTSDLGVSIS-TGTDIAMEAADVIILNRSENNHVSL 864
             A  GDG+NDSP+L  +++G+++   G+D+A +A+D+++   S++N  S+
Sbjct: 740 FCAMTGDGVNDSPSLKIANVGIAMGINGSDVAKDASDIVL---SDDNFASI 787

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 83/326 (25%), Positives = 132/326 (40%), Gaps = 40/326 (12%)

Query: 341 VLLSTLCSFAFSLYSIAMNVAKKSERMPNVIFDASVMLIGFISV--GKLLENKAKSKTNN 398
           + +S +C+    +  I+M +   S  + + I    +  + FI+V  G   E  A SKT N
Sbjct: 67  IFISQICNAMIMVLIISMVI---SFAIKDWISGGVIAFVVFINVVIGAYQEYNA-SKTMN 122

Query: 399 SLSKLMSLAPSTCTIIENGKAREIPVEFLQVGDTVEIKPGAKIPTDGVIIEG-ESEVDES 457
           SL    SL+  +  +I  G    I  + L  GD   I+ G  +P D  + E    E DE+
Sbjct: 123 SLK---SLSTPSAHVIRAGNDLTIESKELVPGDICIIRVGDTVPADLRLFEAINLETDEA 179

Query: 458 LITGESLMVPRYKG------FPV-------IAGSINGPNRFLLTATSVGDDTKLAQIIQT 504
           L+TGESL V +  G       PV        A S     R          +T++ +I ++
Sbjct: 180 LLTGESLPVAKSHGEVYEQDTPVGDRLNLAFAASTVTKGRATGIVIKTALNTEIGKIAKS 239

Query: 505 MKQ--AQLSKAPIQHYADYLASKFVPSVLVLAMITFVTWTILSRVLSNPPSIFDSP---- 558
           +K   + +S+   + +   L      S+      +    T L R LS    +        
Sbjct: 240 LKSEASLISRDKSKSFGRNLWITLRESIGTFLGTS--VGTPLHRKLSQLAILLFVVAVIF 297

Query: 559 ------NGKFFICLEMTISVIVVAC---PCALGLAAPTAIMVGTGLGAKHGVLIKGGDIL 609
                   KF +  ++ I  I VA    P +L +     +  G  + A   V+I+  D L
Sbjct: 298 AIVVMGTQKFKVNKQVAIYAICVALSMIPSSLVVVLTITMSAGAKVMATRHVIIRKLDSL 357

Query: 610 EKCSSLETFLFDKTGTLTTGHMTVEQ 635
           E   ++     DKTGTLT G M  +Q
Sbjct: 358 EALGAVNDICSDKTGTLTQGKMIAKQ 383

>KLLA0F20658g 1919851..1923099 similar to sp|Q12691 Saccharomyces
           cerevisiae YDR038c ENA5 P-type ATPase involved in Na+
           efflux, start by similarity
          Length = 1082

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 40/169 (23%), Positives = 78/169 (46%), Gaps = 40/169 (23%)

Query: 732 YVKINGELVGRFEISDFIKKDAAEVVQYLTEKGHRVCMVTGDNHKSAMKVALELGIEANN 791
           +V+     +G   I D  ++++   V+   + G  V M+TGD   +A  +A E+GI  +N
Sbjct: 623 FVECKLTFLGLIGIYDPPRQESLAAVKKCHQAGINVHMLTGDFPGTAKSIAQEVGILPHN 682

Query: 792 VY-----------------------------------SELTPADKNQLVQDLQDGGRKNV 816
           +Y                                   +   P  K ++++ L     K  
Sbjct: 683 LYHYPKEVVNFMVMAATDFDALSDQEIDDLRVLPLVIARCAPQTKVRMIEALHRRS-KFC 741

Query: 817 AFIGDGINDSPALVTSDLGVSIS-TGTDIAMEAADVIILNRSENNHVSL 864
           A  GDG+NDSP+L  +++G+++   G+D+A +A+D+++   S++N  S+
Sbjct: 742 AMTGDGVNDSPSLKIANVGIAMGINGSDVAKDASDIVL---SDDNFASI 787

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 73/283 (25%), Positives = 115/283 (40%), Gaps = 35/283 (12%)

Query: 382 ISVGKLLENKAKSKTNNSLSKLMSLAPSTCTIIENGKAREIPVEFLQVGDTVEIKPGAKI 441
           + +G   E  A SKT NSL    SL+  +  +I +G    I  + L  GD   IK G  +
Sbjct: 107 VVIGAYQEYNA-SKTMNSLK---SLSTPSAHVIRDGNDITIQSKELVPGDICIIKVGDTV 162

Query: 442 PTDGVIIEG-ESEVDESLITGESLMVPRY------KGFPV-------IAGSINGPNRFLL 487
           P D  ++E    E DE+L+TGESL V +       K  PV        A S     R   
Sbjct: 163 PADLRLLESINLETDEALLTGESLPVAKSHSEVYEKDTPVGDRLNLAFAASTVTKGRATG 222

Query: 488 TATSVGDDTKLAQIIQTMKQAQ--LSKAPIQHYADYLASKFVPSVLVLAMITFVTWTILS 545
                  +T++ +I +++K     +SK   + +   L      +  + + +     T L 
Sbjct: 223 IVIKTALNTEIGKIAKSLKSETSFISKDENKSFGQNLWITLKET--IGSFLGTNVGTPLH 280

Query: 546 RVLSNPPSIFDSP----------NGKFFICLEMTISVIVVA---CPCALGLAAPTAIMVG 592
           R LS    +                K+ +  ++ I  I VA    P +L +     +  G
Sbjct: 281 RKLSQLAILLFVVAVIFAIVVMGTQKYRVNKQVAIYAICVAISMIPSSLVVVLTITMSAG 340

Query: 593 TGLGAKHGVLIKGGDILEKCSSLETFLFDKTGTLTTGHMTVEQ 635
             + A   V+++  D LE   ++     DKTGTLT G M  +Q
Sbjct: 341 AKVMATRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKMIAKQ 383

>AFR567W [3759] [Homologous to ScYOR291W - SH]
            complement(1455295..1459644) [4350 bp, 1449 aa]
          Length = 1449

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 35/49 (71%), Gaps = 1/49 (2%)

Query: 791  NVYSELTPADKNQLVQDLQDGGRKNVAFIGDGINDSPALVTSDLGVSIS 839
            ++Y+ ++P +K++LV+ LQ  G + V F GDG ND  AL  +D+G+S+S
Sbjct: 1135 SIYARMSPDEKHELVERLQSIGYQ-VGFCGDGANDCGALKAADIGISLS 1182

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 68/321 (21%), Positives = 128/321 (39%), Gaps = 62/321 (19%)

Query: 349 FAFSLYSIAMNVAKKSERMPNVIFDASVMLIGFISVGKLLENKAKSKTNNSLSKLMSLAP 408
           + F ++SI + +          IF  SV+ +    +  L+E K  S+  + LS+      
Sbjct: 487 YIFQIFSIILWMFDAYYYYATCIFIISVLSV----IDTLVETKQSSERLSELSQFYC--- 539

Query: 409 STCTIIENGKAREIPVEFLQVGDTVEI-KPG-AKIPTDGVIIEGESEVDESLITGES--- 463
               +  +G   ++P   L  GD  E+  P  + +P D ++I G+  V+ES++TGES   
Sbjct: 540 -DVRVYRDGFWSQVPSSDLVPGDIYELTDPSLSLLPCDSILISGDCLVNESMLTGESVPV 598

Query: 464 ----------------LMVPRYKGFPVIAGSINGPNRFLLTATSVGDDTKLAQIIQT--- 504
                            M  +   F   +   NG     + AT+ G    L  + +T   
Sbjct: 599 SKVAATRETMLQLLDDFMDTQLSSFVSKSFLFNGTKLIRVRATA-GQSIALGMVARTGFS 657

Query: 505 -----MKQAQLSKAP--IQHYADYLASKFVPSVLVLAMITF-VTWTILSRVLSNPPSIFD 556
                + ++ +   P   + Y D  + K++  + ++A+  F V++    R+  +  ++  
Sbjct: 658 TTKGSLVRSMVFPKPTGFKFYED--SFKYIGYISIIALFGFAVSFIQFLRLGLDKRTM-- 713

Query: 557 SPNGKFFICLEMTISVIVVACPCALGLAAPTAIMVGTGLG----AKHGVLIKGGDILEKC 612
                    +   + +I V  P AL    P ++ +GTG       K G+       +   
Sbjct: 714 ---------ILRALDIITVVVPPAL----PASLSIGTGFALNRLKKKGIFCISPTRVNVG 760

Query: 613 SSLETFLFDKTGTLTTGHMTV 633
             ++   FDKTGTLT   + V
Sbjct: 761 GKIDVMCFDKTGTLTEDGLDV 781

>CAGL0L01419g 156123..159767 highly similar to sp|P39986
           Saccharomyces cerevisiae YEL031w SPF1 P-type ATPase,
           hypothetical start
          Length = 1214

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 26/39 (66%)

Query: 749 IKKDAAEVVQYLTEKGHRVCMVTGDNHKSAMKVALELGI 787
           +K DA E +Q L E  HR  M+TGDN  +A+ VA E+GI
Sbjct: 673 LKHDAIETIQMLNESAHRCVMITGDNPLTAVHVAKEVGI 711

 Score = 38.1 bits (87), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 33/52 (63%), Gaps = 1/52 (1%)

Query: 792 VYSELTPADKNQLVQDLQDGGRKNVAFIGDGINDSPALVTSDLGVSISTGTD 843
           +Y+ ++PA K  ++ +L+D G + +   GDG ND  AL  + +GV++  GT+
Sbjct: 786 IYARVSPAQKEFILNNLKDMGYQTL-MCGDGTNDVGALKQAHVGVALLNGTE 836

>Scas_569.0d
          Length = 468

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 47/74 (63%), Gaps = 5/74 (6%)

Query: 792 VYSELTPADKNQLVQDLQDGGRKNVAFIGDGINDSPALVTSDLGVSIS-TGTDIAMEAAD 850
           V +  +P  K ++++ L     K  A  GDG+NDSP+L  +++G+++   G+D+A +A+D
Sbjct: 104 VIARCSPQTKVRMIEALHRRD-KFCAMTGDGVNDSPSLKMANVGIAMGINGSDVAKDASD 162

Query: 851 VIILNRSENNHVSL 864
           +++   S++N  S+
Sbjct: 163 IVL---SDDNFASI 173

>Scas_665.30
          Length = 1439

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 43/73 (58%), Gaps = 5/73 (6%)

Query: 769 MVTGDNHKSAMKVALELGIEANNVYSELTPADKNQLVQDLQDGGRKN--VAFIGDGINDS 826
           ++ GD + S  +  +   +    +Y+ ++P +K++L++ LQ   R N  V F GDG ND 
Sbjct: 906 IIFGDENNSISEDYINTVLLKGTIYARMSPDEKHELMEQLQ---RLNYTVGFCGDGANDC 962

Query: 827 PALVTSDLGVSIS 839
            AL  +D+G+S+S
Sbjct: 963 GALKAADVGISLS 975

 Score = 33.9 bits (76), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 33/62 (53%), Gaps = 1/62 (1%)

Query: 733 VKINGELVGRFEISDFIKKDAAEVVQYLTEKGHRVCMVTGDNHKSAMKVALELG-IEANN 791
           V+ N E +G     + +KK+ A+ +Q L E   R  M TGDN  +A+ V  +   I++  
Sbjct: 791 VESNMEFLGFIIFENKLKKETAKTLQTLQEASIRTVMCTGDNVLTAISVGRQCNLIKSKK 850

Query: 792 VY 793
           VY
Sbjct: 851 VY 852

 Score = 33.9 bits (76), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 67/328 (20%), Positives = 127/328 (38%), Gaps = 76/328 (23%)

Query: 349 FAFSLYSIAMNVAKKSERMPNVIFDASVMLIGFISVGKLLENKAKSKTNNSLSKLMSLAP 408
           + F ++SI +    +       IF  S++ I    V  L+E +   +T  SL+ +   A 
Sbjct: 275 YVFQIFSIILWSLDEYYYYAGCIFLISILSI----VDTLVETR---RTQKSLADMSHFA- 326

Query: 409 STCTIIENGKAREIPVEFLQVGDTVEIK-PGAKI-PTDGVIIEGESEVDESLITGESLMV 466
               +  +     +    L  GD  EI  P   + P D +++ G+  V+ES++TGES+ V
Sbjct: 327 CEVRVFRDEFWTNVNSADLVPGDIYEISDPSLTVFPCDSLLLSGDCIVNESMLTGESVPV 386

Query: 467 PRYKGFP-------------VIAGSINGPNRFLLTATSV-------GDDTKLAQIIQT-- 504
            ++   P              I+  ++    FL   T++       G    LA +++T  
Sbjct: 387 SKFPAEPETMLQLLDDFQNTQISSYLS--KSFLFNGTTIIRARIPYGQSAALAMVVRTGF 444

Query: 505 ------MKQAQLSKAP--IQHYADYLASKFVPSVLVLAM-------ITFVTWTILSRVLS 549
                 + ++ +   P   + Y D  + K++  + ++A+       I F+   +  R + 
Sbjct: 445 STTKGSLVRSMVFPKPTGFKFYED--SFKYIGVMALIALFGFSISCIQFIKIGLDKRTM- 501

Query: 550 NPPSIFDSPNGKFFICLEMTISVIVVACPCALGLAAPTAIMVGTGLG----AKHGVLIKG 605
                           +   + +I +  P AL    P  + +GTG       K G+    
Sbjct: 502 ----------------ILRALDIITIVVPPAL----PATLTIGTGFALSRLKKKGIFCIS 541

Query: 606 GDILEKCSSLETFLFDKTGTLTTGHMTV 633
              +     ++   FDKTGTLT   + V
Sbjct: 542 PTRVNIGGKIDILCFDKTGTLTENGLDV 569

>KLLA0B08217g complement(724364..728683) similar to sp|Q12697
            Saccharomyces cerevisiae YOR291w, start by similarity
          Length = 1439

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 34/49 (69%), Gaps = 1/49 (2%)

Query: 791  NVYSELTPADKNQLVQDLQDGGRKNVAFIGDGINDSPALVTSDLGVSIS 839
            ++Y+ ++P +K++LV+ LQ     NV F GDG ND  AL  +++G+S+S
Sbjct: 1125 SIYARMSPDEKHELVEQLQKLDY-NVGFCGDGANDCGALKAANIGISLS 1172

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 70/315 (22%), Positives = 125/315 (39%), Gaps = 62/315 (19%)

Query: 349 FAFSLYSIAMNVAKKSERMPNVIFDASVMLIGFISVGKLLENKAKSKTNNSLSKLMSLAP 408
           + F ++SI + +A         IF  SV+ I    +  ++E K  S+      KL  ++ 
Sbjct: 486 YVFQIFSIILWLADDYYYYAGCIFLISVLSI----IDTVIETKKNSE------KLADISH 535

Query: 409 STC--TIIENGKAREIPVEFLQVGDTVEIKPGAKI--PTDGVIIEGESEVDESLITGESL 464
             C   + ++    ++    L  GD  EI   + +  P D V+I G+  V+ES++TGES+
Sbjct: 536 FNCEVRVYKDRFWTQVNSSDLVPGDLFEISDPSLVVLPCDAVLISGDCIVNESMLTGESV 595

Query: 465 MVPRY-----------KGFPVIAGSINGPNRFLLTATSV-------GDDTKLAQIIQT-- 504
            V +Y           + F     S      FL   T +       G    LA +I+T  
Sbjct: 596 PVSKYAATEATMAQLLQDFKSSQVSSFVSKSFLFNGTKIIRVRNQPGQGMALALVIRTGF 655

Query: 505 ------MKQAQLSKAPI--QHYADYLASKFVPSVLVLAMITFVTWTILSRVLSNPPSIFD 556
                 + ++ +   P+  + Y D  + K++  + ++AM  F    I           F 
Sbjct: 656 STTKGSLVRSMVFPKPVGFKFYED--SFKYIGFMTLIAMFGFSISCIQ----------FI 703

Query: 557 SPNGKFFICLEMTISVIVVACPCALGLAAPTAIMVGTGLG----AKHGVLIKGGDILEKC 612
               ++ + +   + +I +  P AL    P  + +GT        K G+       +   
Sbjct: 704 RLGLEYKVMILRALDIITIVVPPAL----PATLTIGTSFALGRLKKKGIFCISPTRVNVG 759

Query: 613 SSLETFLFDKTGTLT 627
             ++   FDKTGTLT
Sbjct: 760 GKVDMMCFDKTGTLT 774

>YEL031W (SPF1) [1394] chr5 (90258..93905) Putative
           Ca2+-transporting ATPase, member of the P-type ATPase
           superfamily of membrane transporters [3648 bp, 1215 aa]
          Length = 1215

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 33/59 (55%), Gaps = 2/59 (3%)

Query: 749 IKKDAAEVVQYLTEKGHRVCMVTGDNHKSAMKVALELGIEANN--VYSELTPADKNQLV 805
           +K DA E ++ L E  HR  M+TGDN  +A+ VA E+GI      +      +D NQL+
Sbjct: 675 LKDDAIETIKMLNESSHRSIMITGDNPLTAVHVAKEVGIVFGETLILDRAGKSDDNQLL 733

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 32/52 (61%), Gaps = 1/52 (1%)

Query: 792 VYSELTPADKNQLVQDLQDGGRKNVAFIGDGINDSPALVTSDLGVSISTGTD 843
           VY+ ++P+ K  L+  L+D G + +   GDG ND  AL  + +G+++  GT+
Sbjct: 788 VYARVSPSQKEFLLNTLKDMGYQTL-MCGDGTNDVGALKQAHVGIALLNGTE 838

 Score = 31.2 bits (69), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 34/65 (52%), Gaps = 3/65 (4%)

Query: 402 KLMSLAPSTCTIIENGKAREIPVEFLQVGDTVEIKPGAK---IPTDGVIIEGESEVDESL 458
           + M + P T  +  N K   +    L   D V I   A+   IP D ++++G + V+E++
Sbjct: 247 RTMGIKPYTINVFRNKKWVALQTNELLPMDLVSITRTAEESAIPCDLILLDGSAIVNEAM 306

Query: 459 ITGES 463
           ++GES
Sbjct: 307 LSGES 311

>KLLA0E22352g 1984522..1988142 highly similar to sp|P39986
           Saccharomyces cerevisiae YEL031w SPF1 P-type ATPase,
           start by similarity
          Length = 1206

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/39 (48%), Positives = 26/39 (66%)

Query: 749 IKKDAAEVVQYLTEKGHRVCMVTGDNHKSAMKVALELGI 787
           +K DA E ++ L E  HR  M+TGDN  +A+ VA E+GI
Sbjct: 673 LKDDAIETIKMLNESSHRSIMITGDNPLTAVHVAKEVGI 711

 Score = 37.7 bits (86), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 59/124 (47%), Gaps = 11/124 (8%)

Query: 726 ASSTLAYVKINGELVGRFEISDFIKKDAAEVVQY--LTEKGHRVCMVTGDNHKSAMKVAL 783
           +S  L    +N  +V  F   D    D  E+ Q   L   GH + ++ G  HK    V  
Sbjct: 726 SSHALVMRDVNETIVKPFN-PDADTFDEKEIFQKYDLAVTGHALKLLQG--HKQLRDV-- 780

Query: 784 ELGIEANNVYSELTPADKNQLVQDLQDGGRKNVAFIGDGINDSPALVTSDLGVSISTGTD 843
              I    +Y+ ++P+ K  ++  L+D G + +   GDG ND  AL  + +G+++  GT+
Sbjct: 781 ---IRHTWIYARVSPSQKEFILITLKDMGYQTL-MCGDGTNDVGALKQAHVGIALLNGTE 836

Query: 844 IAME 847
            +++
Sbjct: 837 DSLK 840

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 35/65 (53%), Gaps = 3/65 (4%)

Query: 402 KLMSLAPSTCTIIENGKAREIPVEFLQVGDTVEIKPGAK---IPTDGVIIEGESEVDESL 458
           + M + P    +  +GK  E+  + L   D V I   A+   IP D ++I+G   V+E++
Sbjct: 246 RTMGIKPYAINVFRDGKWVEMQTDKLFPMDLVSITRTAEDSAIPCDLLLIDGSCIVNEAM 305

Query: 459 ITGES 463
           ++GES
Sbjct: 306 LSGES 310

>Kwal_26.9207
          Length = 1469

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 45/77 (58%), Gaps = 8/77 (10%)

Query: 770  VTGD-------NHKSAMKVALELGIEANNVYSELTPADKNQLVQDLQDGGRKNVAFIGDG 822
            VTGD       N++   +  + + +  +++Y+ ++P +K++LV  LQ G    V F GDG
Sbjct: 1127 VTGDVFRLLFKNNEVLPESYINMVLLKSSIYARMSPDEKHELVGQLQ-GLDYVVGFCGDG 1185

Query: 823  INDSPALVTSDLGVSIS 839
             ND  AL  +D+GVS+S
Sbjct: 1186 ANDCGALKAADVGVSLS 1202

 Score = 36.2 bits (82), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 60/124 (48%), Gaps = 14/124 (11%)

Query: 349 FAFSLYSIAMNVAKKSERMPNVIFDASVMLIGFISVGKLLENKAKSKTNNSLSKLMSLAP 408
           + F ++SI + +A         IF  S++ I    +  L+E K  S+      +L  ++ 
Sbjct: 505 YVFQIFSILLWLADNYYYYAACIFIISMLSI----IDTLVETKKTSQ------RLAEVSH 554

Query: 409 STC--TIIENGKAREIPVEFLQVGDTVEIK-PG-AKIPTDGVIIEGESEVDESLITGESL 464
           S C   +  +G   ++    L  GD  EI  P  +  P D +++ G+  V+ES++TGES+
Sbjct: 555 SHCEVRVYRDGFWVQVSSSELVPGDVYEISDPSLSTFPCDSLLLSGDCIVNESMLTGESV 614

Query: 465 MVPR 468
            V +
Sbjct: 615 PVSK 618

>Scas_583.14*
          Length = 875

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 33/59 (55%), Gaps = 4/59 (6%)

Query: 749 IKKDAAEVVQYLTEKGHRVCMVTGDNHKSAMKVALELGIEANNVYSELTPADKNQLVQD 807
           +K DA E ++ L E  HR  M+TGDN  +A+ VA E+ I    V  E    DK++ V D
Sbjct: 329 LKPDAVETIKMLNESAHRSIMITGDNPLTAVHVAKEVAI----VTGETLILDKSETVGD 383

 Score = 37.7 bits (86), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 36/57 (63%), Gaps = 1/57 (1%)

Query: 792 VYSELTPADKNQLVQDLQDGGRKNVAFIGDGINDSPALVTSDLGVSISTGTDIAMEA 848
           VY+ ++P+ K  ++ +L++ G + +   GDG ND  AL  + +GV++  GT+ +M A
Sbjct: 442 VYARVSPSQKEFILNNLKEMGYQTL-MCGDGTNDVGALKQAHVGVALLNGTEESMTA 497

>CAGL0M11308g 1110211..1114569 similar to sp|Q12697 Saccharomyces
            cerevisiae YOR291w, hypothetical start
          Length = 1452

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 33/49 (67%), Gaps = 1/49 (2%)

Query: 791  NVYSELTPADKNQLVQDLQDGGRKNVAFIGDGINDSPALVTSDLGVSIS 839
            ++++ ++P +K++LV+ LQ      V F GDG ND  AL  +D+G+S+S
Sbjct: 1138 SIFARMSPDEKHELVEQLQKMDY-TVGFCGDGANDCGALKAADVGISLS 1185

 Score = 36.2 bits (82), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 49/99 (49%), Gaps = 11/99 (11%)

Query: 376 VMLIGFISV-GKLLENKAKSKTNNSLSKLMSLAPSTC--TIIENGKAREIPVEFLQVGDT 432
           + LI  +S+   L+E K  S+T      L  ++   C   ++  G    I    L  GD 
Sbjct: 509 IFLISLLSILDTLIETKKISRT------LAEMSHFNCEVRVLREGFWSSIHSSELVPGDI 562

Query: 433 VEIK-PGAKI-PTDGVIIEGESEVDESLITGESLMVPRY 469
            EI  P   + P D +++ G+  V+ES++TGES+ V +Y
Sbjct: 563 YEISDPNLNLLPCDSILLSGDCIVNESMLTGESVPVSKY 601

>AFR354C [3546] [Homologous to ScYEL031W (SPF1) - SH]
           (1078275..1081907) [3633 bp, 1210 aa]
          Length = 1210

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 25/39 (64%)

Query: 749 IKKDAAEVVQYLTEKGHRVCMVTGDNHKSAMKVALELGI 787
           +K DA E ++ L E  HR  M+TGDN  +A+ VA E+ I
Sbjct: 676 LKDDAIETIKMLNESSHRCIMITGDNPLTAVHVAKEVAI 714

 Score = 39.7 bits (91), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 43/80 (53%), Gaps = 8/80 (10%)

Query: 764 GHRVCMVTGDNHKSAMKVALELGIEANNVYSELTPADKNQLVQDLQDGGRKNVAFIGDGI 823
           GH + +++G +  + +       I    VY+ ++PA K  ++  L+D G + +   GDG 
Sbjct: 768 GHALQLLSGHSQLNEL-------IRHTWVYARVSPAQKEFIMNSLKDMGYQTL-MCGDGT 819

Query: 824 NDSPALVTSDLGVSISTGTD 843
           ND  AL  + +G+++  GT+
Sbjct: 820 NDVGALKQAHVGIALLNGTE 839

>YOR291W (YOR291W) [5075] chr15 (861172..865590) Member of the
            cation-translocating P-type ATPase superfamily of
            membrane transporters [4419 bp, 1472 aa]
          Length = 1472

 Score = 38.5 bits (88), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 33/50 (66%), Gaps = 1/50 (2%)

Query: 790  NNVYSELTPADKNQLVQDLQDGGRKNVAFIGDGINDSPALVTSDLGVSIS 839
            +++Y+ ++P +K++L+  LQ      V F GDG ND  AL  +D+G+S+S
Sbjct: 1157 SSIYARMSPDEKHELMIQLQKLDY-TVGFCGDGANDCGALKAADVGISLS 1205

 Score = 34.3 bits (77), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 34/62 (54%), Gaps = 1/62 (1%)

Query: 733  VKINGELVGRFEISDFIKKDAAEVVQYLTEKGHRVCMVTGDNHKSAMKVALELG-IEANN 791
            V+ N E +G     + +KK+ +E ++ L +   R  M TGDN  +A+ V  E G I+ + 
Sbjct: 1015 VESNLEFLGFIIFQNKLKKETSETLKSLQDANIRTIMCTGDNILTAISVGREAGLIQCSR 1074

Query: 792  VY 793
            VY
Sbjct: 1075 VY 1076

>Sklu_2193.1 YIL048W, Contig c2193 334-3765 reverse complement
          Length = 1143

 Score = 37.4 bits (85), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 28/48 (58%)

Query: 417 GKAREIPVEFLQVGDTVEIKPGAKIPTDGVIIEGESEVDESLITGESL 464
            KA+ +P + L+VGD ++I  G +IP D V+++      ES I  + L
Sbjct: 256 NKAQLVPSKDLKVGDLIKIHKGTRIPADLVLLQSSEPSGESFIKTDQL 303

>YIL048W (NEO1) [2619] chr9 (261436..264891) Member of the
           Drs2p-like ATPases family in the superfamily of P-type
           ATPases, overproduction confers neomycin resistance
           [3456 bp, 1151 aa]
          Length = 1151

 Score = 37.0 bits (84), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 27/47 (57%)

Query: 418 KAREIPVEFLQVGDTVEIKPGAKIPTDGVIIEGESEVDESLITGESL 464
           + R IP + L+VGD +++  G +IP D V+++      ES I  + L
Sbjct: 261 RNRSIPSKDLKVGDLIKVHKGDRIPADLVLLQSSEPSGESFIKTDQL 307

>KLLA0C08393g 734655..738101 highly similar to sp|P40527
           Saccharomyces cerevisiae YIL048w NEO1 ATPase whose
           overproduction confers neomycin resistance, start by
           similarity
          Length = 1148

 Score = 37.0 bits (84), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 27/43 (62%)

Query: 422 IPVEFLQVGDTVEIKPGAKIPTDGVIIEGESEVDESLITGESL 464
           IP + L+VGD +++K GA++P D V+++      ES I  + L
Sbjct: 268 IPSKDLKVGDIIKLKKGARVPADVVVLQTNEPNGESFIKTDQL 310

>CAGL0L00715g 86810..90244 highly similar to sp|P40527 Saccharomyces
           cerevisiae YIL048w NEO1 ATPase whose overproduction
           confers neomycin resistance, hypothetical start
          Length = 1144

 Score = 35.0 bits (79), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 28/48 (58%)

Query: 417 GKAREIPVEFLQVGDTVEIKPGAKIPTDGVIIEGESEVDESLITGESL 464
           G+ R +  + L+VGD ++I  GA++P D ++++      E+ I  + L
Sbjct: 254 GRPRPVASKDLKVGDLIKISKGARVPADLILLQSSEPSGEAFIKTDQL 301

 Score = 30.8 bits (68), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 34/58 (58%)

Query: 726 ASSTLAYVKINGELVGRFEISDFIKKDAAEVVQYLTEKGHRVCMVTGDNHKSAMKVAL 783
           A++   Y++ + EL+G   + D ++KD    ++ L   G ++ M+TGD  ++A  V++
Sbjct: 722 ANTISKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSI 779

>AAR147W [335] [Homologous to ScYOR191W (RIS1) - SH]
           complement(608865..613607) [4743 bp, 1580 aa]
          Length = 1580

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 19/33 (57%)

Query: 936 WKPPKLDVSPKSQKPSAWSRISALFRREKSVRP 968
           W+ P +D++    KPSAW+    + RR  SV P
Sbjct: 95  WRSPGVDMAEPEHKPSAWAPAGGVKRRRLSVAP 127

>YKR029C (SET3) [3284] chr11 complement(497220..499475) Component of
           the Set3p complex with histone deacetylase activity that
           represses meiotic-specific sporulation gene expression,
           has similarity to E(z) Enhancer of zeste in the
           C-terminal domain, contains a PHD finger and a SET
           domain [2256 bp, 751 aa]
          Length = 751

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 33/137 (24%), Positives = 59/137 (43%), Gaps = 19/137 (13%)

Query: 635 QFVPMGVRDNLTTEELLCINASEAVSEHPVGKAIVEFTDSLIEDCDRTAVVTKSKTILGG 694
           +FV   +RD    EEL      +  S+HP+ K I   T   ++D +R  ++   +TIL  
Sbjct: 436 KFVLRALRDISEDEELYI--KWQWDSKHPILKLIKGMTIDSLDDLERYGLINSVETILSN 493

Query: 695 GLICDCELDGKAYHVVIGNRNVMQDMSLSADASSTLAYVKINGELVGRFEISDFI----- 749
           G  C C  + K  +++   R           A S    VK  G++  R+++++ +     
Sbjct: 494 GE-CGCGNNSKDCYLLKVKRY----------AQSLYKSVKSRGKMNNRYKLNEILNQYNC 542

Query: 750 -KKDAAEVVQYLTEKGH 765
            K+    ++  L EK  
Sbjct: 543 KKRREPPILHRLEEKAQ 559

>Scas_704.38
          Length = 1161

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 13/48 (27%), Positives = 28/48 (58%)

Query: 417 GKAREIPVEFLQVGDTVEIKPGAKIPTDGVIIEGESEVDESLITGESL 464
            +++ +P + L+VGD ++I  G ++P D V+++      E+ I  + L
Sbjct: 270 NQSKLVPSKDLKVGDLIKISKGDRLPADLVLLQSSEPSGETFIKTDQL 317

>CAGL0E01705g complement(168356..169444) similar to sp|P22133
           Saccharomyces cerevisiae YOL126c MDH2, start by
           similarity
          Length = 362

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 28/51 (54%), Gaps = 12/51 (23%)

Query: 637 VPMGV--RDNLTTEELLCINASEAVSEHPVGKAIVEFTDSLIEDCDRTAVV 685
           +P GV  +  +T ++L  INA          K I + TDS++E+CD T VV
Sbjct: 97  IPAGVPRKPGMTRDDLFNINA----------KIITQLTDSILENCDLTRVV 137

>Kwal_23.5789
          Length = 1133

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 36/70 (51%), Gaps = 12/70 (17%)

Query: 395 KTNNSLSKLMSLAPSTCTIIENGKAREIPVEFLQVGDTVEIKPGAKIPTDGVIIEGESEV 454
           ++NN L +++S            K++ +P + L+VGD ++I  GA+ P D V+++     
Sbjct: 236 ESNNELYEVLS------------KSQLVPSKDLKVGDLIKIGKGARAPADLVLLQSSEPS 283

Query: 455 DESLITGESL 464
            E  I  + L
Sbjct: 284 GEIFIKTDQL 293

>Kwal_23.3556
          Length = 1597

 Score = 32.0 bits (71), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 32/155 (20%), Positives = 69/155 (44%), Gaps = 19/155 (12%)

Query: 769  MVTGDNHKSAMKVALELGIEANNVYS-ELTPADKNQLVQDLQDGGRKNVAF-IGDGINDS 826
            + T +++ + M V +EL  + ++V     +P+ K  +V  +++  +K V   IGDG ND 
Sbjct: 1114 LTTFESNPTLMSVFVELCTKTDSVICCRASPSQKALMVTHIRNTDKKLVTLAIGDGANDI 1173

Query: 827  PALVTSDLGVSISTGTDI-AMEAADV----------IILNRSENNHVSLRELIYALDIAQ 875
              + ++D+GV I+    + A  ++D           ++L     N+V   + +       
Sbjct: 1174 AMIQSADIGVGIAGKEGLQASRSSDYSIAQFRFLLKLLLVHGRYNYVRTTKFVLC----- 1228

Query: 876  KTFRRVKINFFWAICYNLFMLPIAMGVLVPWEITM 910
             TF +  + +   + Y    +     +  PW ++M
Sbjct: 1229 -TFYKELLFYLTQMIYQRHTMFSGTSLYEPWSLSM 1262

>KLLA0E01650g complement(155975..160627) similar to sp|Q12674
            Saccharomyces cerevisiae YMR162c, start by similarity
          Length = 1550

 Score = 30.8 bits (68), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 13/52 (25%), Positives = 30/52 (57%)

Query: 731  AYVKINGELVGRFEISDFIKKDAAEVVQYLTEKGHRVCMVTGDNHKSAMKVA 782
             +++ + EL+G   I D +++   E +Q +   G ++ M+TGD  ++A+ + 
Sbjct: 993  GHIETDLELLGATAIEDKLQEGVPEAIQKIRRAGIKMWMLTGDKRETAINIG 1044

>CAGL0H04477g 421857..426737 similar to sp|Q12674 Saccharomyces
            cerevisiae YMR162c, start by similarity
          Length = 1626

 Score = 30.8 bits (68), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 27/126 (21%), Positives = 54/126 (42%), Gaps = 18/126 (14%)

Query: 797  TPADKNQLVQDLQDGGRKNVAF-IGDGINDSPALVTSDLGVSISTGTDI-AMEAADV--- 851
            +PA K  +V ++++  +  V   IGDG ND   + ++D+GV I+    + A  +AD    
Sbjct: 1144 SPAQKALMVSNIRNTDKSIVTLAIGDGANDIAMIQSADIGVGIAGKEGLQASRSADYSIG 1203

Query: 852  -------IILNRSENNHVSLRELIYALDIAQKTFRRVKINFFWAICYNLFMLPIAMGVLV 904
                   ++L     N++   + I      + TF      +   + Y  + +     +  
Sbjct: 1204 QFRFILKLLLVHGRYNYIRTAKFILCTFYKELTF------YLTQLIYQRYTMFSGTSLYE 1257

Query: 905  PWEITM 910
            PW ++M
Sbjct: 1258 PWSLSM 1263

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.135    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 28,116,676
Number of extensions: 1128195
Number of successful extensions: 3263
Number of sequences better than 10.0: 71
Number of HSP's gapped: 3170
Number of HSP's successfully gapped: 153
Length of query: 975
Length of database: 16,596,109
Length adjustment: 111
Effective length of query: 864
Effective length of database: 12,753,511
Effective search space: 11019033504
Effective search space used: 11019033504
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)