Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_55.2157024123912880.0
Sklu_1979.227324410721e-149
ACR087C25723610511e-146
KLLA0E21967g26023710141e-141
CAGL0I00946g25922310121e-140
Scas_699.432562119881e-137
YOR039W (CKB2)2582179811e-136
KLLA0A04818g2772534602e-56
CAGL0A00275g2662674479e-55
AGR163W2752644428e-54
Kwal_47.174492502454372e-53
Sklu_1768.43292344414e-53
Scas_638.72702334356e-53
YGL019W (CKB1)2782444296e-52
KLLA0B05555g199744619.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_55.21570
         (239 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_55.21570                                                         500   0.0  
Sklu_1979.2 YOR039W, Contig c1979 3847-4668 reverse complement        417   e-149
ACR087C [1134] [Homologous to ScYOR039W (CKB2) - SH] (514602..51...   409   e-146
KLLA0E21967g 1951763..1952545 similar to sp|P38930 Saccharomyces...   395   e-141
CAGL0I00946g complement(76974..77753) highly similar to sp|P3893...   394   e-140
Scas_699.43                                                           385   e-137
YOR039W (CKB2) [4851] chr15 (405767..406543) Casein kinase II Pr...   382   e-136
KLLA0A04818g 429275..430108 similar to sp|P43639 Saccharomyces c...   181   2e-56
CAGL0A00275g 29069..29869 highly similar to sp|P43639 Saccharomy...   176   9e-55
AGR163W [4474] [Homologous to ScYGL019W (CKB1) - SH] complement(...   174   8e-54
Kwal_47.17449                                                         172   2e-53
Sklu_1768.4 YGL019W, Contig c1768 4317-5306 reverse complement        174   4e-53
Scas_638.7                                                            172   6e-53
YGL019W (CKB1) [1954] chr7 (458159..458995) Casein kinase II (Pr...   169   6e-52
KLLA0B05555g complement(494997..500990) similar to sp|Q00416 Sac...    28   9.1  

>Kwal_55.21570
          Length = 241

 Score =  500 bits (1288), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 239/239 (100%), Positives = 239/239 (100%)

Query: 1   MADVEMVEARPDTAEGSDSSEYAEFWIDLFLGRKGHEYFCDIDTEYITDRFNLINLQKSV 60
           MADVEMVEARPDTAEGSDSSEYAEFWIDLFLGRKGHEYFCDIDTEYITDRFNLINLQKSV
Sbjct: 1   MADVEMVEARPDTAEGSDSSEYAEFWIDLFLGRKGHEYFCDIDTEYITDRFNLINLQKSV 60

Query: 61  NKFTQVIQYMVDELDDGILEQMSSTRLEQLEHDARKLYGLIHARYVITIKGLQKMLQKYK 120
           NKFTQVIQYMVDELDDGILEQMSSTRLEQLEHDARKLYGLIHARYVITIKGLQKMLQKYK
Sbjct: 61  NKFTQVIQYMVDELDDGILEQMSSTRLEQLEHDARKLYGLIHARYVITIKGLQKMLQKYK 120

Query: 121 EADFGRCPRVYCNFQPLLPVGLHDVPGKDCVKLYCACCEDLYIPKSSRHSAIDGAYFGTS 180
           EADFGRCPRVYCNFQPLLPVGLHDVPGKDCVKLYCACCEDLYIPKSSRHSAIDGAYFGTS
Sbjct: 121 EADFGRCPRVYCNFQPLLPVGLHDVPGKDCVKLYCACCEDLYIPKSSRHSAIDGAYFGTS 180

Query: 181 FPGMFLQAFPEMVPKHPVKRYVPKIFGFELHKQAQVARWQELQRMKLEISLREQGIDGG 239
           FPGMFLQAFPEMVPKHPVKRYVPKIFGFELHKQAQVARWQELQRMKLEISLREQGIDGG
Sbjct: 181 FPGMFLQAFPEMVPKHPVKRYVPKIFGFELHKQAQVARWQELQRMKLEISLREQGIDGG 239

>Sklu_1979.2 YOR039W, Contig c1979 3847-4668 reverse complement
          Length = 273

 Score =  417 bits (1072), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 197/244 (80%), Positives = 219/244 (89%), Gaps = 9/244 (3%)

Query: 3   DVEMVE-------ARPDTA--EGSDSSEYAEFWIDLFLGRKGHEYFCDIDTEYITDRFNL 53
           DVEMV+        R D A  + +DSSEY EFWIDLFLGRKGHEYFCD+DT+YITDRFNL
Sbjct: 21  DVEMVDVEHQGQGTRVDEANHDTTDSSEYVEFWIDLFLGRKGHEYFCDVDTDYITDRFNL 80

Query: 54  INLQKSVNKFTQVIQYMVDELDDGILEQMSSTRLEQLEHDARKLYGLIHARYVITIKGLQ 113
           INLQK+V++FTQVIQY+VDELDD  LEQMS +RLEQLE DARKLYGLIHARY+IT+KGLQ
Sbjct: 81  INLQKTVSRFTQVIQYIVDELDDTALEQMSRSRLEQLESDARKLYGLIHARYIITVKGLQ 140

Query: 114 KMLQKYKEADFGRCPRVYCNFQPLLPVGLHDVPGKDCVKLYCACCEDLYIPKSSRHSAID 173
           KMLQKY++ADFGRCPRVYCNFQ LLPVGLHDVPG DCVKLYC  CEDLYIPKSSRHS+ID
Sbjct: 141 KMLQKYRDADFGRCPRVYCNFQALLPVGLHDVPGIDCVKLYCPSCEDLYIPKSSRHSSID 200

Query: 174 GAYFGTSFPGMFLQAFPEMVPKHPVKRYVPKIFGFELHKQAQVARWQELQRMKLEISLRE 233
           GAYFGTSFPGMFLQAFPEMVPKHPVKRYVP+IFGFELHKQAQ+ARWQELQR+KLE  L +
Sbjct: 201 GAYFGTSFPGMFLQAFPEMVPKHPVKRYVPRIFGFELHKQAQLARWQELQRLKLESQLDK 260

Query: 234 QGID 237
           +G++
Sbjct: 261 EGVE 264

>ACR087C [1134] [Homologous to ScYOR039W (CKB2) - SH]
           (514602..515375) [774 bp, 257 aa]
          Length = 257

 Score =  409 bits (1051), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 191/236 (80%), Positives = 212/236 (89%), Gaps = 2/236 (0%)

Query: 2   ADVEMVEARPDTAEGSDSSEYAEFWIDLFLGRKGHEYFCDIDTEYITDRFNLINLQKSVN 61
           ADVEM +A    + GS  S+Y E WIDLFLG+KGHEYFCD+DTEYITDRFNLINLQK+V+
Sbjct: 15  ADVEMADAVETNSTGS--SDYVELWIDLFLGKKGHEYFCDVDTEYITDRFNLINLQKTVS 72

Query: 62  KFTQVIQYMVDELDDGILEQMSSTRLEQLEHDARKLYGLIHARYVITIKGLQKMLQKYKE 121
           KFTQVIQYMVDELDD  LE MS T+L QLE DARKLYGLIHARY+ITIKGLQKMLQKY++
Sbjct: 73  KFTQVIQYMVDELDDTTLEAMSRTKLTQLEADARKLYGLIHARYIITIKGLQKMLQKYRD 132

Query: 122 ADFGRCPRVYCNFQPLLPVGLHDVPGKDCVKLYCACCEDLYIPKSSRHSAIDGAYFGTSF 181
           ADF RCPRV+CNFQPLLPVGLHDVPG DCVKLYC  CEDLYIPKSSRHS+IDGAYFGTSF
Sbjct: 133 ADFCRCPRVHCNFQPLLPVGLHDVPGIDCVKLYCPSCEDLYIPKSSRHSSIDGAYFGTSF 192

Query: 182 PGMFLQAFPEMVPKHPVKRYVPKIFGFELHKQAQVARWQELQRMKLEISLREQGID 237
           PGMFLQAFPE+VPKHP KRYVPK+FGF+LHKQAQ+ARWQELQR+KLE  L ++G+D
Sbjct: 193 PGMFLQAFPEVVPKHPTKRYVPKVFGFDLHKQAQLARWQELQRLKLERELIKKGVD 248

>KLLA0E21967g 1951763..1952545 similar to sp|P38930 Saccharomyces
           cerevisiae YOR039w CKB2 casein kinase II beta chain,
           start by similarity
          Length = 260

 Score =  395 bits (1014), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 185/237 (78%), Positives = 205/237 (86%), Gaps = 3/237 (1%)

Query: 1   MADVEMVEARPDTAEGSDSSEYAEFWIDLFLGRKGHEYFCDIDTEYITDRFNLINLQKSV 60
           MAD  +V    D  +GSDS EY E+WIDLFLG+KGHEYFCDIDTEYITDRFNLINLQK+V
Sbjct: 18  MADALVVN---DQDDGSDSGEYVEYWIDLFLGKKGHEYFCDIDTEYITDRFNLINLQKTV 74

Query: 61  NKFTQVIQYMVDELDDGILEQMSSTRLEQLEHDARKLYGLIHARYVITIKGLQKMLQKYK 120
           +KFT V+QYMVD+L++GI+E MS  RLEQLE D RKLYGLIHARY+IT KGLQKMLQKYK
Sbjct: 75  SKFTTVVQYMVDDLEEGIIESMSPARLEQLETDTRKLYGLIHARYIITAKGLQKMLQKYK 134

Query: 121 EADFGRCPRVYCNFQPLLPVGLHDVPGKDCVKLYCACCEDLYIPKSSRHSAIDGAYFGTS 180
            ADFGRCPR +CN QPLLPVGLHD+PG DCVKLYC  CEDLY PKSSRHSAIDGAYFGTS
Sbjct: 135 AADFGRCPRYHCNHQPLLPVGLHDIPGIDCVKLYCPSCEDLYNPKSSRHSAIDGAYFGTS 194

Query: 181 FPGMFLQAFPEMVPKHPVKRYVPKIFGFELHKQAQVARWQELQRMKLEISLREQGID 237
           FPGMFLQ FPEM PKHP KRYVPK+FGF+LHKQAQ+ RWQELQR+KLE  L  +GI+
Sbjct: 195 FPGMFLQGFPEMCPKHPTKRYVPKVFGFDLHKQAQLTRWQELQRLKLEKLLITKGIN 251

>CAGL0I00946g complement(76974..77753) highly similar to sp|P38930
           Saccharomyces cerevisiae YOR039w CKB2 casein kinase II
           beta chain, start by similarity
          Length = 259

 Score =  394 bits (1012), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 179/223 (80%), Positives = 200/223 (89%)

Query: 15  EGSDSSEYAEFWIDLFLGRKGHEYFCDIDTEYITDRFNLINLQKSVNKFTQVIQYMVDEL 74
           + +DSSEYA+ WIDLFLGRKGHEYFCD+D EYITDRFNLINLQK+V+KF+QV+QY+VDEL
Sbjct: 28  DATDSSEYAQMWIDLFLGRKGHEYFCDVDPEYITDRFNLINLQKTVSKFSQVVQYIVDEL 87

Query: 75  DDGILEQMSSTRLEQLEHDARKLYGLIHARYVITIKGLQKMLQKYKEADFGRCPRVYCNF 134
           DD I+E MS  RLEQLE+DARK YGLIHARY+IT+KGLQKML KYK+ADFGRC RVYCNF
Sbjct: 88  DDSIVENMSKARLEQLENDARKFYGLIHARYIITVKGLQKMLSKYKDADFGRCSRVYCNF 147

Query: 135 QPLLPVGLHDVPGKDCVKLYCACCEDLYIPKSSRHSAIDGAYFGTSFPGMFLQAFPEMVP 194
           QPLLPVGLHDVPG D VKLYC  CEDLY PKSSRHS+IDGAYFGTSFPGMFLQAFP+MVP
Sbjct: 148 QPLLPVGLHDVPGIDSVKLYCPSCEDLYNPKSSRHSSIDGAYFGTSFPGMFLQAFPDMVP 207

Query: 195 KHPVKRYVPKIFGFELHKQAQVARWQELQRMKLEISLREQGID 237
           KHP  RYVPKIFGFELHKQAQ+ RWQELQR+KL   L+ + +D
Sbjct: 208 KHPTARYVPKIFGFELHKQAQLTRWQELQRLKLVKRLQAKEVD 250

>Scas_699.43
          Length = 256

 Score =  385 bits (988), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 174/211 (82%), Positives = 194/211 (91%)

Query: 14  AEGSDSSEYAEFWIDLFLGRKGHEYFCDIDTEYITDRFNLINLQKSVNKFTQVIQYMVDE 73
            E +DSSEY + WIDLFLG+KGHEYFCDID +YITDRFNLINLQK+V+KF+QV+QY+VDE
Sbjct: 24  GEVTDSSEYVDEWIDLFLGKKGHEYFCDIDPDYITDRFNLINLQKTVSKFSQVVQYIVDE 83

Query: 74  LDDGILEQMSSTRLEQLEHDARKLYGLIHARYVITIKGLQKMLQKYKEADFGRCPRVYCN 133
           LD+ ILE MS+ RLEQLE+DARK YGLIHARY+IT+KGLQKML K+K+ADFGRCPRVYCN
Sbjct: 84  LDESILETMSNARLEQLENDARKFYGLIHARYIITVKGLQKMLDKFKDADFGRCPRVYCN 143

Query: 134 FQPLLPVGLHDVPGKDCVKLYCACCEDLYIPKSSRHSAIDGAYFGTSFPGMFLQAFPEMV 193
           +QPLLPVGLHD PG DCVKLYCA CEDLYIPKS RHS IDGA+FGTSFPGMFLQAFPEMV
Sbjct: 144 YQPLLPVGLHDTPGMDCVKLYCASCEDLYIPKSMRHSCIDGAFFGTSFPGMFLQAFPEMV 203

Query: 194 PKHPVKRYVPKIFGFELHKQAQVARWQELQR 224
           PKHP K+YVPKIFGFELHKQAQ+ARWQE QR
Sbjct: 204 PKHPTKKYVPKIFGFELHKQAQLARWQEFQR 234

>YOR039W (CKB2) [4851] chr15 (405767..406543) Casein kinase II
           Protein kinase CK2, regulatory (beta-prime) subunit [777
           bp, 258 aa]
          Length = 258

 Score =  382 bits (981), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 174/217 (80%), Positives = 193/217 (88%)

Query: 21  EYAEFWIDLFLGRKGHEYFCDIDTEYITDRFNLINLQKSVNKFTQVIQYMVDELDDGILE 80
           EY + WIDLFLGRKGHEYFCD+D EYITDRFNL+NLQK+V+KF+ V+QY+VD+LDD ILE
Sbjct: 33  EYVDMWIDLFLGRKGHEYFCDVDPEYITDRFNLMNLQKTVSKFSYVVQYIVDDLDDSILE 92

Query: 81  QMSSTRLEQLEHDARKLYGLIHARYVITIKGLQKMLQKYKEADFGRCPRVYCNFQPLLPV 140
            M+  RLEQLE D+RKLYGLIHARY+ITIKGLQKM  KYKEADFGRCPRVYCN Q LLPV
Sbjct: 93  NMTHARLEQLESDSRKLYGLIHARYIITIKGLQKMYAKYKEADFGRCPRVYCNLQQLLPV 152

Query: 141 GLHDVPGKDCVKLYCACCEDLYIPKSSRHSAIDGAYFGTSFPGMFLQAFPEMVPKHPVKR 200
           GLHD+PG DCVKLYC  CEDLYIPKSSRHS+IDGAYFGTSFPGMFLQAFP+MVPKHP KR
Sbjct: 153 GLHDIPGIDCVKLYCPSCEDLYIPKSSRHSSIDGAYFGTSFPGMFLQAFPDMVPKHPTKR 212

Query: 201 YVPKIFGFELHKQAQVARWQELQRMKLEISLREQGID 237
           YVPKIFGFELHKQAQ+ RWQELQR+KL   L  + +D
Sbjct: 213 YVPKIFGFELHKQAQLTRWQELQRLKLVEKLESKDVD 249

>KLLA0A04818g 429275..430108 similar to sp|P43639 Saccharomyces
           cerevisiae YGL019w CKB1 casein kinase II, beta subunit,
           start by similarity
          Length = 277

 Score =  181 bits (460), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 100/253 (39%), Positives = 138/253 (54%), Gaps = 43/253 (16%)

Query: 13  TAEGSDSSEYAEFWIDLFLGRKGHEYFCDIDTEYITDRFNLINLQKSVNKFTQVIQYMVD 72
           + + SDS  Y E WI  F  R GHEYFC + T++I D FNL  L + V  + + +  ++D
Sbjct: 7   SNDSSDSGNYEE-WIPTFCSRFGHEYFCQVPTDFIEDDFNLTGLSQEVAYYRKALDTILD 65

Query: 73  ELDDGILEQMSSTRLEQ-------------------LEHDARKLYGLIHARYVITIKGLQ 113
                 LE  S    E+                   +EH A +LYGLIHAR+++T  GLQ
Sbjct: 66  ------LESTSDEEEEKNDASSNSKKDNDAHVTRSIVEHSAEQLYGLIHARFILTKAGLQ 119

Query: 114 KMLQKYKEADFGRCPRVYCNFQPLLPVGLHDVPGKDCVKLYCACCEDLYIPKSSRHSAID 173
            M +K+   +FG CPR +C    LLP GL D  GK  V+LYC  C+DLYIP+SSRH +++
Sbjct: 120 AMAEKFDRKEFGTCPRYHCGSIQLLPCGLSDTLGKQTVRLYCPSCQDLYIPQSSRHLSLE 179

Query: 174 GAYFGTSFPGMFLQAFPEM---VPKHPVKRYVPKIFGFELHKQAQVA------------- 217
           GAY+GTSFPG+FL+ F E+   V K   + Y  KIFGF + K+A                
Sbjct: 180 GAYWGTSFPGVFLKHFKELEDYVEKKNKETYELKIFGFSIAKEAICGPRMQWLRQYPKTD 239

Query: 218 -RWQELQRMKLEI 229
             W+E ++ + EI
Sbjct: 240 EEWEEFKKCEFEI 252

>CAGL0A00275g 29069..29869 highly similar to sp|P43639 Saccharomyces
           cerevisiae YGL019w CKB1, hypothetical start
          Length = 266

 Score =  176 bits (447), Expect = 9e-55,   Method: Compositional matrix adjust.
 Identities = 97/267 (36%), Positives = 142/267 (53%), Gaps = 40/267 (14%)

Query: 6   MVEARPDTAEGSDSSEYAEFWIDLFLGRKGHEYFCDIDTEYITDRFNLINLQKSVNKFTQ 65
           M E   D +   DS  Y E WI  F  R GHEYFC + T++I D FN+ +L + V  + +
Sbjct: 1   MSEYMEDNSHSDDSGTYDE-WIPSFCSRFGHEYFCQVPTDFIEDDFNMTSLAQEVPHYRK 59

Query: 66  VIQYMVD--------ELD--------------DGILEQMSSTRLEQLEHDARKLYGLIHA 103
            +  ++D        ++D              +G +   +      + H A +LYGLIHA
Sbjct: 60  ALDLILDLEMVSDEEDMDEKESGAESSSGANNNGGVNSKALVNRNIIGHAAEQLYGLIHA 119

Query: 104 RYVITIKGLQKMLQKYKEADFGRCPRVYCNFQPLLPVGLHDVPGKDCVKLYCACCEDLYI 163
           RY++T  GLQ M +K+   DFG CPR +C+   LLP GL D  GK  V+LYC  C+DLY+
Sbjct: 120 RYILTKPGLQAMAEKFDHKDFGTCPRYFCHGMQLLPCGLSDTIGKQAVRLYCPSCQDLYL 179

Query: 164 PKSSRHSAIDGAYFGTSFPGMFLQAFPEM---VPKHPVKRYVPKIFGFELHKQAQVA--- 217
           P+SSRH  ++GAY+GTSFPG+FL+ F E+   V +   + Y  K+FGF ++ QA      
Sbjct: 180 PQSSRHLCLEGAYWGTSFPGVFLKHFKELEEYVERKNKESYELKVFGFRINDQAVSGPRM 239

Query: 218 -----------RWQELQRMKLEISLRE 233
                       W+E  + + E+ + E
Sbjct: 240 KWLRQYPVTEEDWEEFNKCEFEMPIVE 266

>AGR163W [4474] [Homologous to ScYGL019W (CKB1) - SH]
           complement(1052587..1053414) [828 bp, 275 aa]
          Length = 275

 Score =  174 bits (442), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 100/264 (37%), Positives = 144/264 (54%), Gaps = 47/264 (17%)

Query: 12  DTAEGSDSSEYAEFWIDLFLGRKGHEYFCDIDTEYITDRFNLINLQKSVNKFTQVIQYMV 71
           D ++ S+SS Y E WI  F  R GHE+FC + TE+I D FNL  L   V  + + +  ++
Sbjct: 6   DVSDVSESSNYDE-WITSFCSRFGHEFFCQVPTEFIEDDFNLTGLSAEVPHYRRALDLIL 64

Query: 72  D-----ELDDGIL-----------EQMSSTRLEQ-------------LEHDARKLYGLIH 102
           D     E D+  +           +  + T + Q             ++H A +LYGLIH
Sbjct: 65  DLESLSEEDEDGVAASAGAASNGGDHSNGTSVRQAAHADGQPINKSIIDHCAEQLYGLIH 124

Query: 103 ARYVITIKGLQKMLQKYKEADFGRCPRVYCNFQPLLPVGLHDVPGKDCVKLYCACCEDLY 162
           ARY++T +GLQ M +K+   +FG CPR YC    LLP GL D  GK+ V+LYCA C+DLY
Sbjct: 125 ARYILTKQGLQAMAEKFDHKEFGTCPRYYCGGMQLLPCGLSDTLGKNTVRLYCASCQDLY 184

Query: 163 IPKSSRHSAIDGAYFGTSFPGMFLQAFPEM---VPKHPVKRYVPKIFGFELHKQ------ 213
           +P SSRH  ++GA++GTSFPG+FL+ F E+   V +     Y  +IFGF + K+      
Sbjct: 185 LPHSSRHLCLEGAFWGTSFPGVFLKHFKELEDYVEQKNKNVYRLRIFGFPVAKESISGPR 244

Query: 214 --------AQVARWQELQRMKLEI 229
                   +  A WQE ++ + EI
Sbjct: 245 MEWLRQYPSTEAEWQEFEKCEYEI 268

>Kwal_47.17449
          Length = 250

 Score =  172 bits (437), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 98/245 (40%), Positives = 134/245 (54%), Gaps = 24/245 (9%)

Query: 6   MVEARPDTAEGSDSSEYAEF--WIDLFLGRKGHEYFCDIDTEYITDRFNLINLQKSVNKF 63
           M E   D +    S E   F  WI  F  R GHEYFC + TE+I D FN+  L + V  +
Sbjct: 1   MSEYVGDNSRSGSSDESGTFDEWIPSFCARFGHEYFCQVPTEFIEDDFNMTGLGQEVPHY 60

Query: 64  TQVIQYMVDELDDGILEQMSSTRLEQ---------LEHDARKLYGLIHARYVITIKGLQK 114
            + +  ++D      LE MS    +          +EH A +LYGL+HARY++T  GLQ 
Sbjct: 61  RKALDLVLD------LEAMSDEEGQDSEEPVSRSIVEHAAEQLYGLVHARYILTKPGLQA 114

Query: 115 MLQKYKEADFGRCPRVYCNFQPLLPVGLHDVPGKDCVKLYCACCEDLYIPKSSRHSAIDG 174
           M +K+   +FG CPR YC    +LP GL D  GK  V+LYC  C+DLY+P+SSRH  ++G
Sbjct: 115 MAEKFDHKEFGTCPRYYCAGMQMLPCGLTDTLGKLTVRLYCPSCQDLYLPQSSRHLCLEG 174

Query: 175 AYFGTSFPGMFLQAFPEM---VPKHPVKRYVPKIFGFELHKQAQVA---RWQELQRMKLE 228
           A++GTSFPG+FL+ F E+   V +     Y  ++FGF +  +A      RW   Q  K  
Sbjct: 175 AFWGTSFPGVFLKHFKELEDYVDRKSKDTYELRVFGFRIASEAPSGARMRWLR-QHPKTP 233

Query: 229 ISLRE 233
             LRE
Sbjct: 234 QELRE 238

>Sklu_1768.4 YGL019W, Contig c1768 4317-5306 reverse complement
          Length = 329

 Score =  174 bits (441), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 92/234 (39%), Positives = 133/234 (56%), Gaps = 30/234 (12%)

Query: 26  WIDLFLGRKGHEYFCDIDTEYITDRFNLINLQKSVNKFTQVIQYMVD----------ELD 75
           WI  F  R GHEYFC + TE+I D FN+  L + +  + + +  ++D          + +
Sbjct: 92  WIPSFCSRFGHEYFCQVPTEFIEDDFNMTGLSQEIPHYRKALDLILDLEAMSDEDDEDDN 151

Query: 76  DGILEQMSS---TRLEQLEHDARKLYGLIHARYVITIKGLQKMLQKYKEADFGRCPRVYC 132
           DG  E+  S        +EH A +LYGLIHARY++T  GLQ M +K+   +FG CPR YC
Sbjct: 152 DGAAEEDGSGEPVNRSIMEHAAEQLYGLIHARYILTKPGLQSMAEKFDHKEFGTCPRYYC 211

Query: 133 NFQPLLPVGLHDVPGKDCVKLYCACCEDLYIPKSSRHSAIDGAYFGTSFPGMFLQAFPEM 192
               +LP GL D  GK  V+LYC  C+DLY+P+SSRH  +DGA++GTSFPG+FL+ F E+
Sbjct: 212 GGMQMLPCGLSDTLGKQTVRLYCPSCQDLYLPQSSRHLCMDGAFWGTSFPGVFLKHFKEL 271

Query: 193 ---VPKHPVKRYVPKIFGFELHKQ--------------AQVARWQELQRMKLEI 229
              V +     Y  K+FGF+++ +              A  A W+E ++ + EI
Sbjct: 272 EDYVERKSKDVYELKVFGFKINGEAVSGPRMKWLRQYPATEAEWEEFEKCEFEI 325

>Scas_638.7
          Length = 270

 Score =  172 bits (435), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 92/233 (39%), Positives = 133/233 (57%), Gaps = 30/233 (12%)

Query: 18  DSSEYAEFWIDLFLGRKGHEYFCDIDTEYITDRFNLINLQKSVNKFTQVIQYMVD----- 72
           DS  Y E WI  F  R GHEYFC++ TE+I D FNL +L + V  + + +  ++D     
Sbjct: 18  DSGNYEE-WIPSFCARFGHEYFCEVPTEFIEDDFNLTSLSQEVPHYRKALDLILDLEAIS 76

Query: 73  ----------------ELDDGILEQMSSTRLEQLEHDARKLYGLIHARYVITIKGLQKML 116
                           + D+ + ++  +     +EH A +LYGLIHARY++T  GLQ M 
Sbjct: 77  EEEEEEDEDMVGANNGQTDELVKKKAQAVNRSIIEHAAEQLYGLIHARYILTKPGLQAMA 136

Query: 117 QKYKEADFGRCPRVYCNFQPLLPVGLHDVPGKDCVKLYCACCEDLYIPKSSRHSAIDGAY 176
           +K+   +FG CPR +C    LLP GL D  GK  V+LYC  C+DLY+P+SSR   ++GA+
Sbjct: 137 EKFDHKEFGTCPRYHCGGMQLLPCGLSDTIGKYTVRLYCPSCQDLYLPQSSRFLCLEGAF 196

Query: 177 FGTSFPGMFLQAFPEM---VPKHPVKRYVPKIFGFELHKQAQVARWQELQRMK 226
           +GTSFPG+FL+ F E+   V +     Y  K+FGF+++ +A        QRMK
Sbjct: 197 WGTSFPGVFLKHFKELEDYVGRKTKNSYELKVFGFKINDRAVSG-----QRMK 244

>YGL019W (CKB1) [1954] chr7 (458159..458995) Casein kinase II
           (Protein kinase CK2), regulatory (beta) subunit [837 bp,
           278 aa]
          Length = 278

 Score =  169 bits (429), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 94/244 (38%), Positives = 136/244 (55%), Gaps = 35/244 (14%)

Query: 5   EMVE--ARPDTAEGSDSSEYAEFWIDLFLGRKGHEYFCDIDTEYITDRFNLINLQKSVNK 62
           E VE  +R  +++  DS  Y E WI  F  R GHEYFC + TE+I D FN+ +L + V  
Sbjct: 4   EFVEDYSRTGSSDDEDSGAYDE-WIPSFCSRFGHEYFCQVPTEFIEDDFNMTSLSQEVPH 62

Query: 63  FTQVIQYMVD------------------------ELDDGILEQMSSTRL-----EQLEHD 93
           + + +  ++D                        + +DG  E     +        +EH 
Sbjct: 63  YRKALDLILDLEAMSDEEEDEDDVVEEDEVDQEMQSNDGHDEGKRRNKSPVVNKSIIEHA 122

Query: 94  ARKLYGLIHARYVITIKGLQKMLQKYKEADFGRCPRVYCNFQPLLPVGLHDVPGKDCVKL 153
           A +LYGLIHAR+++T  GLQ M +K+   +FG CPR YCN   LLP GL D  GK  V+L
Sbjct: 123 AEQLYGLIHARFILTKPGLQAMAEKFDHKEFGTCPRYYCNGMQLLPCGLSDTVGKHTVRL 182

Query: 154 YCACCEDLYIPKSSRHSAIDGAYFGTSFPGMFLQAFPEM---VPKHPVKRYVPKIFGFEL 210
           YC  C+DLY+P+SSR   ++GA++GTSFPG+FL+ F E+   V +   + Y  K+FGF +
Sbjct: 183 YCPSCQDLYLPQSSRFLCLEGAFWGTSFPGVFLKHFKELEEYVERKSKESYELKVFGFRI 242

Query: 211 HKQA 214
           + +A
Sbjct: 243 NDEA 246

>KLLA0B05555g complement(494997..500990) similar to sp|Q00416
            Saccharomyces cerevisiae YLR430w SEN1 positive effector
            of tRNA-splicing endonuclease, start by similarity
          Length = 1997

 Score = 28.1 bits (61), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 2/44 (4%)

Query: 19   SSEYAEFWIDLFLGRKGHEYFCDIDTEYITDRFNLINLQKSVNK 62
            S  YA+  I+ F G   H+Y  ++DT    D FN     K+VNK
Sbjct: 1858 SDRYAQDTIERFKG--SHDYIANLDTYNPYDSFNSSRGHKNVNK 1899

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.323    0.140    0.432 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,845,167
Number of extensions: 336109
Number of successful extensions: 786
Number of sequences better than 10.0: 17
Number of HSP's gapped: 779
Number of HSP's successfully gapped: 17
Length of query: 239
Length of database: 16,596,109
Length adjustment: 99
Effective length of query: 140
Effective length of database: 13,168,927
Effective search space: 1843649780
Effective search space used: 1843649780
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 60 (27.7 bits)