Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_55.2156687386146170.0
Sklu_1979.384784425950.0
ACR088W85084724320.0
YOR038C (HIR2)87587820690.0
KLLA0E21945g84785519450.0
Scas_699.4288589118560.0
CAGL0I00968g99746313181e-167
Scas_702.168162042181e-17
YBL008W (HIR1)8402162054e-16
KLLA0A04928g8612062036e-16
AGR168W8253622028e-16
Kwal_47.174658002371732e-12
CAGL0E02805g8402081643e-11
YML102W (CAC2)4681051258e-07
Kwal_27.10385536199920.007
KLLA0E11143g49391910.010
Sklu_2109.465894870.036
AER280C51091820.11
CAGL0I09922g50182790.30
Scas_512.3534101770.51
KLLA0D11748g793148731.5
Scas_585.8460115722.0
YJL141C (YAK1)80765722.2
Sklu_2339.2196682722.3
CAGL0I05896g77858712.5
KLLA0A01650g401122702.7
ADR090W123354713.1
Scas_651.379358703.1
Kwal_47.1756759049685.7
KLLA0D13838g51283677.6
Scas_678.22*86070677.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_55.21566
         (861 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_55.21566                                                        1783   0.0  
Sklu_1979.3 YOR038C, Contig c1979 4836-7379                          1004   0.0  
ACR088W [1135] [Homologous to ScYOR038C (HIR2) - SH] complement(...   941   0.0  
YOR038C (HIR2) [4850] chr15 complement(402760..405387) Histone t...   801   0.0  
KLLA0E21945g complement(1948687..1951230) similar to sp|P32480 S...   753   0.0  
Scas_699.42                                                           719   0.0  
CAGL0I00968g 78375..81368 similar to sp|P32480 Saccharomyces cer...   512   e-167
Scas_702.16                                                            89   1e-17
YBL008W (HIR1) [186] chr2 (209618..212140) Histone transcription...    84   4e-16
KLLA0A04928g 439349..441934 similar to sp|P32479 Saccharomyces c...    83   6e-16
AGR168W [4479] [Homologous to ScYBL008W (HIR1) - SH] complement(...    82   8e-16
Kwal_47.17465                                                          71   2e-12
CAGL0E02805g complement(265137..267659) similar to sp|P32479 Sac...    68   3e-11
YML102W (CAC2) [3869] chr13 (68294..69700) Chromatin assembly co...    53   8e-07
Kwal_27.10385                                                          40   0.007
KLLA0E11143g 983669..985150 similar to sp|Q04199 Saccharomyces c...    40   0.010
Sklu_2109.4 YOR254C, Contig c2109 4786-6762                            38   0.036
AER280C [2782] [Homologous to ScYML102W (CAC2) - SH] (1148956..1...    36   0.11 
CAGL0I09922g complement(947512..949017) similar to tr|Q12096 Sac...    35   0.30 
Scas_512.3                                                             34   0.51 
KLLA0D11748g 1000988..1003369 similar to sp|Q03308 Saccharomyces...    33   1.5  
Scas_585.8                                                             32   2.0  
YJL141C (YAK1) [2777] chr10 complement(147885..150308) Serine/th...    32   2.2  
Sklu_2339.2 YLR422W, Contig c2339 3447-9347                            32   2.3  
CAGL0I05896g 560169..562505 some similarities with sp|P14680 Sac...    32   2.5  
KLLA0A01650g complement(146030..147235) similar to sp|Q02793 Sac...    32   2.7  
ADR090W [1831] [Homologous to ScYDL195W (SEC31) - SH] complement...    32   3.1  
Scas_651.3                                                             32   3.1  
Kwal_47.17567                                                          31   5.7  
KLLA0D13838g complement(1189057..1190595) similar to sp|P40560 S...    30   7.6  
Scas_678.22*                                                           30   7.9  

>Kwal_55.21566
          Length = 873

 Score = 1783 bits (4617), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 861/861 (100%), Positives = 861/861 (100%)

Query: 1   MIKIFLTLYIFNRIGNNQRTKSTRMKLLKYPRALHSGKIVGCACIGDNLVTAGQDSVCVW 60
           MIKIFLTLYIFNRIGNNQRTKSTRMKLLKYPRALHSGKIVGCACIGDNLVTAGQDSVCVW
Sbjct: 1   MIKIFLTLYIFNRIGNNQRTKSTRMKLLKYPRALHSGKIVGCACIGDNLVTAGQDSVCVW 60

Query: 61  SCSQLVGAAMGNISAKEVREKFEIKVLEARLEPLRLVVGSDACLYVGTDRTVLYADSLLE 120
           SCSQLVGAAMGNISAKEVREKFEIKVLEARLEPLRLVVGSDACLYVGTDRTVLYADSLLE
Sbjct: 61  SCSQLVGAAMGNISAKEVREKFEIKVLEARLEPLRLVVGSDACLYVGTDRTVLYADSLLE 120

Query: 121 KGEKTSFQTLYHVEAPACVTDVKFDFQTGTIFVLVNQGNEGNYVALLDAAGGGAQVGQIS 180
           KGEKTSFQTLYHVEAPACVTDVKFDFQTGTIFVLVNQGNEGNYVALLDAAGGGAQVGQIS
Sbjct: 121 KGEKTSFQTLYHVEAPACVTDVKFDFQTGTIFVLVNQGNEGNYVALLDAAGGGAQVGQIS 180

Query: 181 LGASKPITGVVDPAGQIFTVICADRNVSVFQYGAGGSHKLLHRLNHYLQVDPLRYSISMS 240
           LGASKPITGVVDPAGQIFTVICADRNVSVFQYGAGGSHKLLHRLNHYLQVDPLRYSISMS
Sbjct: 181 LGASKPITGVVDPAGQIFTVICADRNVSVFQYGAGGSHKLLHRLNHYLQVDPLRYSISMS 240

Query: 241 PQADTLPLLNSMSGSTPAILLLDRKSGFKLRATLVGHFDKCQICQFSPSLYEKVQKSGTK 300
           PQADTLPLLNSMSGSTPAILLLDRKSGFKLRATLVGHFDKCQICQFSPSLYEKVQKSGTK
Sbjct: 241 PQADTLPLLNSMSGSTPAILLLDRKSGFKLRATLVGHFDKCQICQFSPSLYEKVQKSGTK 300

Query: 301 VTYNLAATSGFDTGSVVIWNTKRLKPLLNTKCTEDSFVTDLQWSDDGSTLFAVTNNGLLF 360
           VTYNLAATSGFDTGSVVIWNTKRLKPLLNTKCTEDSFVTDLQWSDDGSTLFAVTNNGLLF
Sbjct: 301 VTYNLAATSGFDTGSVVIWNTKRLKPLLNTKCTEDSFVTDLQWSDDGSTLFAVTNNGLLF 360

Query: 361 IFAFRDEELGKTLPKSHVDKLRSDCATLSPLPPTEVPDLNQTIKPEIVAPGSSGVITKVN 420
           IFAFRDEELGKTLPKSHVDKLRSDCATLSPLPPTEVPDLNQTIKPEIVAPGSSGVITKVN
Sbjct: 361 IFAFRDEELGKTLPKSHVDKLRSDCATLSPLPPTEVPDLNQTIKPEIVAPGSSGVITKVN 420

Query: 421 GKNKVAPTTIRSLSMEFIAPSYSVPKDLKRRPKDPLQATTNKKQKHDLEPMDFLDTSLLM 480
           GKNKVAPTTIRSLSMEFIAPSYSVPKDLKRRPKDPLQATTNKKQKHDLEPMDFLDTSLLM
Sbjct: 421 GKNKVAPTTIRSLSMEFIAPSYSVPKDLKRRPKDPLQATTNKKQKHDLEPMDFLDTSLLM 480

Query: 481 PTVSFSKVRLAAPKVRLSFTYYPSTSDSLAISVKNGSGNEQTPTVITLKLKESGQEKTIF 540
           PTVSFSKVRLAAPKVRLSFTYYPSTSDSLAISVKNGSGNEQTPTVITLKLKESGQEKTIF
Sbjct: 481 PTVSFSKVRLAAPKVRLSFTYYPSTSDSLAISVKNGSGNEQTPTVITLKLKESGQEKTIF 540

Query: 541 EDFLPKLITICTSGDNFWSCCSDDGTVYVYSDSGRKLLPPMIMGVPCSFLEACGNFLLCV 600
           EDFLPKLITICTSGDNFWSCCSDDGTVYVYSDSGRKLLPPMIMGVPCSFLEACGNFLLCV
Sbjct: 541 EDFLPKLITICTSGDNFWSCCSDDGTVYVYSDSGRKLLPPMIMGVPCSFLEACGNFLLCV 600

Query: 601 TSIGQVYCWNVDASRLLFPPTSLYPLLSPNLRFSDDVLTRAENITMCTLTASGVPIVTLS 660
           TSIGQVYCWNVDASRLLFPPTSLYPLLSPNLRFSDDVLTRAENITMCTLTASGVPIVTLS
Sbjct: 601 TSIGQVYCWNVDASRLLFPPTSLYPLLSPNLRFSDDVLTRAENITMCTLTASGVPIVTLS 660

Query: 661 NGDGYMYDKVMEVWMLINDSWWAYGSQYWDTTKTTTNGTYASEPNDKHDKKNQNWNSEAK 720
           NGDGYMYDKVMEVWMLINDSWWAYGSQYWDTTKTTTNGTYASEPNDKHDKKNQNWNSEAK
Sbjct: 661 NGDGYMYDKVMEVWMLINDSWWAYGSQYWDTTKTTTNGTYASEPNDKHDKKNQNWNSEAK 720

Query: 721 GLTESLKENKSSILNYLESRTNDELNRKGRVRNLQKFAKTILMKEGYENLEEVVTLSHLE 780
           GLTESLKENKSSILNYLESRTNDELNRKGRVRNLQKFAKTILMKEGYENLEEVVTLSHLE
Sbjct: 721 GLTESLKENKSSILNYLESRTNDELNRKGRVRNLQKFAKTILMKEGYENLEEVVTLSHLE 780

Query: 781 NKLLVSLRLHEYEEFTKLLTIYCIRLSEMGYKNRLDDVLQWLYDDGNYKAKSVAGVKAEE 840
           NKLLVSLRLHEYEEFTKLLTIYCIRLSEMGYKNRLDDVLQWLYDDGNYKAKSVAGVKAEE
Sbjct: 781 NKLLVSLRLHEYEEFTKLLTIYCIRLSEMGYKNRLDDVLQWLYDDGNYKAKSVAGVKAEE 840

Query: 841 LLRKILVACADIRHVQRVTTS 861
           LLRKILVACADIRHVQRVTTS
Sbjct: 841 LLRKILVACADIRHVQRVTTS 861

>Sklu_1979.3 YOR038C, Contig c1979 4836-7379
          Length = 847

 Score = 1004 bits (2595), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 477/844 (56%), Positives = 633/844 (75%), Gaps = 16/844 (1%)

Query: 25  MKLLKYPRALHSGKIVGCACIGDNLVTAGQDSVCVWSCSQLVGAAMGNISAKEVREKFEI 84
           MKLLKYP+ LH G +  CA I D LVT G + V VW   QL+  AMG  SA E+ E F  
Sbjct: 1   MKLLKYPKQLHDGNLGACAAIHDRLVTVGSERVSVWDTKQLLDTAMGKSSANELSELFSS 60

Query: 85  KVLEARLEPLRLVVGSDACLYVGTDRTVLYADSLLEKGEKTSFQTLYHVEAPACVTDVKF 144
           K      E L  V  +D  L+VGTD  + YADS LE  EK  F ++Y VE P+ +TD+K+
Sbjct: 61  KG-NFNNEKLCYVFATDKKLFVGTDHALFYADSWLETREKMVFHSIYRVEPPSTITDIKY 119

Query: 145 DFQTGTIFVLVNQGNEGNYVALLDAAGGGAQVGQISLGASKPITGVVDPAGQIFTVICAD 204
           D     +F+LV+  ++ N VA+L       ++ +I L  +KP+TG++DP GQIFT++ A 
Sbjct: 120 DPLNNILFILVSLTSKKN-VAILYEGRTCTRLAEILL-PTKPMTGIIDPMGQIFTIVGAA 177

Query: 205 RNVSVFQYGAGGSHKLLHRLNHYLQVDPLRYSISMSPQADTLPLLNSMSGSTPAILLLDR 264
           R++S++QY + GS+KL+H+L  Y+Q+DP+ Y+++MSP ADT+P++NS+  STP+++LLDR
Sbjct: 178 RSISIYQYNSKGSYKLVHQLPQYVQIDPVHYTVTMSPPADTIPIINSLRNSTPSVVLLDR 237

Query: 265 KSGFKLRATLVGHFDKCQICQFSPSLYEKVQKSGTKVTYNLAATSGFDTGSVVIWNTKRL 324
            + FK+  TLVG+  KC+I +FSP+LYEK  K+GT   YNL A+SG + GSV +WNTKR 
Sbjct: 238 NNEFKVSTTLVGYDSKCKILKFSPNLYEKTNKTGT-TRYNLLASSGNENGSVAVWNTKRA 296

Query: 325 KPLLNTKCTEDSFVTDLQWSDDGSTLFAVTNNGLLFIFAFRDEELGKTLPKSHVDKLRSD 384
           +PL N      +F+ DL W+DDG  LFAV+++G +++FAF+++ELG+ LP+    KL++ 
Sbjct: 297 RPLFNAAGIAKTFINDLVWNDDGMGLFAVSDDGYMYVFAFQEKELGQVLPQEETVKLQAS 356

Query: 385 CATLSPLPPTEVPDLNQTIKPEIVAPGSSGVITKVN-------GKNKVAPTTIRSLSMEF 437
              L PLP  E+   +  IKP+    G S V   +N       GK KV PTTI+S SMEF
Sbjct: 357 IKKLEPLPTEELKP-SHDIKPK--TSGGSSVNLSLNPTTVTKSGKKKVVPTTIQSTSMEF 413

Query: 438 IAPSYSVPKDLKRRPKDPLQATTNKKQKHDLEPMDFLDTSLLMPTVSFSKVRLAAPKVRL 497
             PSYSVPKDLKR+PKD       KKQK D++PMDFLDT++LMP +SFSK+RLA PK+R+
Sbjct: 414 NPPSYSVPKDLKRKPKDEETMVNGKKQKKDVDPMDFLDTNILMPNISFSKLRLATPKIRV 473

Query: 498 SFTYYPSTSDSLAISVKNGSGNEQTPTVITLKLKESGQEKTIFEDFLPKLITICTSGDNF 557
           SF Y P  + +L   VKNG+GNEQ PT I+L LKE  Q++ IF+DF+PK +T+ ++G++F
Sbjct: 474 SFQYSPVHNKNLIFDVKNGTGNEQKPTSISLLLKEPEQDRMIFQDFIPKFVTLSSAGESF 533

Query: 558 WSCCSDDGTVYVYSDSGRKLLPPMIMGVPCSFLEACGNFLLCVTSIGQVYCWNVDASRLL 617
           W+CC++DGT+YVYSD+G++LLPPMIMGVPCSFLEACG +LLCVTS+GQ+YCW++D  RL 
Sbjct: 534 WACCTEDGTLYVYSDTGKRLLPPMIMGVPCSFLEACGKYLLCVTSMGQLYCWDIDCKRLK 593

Query: 618 FPPTSLYPLLSPNLRFSDDVLTRAENITMCTLTASGVPIVTLSNGDGYMYDKVMEVWMLI 677
           FP  ++YPLL+P LR+SDD+LTRAENITMCT+T +GVP++TLSNGDGYM+D  ME W+LI
Sbjct: 594 FPVNTVYPLLNPVLRYSDDILTRAENITMCTITKNGVPLLTLSNGDGYMFDCDMETWLLI 653

Query: 678 NDSWWAYGSQYWDTTKTTTNGTYASEPNDKHDKKNQNWNSEAKGLTESLKENKSSILNYL 737
           +DSWWAYGSQYWD   T TNG   +  +DK DKKN+ WN EA+ L  +++ NKSSI+NYL
Sbjct: 654 SDSWWAYGSQYWDM--TNTNGVVVTTGSDKDDKKNRYWNPEAENLVSNVRSNKSSIVNYL 711

Query: 738 ESRTNDELNRKGRVRNLQKFAKTILMKEGYENLEEVVTLSHLENKLLVSLRLHEYEEFTK 797
           ES+TNDEL+RKGR+RNLQKFAKTILMKEG+ENLE++VTLSHLEN++LVSL+L E +EFT+
Sbjct: 712 ESKTNDELSRKGRIRNLQKFAKTILMKEGFENLEDIVTLSHLENRVLVSLKLGEDQEFTR 771

Query: 798 LLTIYCIRLSEMGYKNRLDDVLQWLYDDGNYKAKSVAGVKAEELLRKILVACADIRHVQR 857
           LL +YCIRL EMGYKNRL+DVLQWLY++GNYK + +AG   EELL++ILVACADIR VQR
Sbjct: 772 LLIVYCIRLGEMGYKNRLNDVLQWLYNNGNYKMEKIAGTTREELLKQILVACADIRQVQR 831

Query: 858 VTTS 861
           VT S
Sbjct: 832 VTVS 835

>ACR088W [1135] [Homologous to ScYOR038C (HIR2) - SH]
           complement(515561..518113) [2553 bp, 850 aa]
          Length = 850

 Score =  941 bits (2432), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 461/847 (54%), Positives = 610/847 (72%), Gaps = 19/847 (2%)

Query: 25  MKLLKYPRALHSGKIVGCACIGDNLVTAGQDSVCVWSCSQLVGAAMGNISAKEVREKFEI 84
           MKLLKYPR LH G+++    +G  LV  G+D +  + C +L  AA G ++ +EV  + E+
Sbjct: 1   MKLLKYPRQLHDGQLLAGCVVGGLLVVVGRDRISAYDCGKLQAAARGELAVREVSAEVEL 60

Query: 85  KVLEARLEPLRLVVGSDACLYVGTDRTVLYADS-LLEKGEKTSFQTLYHVEAPACVTDVK 143
           +V E   + LR V G +  L V  DR +  A +     G  T F T+  +   ACVTDVK
Sbjct: 61  QV-EVGEDALRYVAGGEGELVVAGDRQIWAAGADWRSAGRGTRFLTVAQLAGGACVTDVK 119

Query: 144 FDFQTGTIFVLVNQGNEGNYVALLDAAGGGAQVGQISLGASKPITGVVDPAGQIFTVICA 203
            D   G +FV V+  +E      L A G   +VG ++L A+KP+T VVDP G++ TV+  
Sbjct: 120 AD-GAGLVFVSVSGKDE----VWLYATGAWERVGVVTL-AAKPVTLVVDPLGELLTVVLQ 173

Query: 204 DRNVSVFQYGAGGSHKLLHRLNHYLQVDPLRYSISMSPQADTLPLLNSMSGSTPAILLLD 263
           +R+V+V+QY   G+ ++  +L  Y+Q +PLRYSI+MSPQ D LPL+NS+    P+  LLD
Sbjct: 174 NRSVAVYQYNRQGAVRMHQQLPQYVQTNPLRYSITMSPQGDLLPLVNSIKNGLPSAQLLD 233

Query: 264 RKSGFKLRATLVGHFDKCQICQFSPSLYEKVQKSGTKVTYNLAATSGFDTGSVVIWNTKR 323
           R +GF +++TLVG+ DKC+I +FSP LYEK  K      YNL A+SG + GSV++WNTKR
Sbjct: 234 RTAGFSVQSTLVGYVDKCKILRFSPRLYEKPNKDKPPTQYNLLASSGNEDGSVIVWNTKR 293

Query: 324 LKPLLNTKCTEDSFVTDLQWSDDGSTLFAVTNNGLLFIFAFRDEELGKTLPKSHVDKLRS 383
            KPLLN     D+F+ D+QWS DG+ LFA++N+G LFIFAF + ELG+ L  + ++KLR 
Sbjct: 294 TKPLLNAAKVTDTFINDVQWSRDGTGLFAISNDGYLFIFAFHEVELGRLLDDAELEKLRQ 353

Query: 384 DCATLSPLPPTEVPDL-------NQTIKPEIVAPGSSGVITKVNGKNKVAPTTIRSLSME 436
               L PLPP     L        Q  KP+  A  S+  ++   GK K+APT I S SME
Sbjct: 354 SVPRLEPLPPPTPKSLAKSEAKPQQDTKPD--AKSSANSVSAKTGKKKIAPTVITSTSME 411

Query: 437 FIAPSYSVPKDLKRRPKDPLQAT--TNKKQKHDLEPMDFLDTSLLMPTVSFSKVRLAAPK 494
           F  PSY+VPKDLKRRPK   Q T    K+ K D+EPMDFLDT+LL+P +SFSK RLA PK
Sbjct: 412 FNEPSYTVPKDLKRRPKQETQRTGPPTKRPKRDVEPMDFLDTNLLIPNISFSKARLATPK 471

Query: 495 VRLSFTYYPSTSDSLAISVKNGSGNEQTPTVITLKLKESGQEKTIFEDFLPKLITICTSG 554
           VR++F Y  +   +L + VKNG+G+EQ PT ITL LK+  ++  +F+DF P+ +TICT G
Sbjct: 472 VRMNFQYCNTLQQNLVMEVKNGTGSEQKPTSITLTLKDKEKDMVLFQDFTPRFVTICTCG 531

Query: 555 DNFWSCCSDDGTVYVYSDSGRKLLPPMIMGVPCSFLEACGNFLLCVTSIGQVYCWNVDAS 614
            +FW+CC+++G VYVYS++G+KLLPPMIMGVP SFLE CG++LLCVTS+GQ++CWNV   
Sbjct: 532 HSFWACCTEEGIVYVYSNTGKKLLPPMIMGVPVSFLEGCGDYLLCVTSMGQLFCWNVKEG 591

Query: 615 RLLFPPTSLYPLLSPNLRFSDDVLTRAENITMCTLTASGVPIVTLSNGDGYMYDKVMEVW 674
           +L FP  ++YPLL+P++R+SDDVLTRAENITMCT T +G+P+VTLSNGDGYM+D  ME+W
Sbjct: 592 KLKFPVNTIYPLLNPSIRYSDDVLTRAENITMCTTTENGIPLVTLSNGDGYMFDPDMEIW 651

Query: 675 MLINDSWWAYGSQYWDTTKTTTNGTYASEPNDKHDKKNQNWNSEAKGLTESLKENKSSIL 734
           +LINDSWWAYGSQYWD T T+  G+ A+  NDK DKKN+ WN++A+ L E +K+NK S++
Sbjct: 652 LLINDSWWAYGSQYWDFTNTSHAGSSAAAGNDKEDKKNKYWNADAEYLIEEVKKNKKSVV 711

Query: 735 NYLESRTNDELNRKGRVRNLQKFAKTILMKEGYENLEEVVTLSHLENKLLVSLRLHEYEE 794
           NYLES+TNDE+ RKG +RNLQ+FAKTILMKEG+ENLE++VTLSHLEN+LLV+L+L+E  E
Sbjct: 712 NYLESKTNDEMTRKGLIRNLQRFAKTILMKEGFENLEDIVTLSHLENRLLVALKLNETNE 771

Query: 795 FTKLLTIYCIRLSEMGYKNRLDDVLQWLYDDGNYKAKSVAGVKAEELLRKILVACADIRH 854
           FTKLL +YCI L+EMG+KNRLDDVL WLY+DG YK  ++A  K EELL++ILVACADIR 
Sbjct: 772 FTKLLKVYCISLAEMGFKNRLDDVLSWLYNDGEYKVGTIANEKREELLKQILVACADIRQ 831

Query: 855 VQRVTTS 861
           VQRVTTS
Sbjct: 832 VQRVTTS 838

>YOR038C (HIR2) [4850] chr15 complement(402760..405387) Histone
           transcription regulator, required for periodic
           repression of three of the four histone gene loci and
           for autogenous repression of HTA1-HTB1 locus by H2A and
           H2B [2628 bp, 875 aa]
          Length = 875

 Score =  801 bits (2069), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/878 (46%), Positives = 582/878 (66%), Gaps = 55/878 (6%)

Query: 25  MKLLKYPRALHSGKIVGCACIGDNLVTAGQDS-VCVWSCSQLVGAAMGNISAKEVREKFE 83
           M+LLKYP  +H+ ++   A +G  ++ AG    V  W   QLV  A   +  K+++ +  
Sbjct: 1   MRLLKYPLDIHNEQVNALAALGPYIILAGSGGHVMAWRQQQLVDTAFDRVMIKDLKPEVS 60

Query: 84  IKVLEARLEPLRLVVGSDACLYVGTDRTVL-YADSL------LEKGEKTSFQTLYHVEAP 136
            +V +     +  + G    LY+G++  +  Y+  L      +   EK + + L+  ++P
Sbjct: 61  FQVDQDTTGDIFFITGDLETLYIGSEHRLWGYSGWLCRDTNNINSVEKMNSKLLFECKSP 120

Query: 137 ACVTDVKFDFQTGTIFVLVNQGNEGNYVALLDAAGGGAQVGQISLG-ASKPITGVVDPAG 195
           + +TDVK+D   G +FVL++  N+     LL       ++ +I++  ASKPITG++DP G
Sbjct: 121 STITDVKYDINLGILFVLLSNENK----ILLFRHKTFDKLSEITIDKASKPITGIIDPTG 176

Query: 196 QIFTVICADRNVSVFQYGAGGSHKLLHRLNHYLQVDPLRYSISMSPQADTLPLLNSMSG- 254
           Q FTV+ +DR++ V+Q    G+HKL+++L  ++Q+ PL Y ISMSPQAD LP++NS+ G 
Sbjct: 177 QTFTVMTSDRSILVYQINKTGTHKLINKLTQHVQMYPLHYRISMSPQADILPVINSVKGV 236

Query: 255 ---STPAILLLDRKSGFKLRATLVG-HFDKCQICQFSPSLYEKVQ-KSGTKVTYNLAATS 309
              +T    LLDR + +K+  TLV    + C++  +SP+ YEK   K GT   YNL ATS
Sbjct: 237 PNNATSCTALLDRNNNYKVTKTLVTPSSNGCRVLVYSPAFYEKPNLKKGTSTRYNLIATS 296

Query: 310 GFDTGSVVIWNTKRLKPLLNTKCTEDSFVTDLQWSDDGSTLFAVTNNGLLFIFAFRDEEL 369
           G   G++++WNTKR+KPL N      + + D+ WS DG TLFA++N+  L+ FAF++++L
Sbjct: 297 GSTDGTILVWNTKRMKPLFNALQVSSTAINDMSWSQDGFTLFAISNDATLYTFAFQEKDL 356

Query: 370 GKTLPKSHVDKLRSDCATLSPLPPTEVPDLNQTIK--PEIV---APGSSGVITKVNGKNK 424
           G  LP++ +  L+        LP  E P   Q  K  PE +      S+  I    G++ 
Sbjct: 357 GVALPQTEIKSLQE---VNKKLPKLEEPLAEQIPKSFPENIKLEESASAAPIPNDIGRSA 413

Query: 425 VA--PT-------------TIRSLSMEFIAPSYSVPKDLKRRPKDPLQ---ATTNKKQKH 466
           V   PT             TI+S SMEF  PSY+VP+DLKR+PK+      A  +KKQK 
Sbjct: 414 VGKKPTKKKTANNQTNGIKTIQSTSMEFNTPSYTVPRDLKRKPKEATPSNIAPGSKKQKK 473

Query: 467 DLEPMDFLDTSLLMPTVSFSKVRLAAPKVRLSFTYYPSTSDSLAISVKNGSGNEQTPTVI 526
           +L+P+DFLDT LL+P  SFS++RLA PK+R +F Y P  + +L + VKNGSGNEQ PT++
Sbjct: 474 ELQPIDFLDTGLLLPNTSFSRIRLATPKIRSTFKYSPINNPNLILDVKNGSGNEQRPTIV 533

Query: 527 TLKLKESGQEKTIFEDFLPKLITICTSGDNFWSCCSDDGTVYVYSDSGRKLLPPMIMGVP 586
            L  K   Q++ +F+DF+PKLITICT+GD FWS CS+DG++Y+YSDSGRKL+ P+++GV 
Sbjct: 534 KLTSKVLDQDQVLFQDFIPKLITICTAGDTFWSFCSEDGSIYIYSDSGRKLMAPLVLGVS 593

Query: 587 CSFLEACGNFLLCVTSIGQVYCWNVDASRLLFPPTSLYPLLSPNLRFSDDVLTRAENITM 646
            SFLEACG +LLC+TSIG++YCWN++  +L FP  ++YPLL+P+LR+SDD+LTRAENIT+
Sbjct: 594 ISFLEACGTYLLCLTSIGELYCWNIEQKKLAFPTNTIYPLLNPSLRYSDDILTRAENITL 653

Query: 647 CTLTASGVPIVTLSNGDGYMYDKVMEVWMLINDSWWAYGSQYWDTTKTTTNGTYASEPN- 705
           C++T  GVP+VTLSNGDGY++DK ME W+L++D WWAYGSQYWDTT TT  G  +S+ N 
Sbjct: 654 CSITKKGVPLVTLSNGDGYLFDKNMETWLLVSDGWWAYGSQYWDTTNTT--GLSSSKANT 711

Query: 706 DKHDKKNQNWNSEAKGLTESLKENKSSILNYLESRTNDELNRKGRVRNLQKFAKTILMKE 765
           D  +    N N     +   +K +  SI+N+LE +TNDELNRKGR++NLQ+FA+TILMKE
Sbjct: 712 DSFNGSESNINE----IVSDIKNDNQSIINFLECKTNDELNRKGRIKNLQRFARTILMKE 767

Query: 766 GYENLEEVVTLSHLENKLLVSLRLHEYEEFTKLLTIYCIRLSEMGYKNRLDDVLQWLYDD 825
           G+EN+EE+VTLSHLENK+L+S+RL E EEF+KL+ +YCIRLSE+GY +RL+DV QWLYDD
Sbjct: 768 GFENMEEIVTLSHLENKILISIRLEEPEEFSKLMMVYCIRLSELGYMDRLNDVFQWLYDD 827

Query: 826 GNYKAKSVAGVKAE---ELLRKILVACADIRHVQRVTT 860
                   A    +    LL+KIL+AC DIR VQRVTT
Sbjct: 828 LPISGTGSAFADKDFKRNLLKKILIACGDIRQVQRVTT 865

>KLLA0E21945g complement(1948687..1951230) similar to sp|P32480
           Saccharomyces cerevisiae YOR038c HIR2 histone
           transcription regulator, start by similarity
          Length = 847

 Score =  753 bits (1945), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/855 (45%), Positives = 554/855 (64%), Gaps = 38/855 (4%)

Query: 25  MKLLKYPRALHSGKIVGCACIGDNLVTAGQDSVCVWSCSQLVGAAMGNISAKEVRE--KF 82
           MKLLK P  LH G++  C    + L   G   + +W    L+ AA G    KEV+E  K 
Sbjct: 1   MKLLKLPSKLHDGQLTQCEVDDNKLYIIGGKYLSIWDSQTLLNAATGKTDVKEVKELEKM 60

Query: 83  EIKVLEARLEPLR-LVVGSDACLYVGTDRTVLYADSLLEKGEKTSFQT--LYHVEAPACV 139
            + +LE+  E  R LVV  +  L  G+D  +   D  L K   + +++  +   +    +
Sbjct: 61  SLDLLESNQEDGRWLVVLDNQRLVYGSDHLLACLD--LNKDSNSEYKSREIGIFKDNEAI 118

Query: 140 TDVKFDFQTGTIFVLVNQGNEGNYVALLDAAGGGAQVGQISLGASKPITGVVDPAGQIFT 199
           TD+K+D   G +FV +++ N    + ++D+     +   I L  SKPI+ + DP GQ+ T
Sbjct: 119 TDLKYDKVNGLLFVSLSKANS---LQIMDSKTWELK-SSIEL-KSKPISIITDPLGQLLT 173

Query: 200 VICADRNVSVFQYGAGGSHKLLHRLNHYLQVDPLRYSISMSPQADTLPLLNSMSGSTPAI 259
           VI  +R+V ++QY + G+ KL   +N ++Q +PL Y ++MSPQ D +P++NS+  + P  
Sbjct: 174 VILQNRSVQIYQYDSHGTTKLHQSINQFVQTNPLPYRMTMSPQGDVIPMINSLHNNVPTA 233

Query: 260 LLLDRKSGFKLRATLVGHFDKCQICQFSPSLYEKVQK--SGTKVTYNLAATSGFDTGSVV 317
           +LLDR   FK++ +LVG+   C+I +FSP +Y K +   S    T+NL A+SG + G+VV
Sbjct: 234 VLLDRIQKFKIKLSLVGYVADCKILKFSPRIYSKTKSPTSNDTQTFNLLASSGNEDGNVV 293

Query: 318 IWNTKRLKPLLNTKCTEDSFVTDLQWSDDGSTLFAVTNNGLLFIFAFRDEELGKTLPKSH 377
           +WNT R+KPL +     +S++TDL+W + G  LFA++ +G L IFAF++ ELG  +P   
Sbjct: 294 VWNTNRIKPLFDASKVVNSYITDLEWDNSGLGLFAISQDGQLVIFAFQENELGDVMPVEA 353

Query: 378 VDKLRSDCATLSPLP---PTEVPDLNQTIKPEIVAPGSSGVITKVNGKNK---VAPTTIR 431
           V +   +   L PLP     E PD         + P  +   T  N K +      TTI 
Sbjct: 354 VTEAAKEIKLLDPLPFKPKAEEPDTK-------LPPNKTAQQTTTNSKKQPKAAEITTIS 406

Query: 432 SLSMEFIAPSYSVPKDLKRRP--KDPLQA---TTNKKQKHDLEPMDFLDTSLLMPTVSFS 486
           S +MEFI PSY VPKDLKR+P  +DPL A     NKK K +L+ +DFLDT+L +P+VSFS
Sbjct: 407 STNMEFIQPSYMVPKDLKRKPVTEDPLLAQNKPANKKAKKELDQIDFLDTNLFLPSVSFS 466

Query: 487 KVRLAAPKVRLSFTYYPSTSDSLAISVKNGSGNEQTPTVITLKLKESGQEKTIFEDFLPK 546
           KVRLA PK+R SF Y  S+  +  + +KNG GN+Q PT ITL  K++   K +F+ FLPK
Sbjct: 467 KVRLAHPKIRASFQY--SSQGNFVLDIKNGLGNDQKPTSITLTRKDNESSKQLFQTFLPK 524

Query: 547 LITICTSGDNFWSCCSDDGTVYVYSDSGRKLLPPMIMGVPCSFLEACGNFLLCVTSIGQV 606
            +T+C++G +FW+  +D G +YV S SG+ L PPM++GVP SFLE  G++LLC+TSIGQ+
Sbjct: 525 FVTLCSAGSSFWAWSTDTGMIYVTSISGQMLFPPMLLGVPVSFLEGSGDYLLCITSIGQM 584

Query: 607 YCWNVDASRLLFPPTSLYPLLSPNLRFSDDVLTRAENITMCTLTASGVPIVTLSNGDGYM 666
           YCWNV+  ++ FP   +Y LL+P LR+SDDVL+RAENITMC +T+ G+PIVTLSNGDGYM
Sbjct: 585 YCWNVNTGKIAFPINDVYSLLNPMLRYSDDVLSRAENITMCAVTSQGIPIVTLSNGDGYM 644

Query: 667 YDKVMEVWMLINDSWWAYGSQYWDTTKTTTNGTYASEPNDKHDKKNQNWNSEAKGLTESL 726
           +D  ME WMLINDSWW YGSQYW+   +   G   +  +D  +KK++ WN+EA  L + +
Sbjct: 645 FDSAMEAWMLINDSWWPYGSQYWNFMSSA--GVDLTSNDD--EKKDKYWNAEADILAKEV 700

Query: 727 KENKSSILNYLESRTNDELNRKGRVRNLQKFAKTILMKEGYENLEEVVTLSHLENKLLVS 786
           K NK+SI+NYLE++TNDEL RKGR+++LQ+FAK +LMKEG+ENLEE++TL+HLENK+LVS
Sbjct: 701 KNNKNSIINYLETKTNDELTRKGRMKHLQRFAKVLLMKEGFENLEEMITLAHLENKILVS 760

Query: 787 LRLHEYEEFTKLLTIYCIRLSEMGYKNRLDDVLQWLYDDGNYKAKSVAGVKAEELLRKIL 846
            RL E EE  +LL IYCIR++EMGY +R    L WLYD  N K   +   +   L++ I+
Sbjct: 761 FRLKEVEEAIRLLKIYCIRIAEMGYTDRFSQTLSWLYDPTNTKFSPLDIDRRRNLIKDII 820

Query: 847 VACADIRHVQRVTTS 861
           ++CA+IR VQRVTTS
Sbjct: 821 ISCANIRQVQRVTTS 835

>Scas_699.42
          Length = 885

 Score =  719 bits (1856), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/891 (43%), Positives = 553/891 (62%), Gaps = 73/891 (8%)

Query: 25  MKLLKYPRALHSGKIVGCACIGDNLVTAGQ-DSVCVWSCSQLVGAAMGNISAKEVREK-- 81
           M+LLKYP  L    +     IG +L+       V VWS   LV  A   I  +++RE   
Sbjct: 1   MRLLKYPLDLKDQSVKALVAIGSHLIIVSNVGHVHVWSQQSLVNTAFNKIPIRDLRESHS 60

Query: 82  FEIKVLEARLEPLRLVV-GSDACLYVGTDRTVLYADSLLEKGEKTSFQTLY--HVEAPAC 138
           F+I     +L+     V G++  L + T+  +L + + L + +   F+ ++  H+ +   
Sbjct: 61  FQIDSFNPKLDRNVFAVEGTNDLLILATENRILISRNWLIRDKNKKFECVFQCHMGSDNV 120

Query: 139 VTDVKFDFQTGTIFVLVNQGNEGNYVAL--LDAAGGGAQVGQISLGASKPITGVVDPAGQ 196
           +TD+K D     + V +   ++     L  L       Q  + SL   +PIT ++DP G 
Sbjct: 121 ITDMKIDQLNKIVLVSMVSPDQILLFNLETLKLINVIDQEFKPSLN-RRPITLIIDPCGT 179

Query: 197 IFTVICADRNVSVFQYGAGGSHKLLHRLNHYLQVDPLRYSISMSPQADTLPLLNSMSGST 256
            FTV+C+DR++ V+Q    G+ KLL+    Y+QV PL Y I+M PQ DTLPL+NS+ GST
Sbjct: 180 RFTVLCSDRSMLVYQINESGNFKLLNTFPQYVQVHPLHYKITMPPQGDTLPLINSIKGST 239

Query: 257 P----AILLLDRKSGFKLRATLVG-HFDKCQICQFSPSLYEKV-QKSGTKVTYNLAATSG 310
                  +LLD    +K+++T+V       ++ ++SP++YEK  QK GTKV+YNL ATSG
Sbjct: 240 SKDITTTVLLDANDNYKIKSTIVSPSSSNTKVLKYSPTIYEKTNQKKGTKVSYNLLATSG 299

Query: 311 FDTGSVVIWNTKRLKPLLNTKCTEDSFVTDLQWSDDGSTLFAVTNNGLLFIFAFRDEELG 370
            + G++++WNTKR+KPL N   T    + D+ WS DG TLFA++++ +L+ FAF+D +LG
Sbjct: 300 TEDGTILMWNTKRMKPLFNAMSTSSMPINDIVWSQDGLTLFAISDDSVLYTFAFQDNDLG 359

Query: 371 KTLPKSHVDKLRSDCATLSPLPPTEV-PDLNQTIKPEIVAPGSSGVITKVNGKNKVA-PT 428
             L    V  LR     L  L    +   + Q+     +       ITK+  +     P+
Sbjct: 360 DQLSIEQVTLLRDQNKKLPILSNLNLDKKVLQSKLDACLNKSDEKTITKIQKEEGTKKPS 419

Query: 429 TIR---------------------SLSMEFIAPSYSVPKDLKRR-PK-----DPLQATTN 461
           + R                     S +MEF  PSY+VPKDLKR+ PK      PL    N
Sbjct: 420 SKRRTSLKQNLPAQSQDSMVKITQSTNMEFNPPSYNVPKDLKRKKPKVKESSTPLNGEQN 479

Query: 462 ----KKQKHDLEPMDFLDTSLLMPTVSFSKVRLAAPKVRLSFTYYPSTSDSLAISVKNGS 517
               KK K DLEP+ FLDT LL+P VSFS++RLA PK+RL FTY P +  +L +++KNGS
Sbjct: 480 PSPTKKLKRDLEPISFLDTGLLLPNVSFSRMRLATPKIRLQFTYTPFSDPNLYMTIKNGS 539

Query: 518 GNEQTPTVITLKLK------ESGQEKTIFEDFLPKLITICTSGDNFWSCCSDDGTVYVYS 571
           G+EQTP++++L  K      +  Q K IF+DF+PK +  C +G++FW CC+ DGT+Y Y+
Sbjct: 540 GSEQTPSIVSLYQKPLQIRQKDTQPKLIFQDFIPKYVCQCIAGESFWCCCTSDGTLYTYT 599

Query: 572 DSGRKLLPPMIMGVPCSFLEACGNFLLCVTSIGQVYCWNVDASRLLFPPTSLYPLLSPNL 631
           DSGR+LLPPM +GVP +FL+AC  +LLCVTS+G++YCW++   +LLFP T++YPLL P++
Sbjct: 600 DSGRRLLPPMTLGVPITFLQACKQYLLCVTSLGELYCWDLSMKKLLFPMTTVYPLLKPSI 659

Query: 632 RFSDDVLTRAENITMCTLTASGVPIVTLSNGDGYMYDKVMEVWMLINDSWWAYGSQYWDT 691
           R+SDDVLTR ENITMCT+T+ GVP+ TLSNGDGY++DK ME W+L++D WWAYGSQYWD 
Sbjct: 660 RYSDDVLTRVENITMCTVTSKGVPLATLSNGDGYIFDKDMESWLLVSDGWWAYGSQYWD- 718

Query: 692 TKTTTNGTYASEPNDKHDKKNQNWNSEAKGLTESLKENKSSILNYLESRTNDELNRKGRV 751
              + N  Y ++ N   + KN               ENK S++N +E +TN+EL+RKGR+
Sbjct: 719 ---SLNNDYKNDSNTLEELKN--------------AENKKSLINMMERKTNEELDRKGRI 761

Query: 752 RNLQKFAKTILMKEGYENLEEVVTLSHLENKLLVSLRLHEYEEFTKLLTIYCIRLSEMGY 811
           ++LQ+FAKT+LMKEG+EN+EE+VTLSHLEN++LVSL+L E+ EF  L+  Y  RL E+GY
Sbjct: 762 KHLQRFAKTLLMKEGFENMEEIVTLSHLENRILVSLKLEEFNEFKDLIIAYSSRLGELGY 821

Query: 812 KNRLDDVLQWLYDDGNY-KAKSVAGVKAEELLRKILVACADIRHVQRVTTS 861
             RL+D+LQW+Y+DG   K+  + G   E +L+ IL+ACAD+RHVQRVT +
Sbjct: 822 IERLNDMLQWIYNDGKMGKSDLLLGQSRELILKDILIACADMRHVQRVTKA 872

>CAGL0I00968g 78375..81368 similar to sp|P32480 Saccharomyces
           cerevisiae YOR038c HIR2 histone transcription regulator,
           hypothetical start
          Length = 997

 Score =  512 bits (1318), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 239/463 (51%), Positives = 337/463 (72%), Gaps = 21/463 (4%)

Query: 404 KPEIVAPGSSGVITKVN-GKNKVAP-----TTIRSLSMEFIAPSYSVPKDLKRRPK-DPL 456
           KP+  +  S    +KVN  +N ++P     T  +S + +F  PSY VPKDLKR+PK D L
Sbjct: 523 KPDKKSIKSENGESKVNKAQNTISPKESNTTDNKSTTPDFKNPSYQVPKDLKRKPKEDAL 582

Query: 457 QATTNKKQKHDLEPMDFLDTSLLMPTVSFSKVRLAAPKVRLSFTYYPSTSDSLAISVKNG 516
                K+ K DLEP+DFLDT LL+P V+FS+VRL+ P +R++     S    + ++++NG
Sbjct: 583 GNAVTKRAKKDLEPVDFLDTGLLLPNVAFSRVRLSTPLIRMNIDCTSSNDSKILLNIRNG 642

Query: 517 SGNEQTPTVITLKLKESGQEKTIFEDFLPKLITICTSGDNFWSCCSDDGTVYVYSDSGRK 576
           SGNEQ PT++ L  K    E+T+F+DF+PK +++ TSGD+FW+C S+DGT+Y+++D GRK
Sbjct: 643 SGNEQKPTIVKLLDKTVTPERTLFQDFIPKFVSLATSGDDFWACSSEDGTLYIFNDVGRK 702

Query: 577 LLPPMIMGVPCSFLEACGNFLLCVTSIGQVYCWNVDASRLLFPPTSLYPLLSPNLRFSDD 636
           ++PP+ +GVP SFLEACG +LLCV+SIG++YCWN+ +S+L FP T+++PLLSP++R+SDD
Sbjct: 703 IIPPLTIGVPISFLEACGKYLLCVSSIGELYCWNIASSKLEFPVTTIFPLLSPSIRYSDD 762

Query: 637 VLTRAENITMCTLTASGVPIVTLSNGDGYMYDKVMEVWMLINDSWWAYGSQYWDTTKTTT 696
           +LTRAENITMC++T +G PI TLSNGDGYMYDK ME W+L++D WWAYGSQYWD   +T 
Sbjct: 763 ILTRAENITMCSVTNNGFPIATLSNGDGYMYDKNMETWLLVSDGWWAYGSQYWD---STN 819

Query: 697 NGTYASEPNDKHDKKNQNWNSEAKGLTESLKENKSSILNYLESRTNDELNRKGRVRNLQK 756
           N     + + K         +E +  TE    +K+SI+  LE +TN+EL RKGR++NL++
Sbjct: 820 NSNLIPDSSTKP--------TEGQSSTEI---SKASIVTLLEKKTNNELTRKGRIKNLRR 868

Query: 757 FAKTILMKEGYENLEEVVTLSHLENKLLVSLRLHEYEEFTKLLTIYCIRLSEMGYKNRLD 816
           FA+TILMKEG+EN+EE+VTLSHLENKLLV+LRL E  EF KL+ +Y ++L E+GY +RL 
Sbjct: 869 FARTILMKEGFENIEEIVTLSHLENKLLVTLRLEEQHEFKKLIKLYAVKLGELGYVDRLR 928

Query: 817 DVLQWLYDDGNYKAKSVAGVKAEELLRKILVACADIRHVQRVT 859
           D+  W+  D N     + G+  +EL++ +L ACAD+R VQRVT
Sbjct: 929 DLFAWIISDSNDNGDLIPGINRKELVKTLLTACADLRSVQRVT 971

 Score =  214 bits (544), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 140/388 (36%), Positives = 213/388 (54%), Gaps = 26/388 (6%)

Query: 25  MKLLKYPRALHSGKIVGCACIGDN--LVTAGQDSVCVWSCSQLVGAAMGNISAKEVREK- 81
           M+LLKYP    SG +     I     +V   +  + VW   QL+  A    + + ++ K 
Sbjct: 1   MRLLKYPLEGISGNVTSLVTIDAEYVVVCGSRGDIQVWHQQQLLDTAFDRCTLETLKPKY 60

Query: 82  ---FEIKVLEARLEPLRLVVGSDACLYVGTDRTVL-YADSL--LEKGEKT-SFQTLYHVE 134
              FE+K  E   + L   +G   CLY+GT+ +V  Y+  L  LE G  T   + +Y   
Sbjct: 61  SFTFELKDDE---DELVFAMGDRDCLYLGTEHSVYSYSGWLKALESGHTTLENKLIYTTV 117

Query: 135 APACVTDVKFDFQTGTIFVLVNQGNEGNYVALLDA-AGGGAQVGQISLGA-SKPITGVVD 192
           + + +TDVK+D     +FVL ++  +   + L D  +    ++  I+L   SKP+TGVVD
Sbjct: 118 SQSIITDVKWDSLLDILFVLTDRPCK---IHLFDTRSANKKEITSIALDKNSKPLTGVVD 174

Query: 193 PAGQ-IFTVICADRNVSVFQYGAGGSHKLLHRLNHYLQVDPLRYSISMSPQADTLPLLNS 251
           P+G   FTV+ +DR++ V+     G +K + +L+ ++ V PL Y I+M PQAD LP++NS
Sbjct: 175 PSGAGTFTVLTSDRSIVVYHINRTGDYKEVKKLSQHVLVYPLHYKITMPPQADFLPIINS 234

Query: 252 MSGST-----PAILLLDRKSGFKLRATLV-GHFDKCQICQFSPSLYEKVQ-KSGTKVTYN 304
           + GS+      A +LL+R   +K+ +TLV       ++   SP +YEK   K GT   YN
Sbjct: 235 LKGSSGAAGSTATVLLNRNENYKVMSTLVPSASSNTKVLVHSPKMYEKANLKRGTISRYN 294

Query: 305 LAATSGFDTGSVVIWNTKRLKPLLNTKCTEDSFVTDLQWSDDGSTLFAVTNNGLLFIFAF 364
           L ATS    GS++IWNTKR KPL       DS + D+ WS +G TLFAV+N+ +L+ FAF
Sbjct: 295 LVATSTNTDGSIMIWNTKRGKPLFAPLNISDSAINDMIWSSNGLTLFAVSNDNVLYTFAF 354

Query: 365 RDEELGKTLPKSHVDKLRSDCATLSPLP 392
             ++LGKT+P   ++ +R       PLP
Sbjct: 355 LQDDLGKTVPMEEIENIRQSNIIKEPLP 382

>Scas_702.16
          Length = 816

 Score = 88.6 bits (218), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 57/204 (27%), Positives = 103/204 (50%), Gaps = 18/204 (8%)

Query: 187 ITGVV-DPAGQIFTVICADRNVSVFQYGAGG--SHKLLHRLNHYLQVDPLR---YSISMS 240
           + GV+ DPA + F     DR + +F+Y   G  S  + H +    +  PL      +S S
Sbjct: 182 VKGVIFDPANKYFATASDDRTMKIFRYHKIGDASFTIEHVVTEPFKGSPLTTYFRRLSWS 241

Query: 241 PQADTLPLLNSMSGSTPAILLLDRKSGFKLRATLVGHFDKCQICQFSPSLYE-------- 292
           P    +   N+ +G   ++ +++R + +    +L+GH    ++ +F+P L+E        
Sbjct: 242 PDGQHIAAPNATNGPVSSVAIINRGT-WDSNISLIGHDAPTEVVRFNPRLFEVNDGMTPA 300

Query: 293 -KVQKSGTKVTY-NLAATSGFDTGSVVIWNTKRLKPLLNTKCTEDSFVTDLQWSDDGSTL 350
            + Q SG   +  ++ AT+G D  +VV+W+T R +P+       +  +TD+QW+ DG+ L
Sbjct: 301 KRKQDSGPNDSMESIIATAGQDK-TVVVWSTTRARPIFIAFDIANKSITDMQWTPDGTML 359

Query: 351 FAVTNNGLLFIFAFRDEELGKTLP 374
           F  + +  + I  F D ELGK +P
Sbjct: 360 FLTSLDSSITILVFEDNELGKIIP 383

 Score = 34.7 bits (78), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 23/112 (20%), Positives = 53/112 (47%), Gaps = 3/112 (2%)

Query: 535 QEKTIFEDFLPKLI--TICTSGDNFWSCCSDDGTVYVYSDSGRKLLPPMIMGVPCSFLEA 592
           Q K     FLP+++   + +S    W   + +G++Y+   +G+   P + +G     +  
Sbjct: 667 QGKICLTAFLPEVVITAVGSSHCQCWCLSTAEGSLYIIGYNGQYRSPRISVGHKIIKMIN 726

Query: 593 CGNFLLCVTSIGQVYCWNVDASRLLFPPTSLYPLLSPNLRFSDDVLTRAENI 644
              +L+ +T  G  Y W+++  +L+     + P+L+ N+ F  + +  +  I
Sbjct: 727 RERYLIALTERGLFYIWDIEDLKLVSKNIPILPILN-NIPFKGNKVRTSRKI 777

>YBL008W (HIR1) [186] chr2 (209618..212140) Histone transcription
           inhibitor, required for periodic repression of 3 of the
           4 histone gene loci and for autogenous repression of
           HTA1-HTB1 locus by H2A and H2B, member of WD (WD-40)
           repeat family [2523 bp, 840 aa]
          Length = 840

 Score = 83.6 bits (205), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 57/216 (26%), Positives = 105/216 (48%), Gaps = 30/216 (13%)

Query: 187 ITGVV-DPAGQIFTVICADRNVSVFQYGAGG--SHKLLHRLNHYLQVDPLRYSI---SMS 240
           + GVV DPA + F     DR + +F+Y   G  S  + H +    +  PL       S S
Sbjct: 182 VKGVVFDPANKYFATTSDDRTMKIFRYHKTGDISFTIEHIITEPFKESPLTTYFRRPSWS 241

Query: 241 PQADTLPLLNSMSGSTPAILLLDRKSGFKLRATLVGHFDKCQICQFSPSLYEK------- 293
           P    + + N+ +G   ++ +++R + +    +L+GH    ++ +F+P L+E+       
Sbjct: 242 PDGQHIAVPNATNGPVSSMAIVNRGT-WDTNVSLIGHDAPTEVARFNPRLFERNAGVKQK 300

Query: 294 ---------VQKSGTKVTY------NLAATSGFDTGSVVIWNTKRLKPLLNTKCTEDSFV 338
                    V ++  KV +      ++ AT+G D  S+ +W+T R +P+L      +  +
Sbjct: 301 KDDDPENALVGQNDDKVHHFDKNIDSVVATAGQDK-SLAVWSTSRPRPILVAFDIANKSI 359

Query: 339 TDLQWSDDGSTLFAVTNNGLLFIFAFRDEELGKTLP 374
           TD+ W+ DGS LF  + +  + +F F + ELGK +P
Sbjct: 360 TDMSWNPDGSLLFVASLDSSITLFKFENNELGKPIP 395

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 52/98 (53%), Gaps = 5/98 (5%)

Query: 534 GQEKTIFEDFLPKLITICTSGDN---FWSCCSDDGTVYVYSDSGRKLLPPMIMGVPCSFL 590
           G ++TI E F+P++I IC  G      W   S +G++Y+ S +G++ +P + +G     +
Sbjct: 694 GGKRTI-ETFIPEVI-ICAIGSKDCKCWCLASANGSIYILSYNGQQRIPKICLGHKVIKM 751

Query: 591 EACGNFLLCVTSIGQVYCWNVDASRLLFPPTSLYPLLS 628
                +LL +T  G  + W++   +L+     + P+L+
Sbjct: 752 VTSSKYLLVLTERGLFFAWDLLDLKLVLRNVPILPILN 789

>KLLA0A04928g 439349..441934 similar to sp|P32479 Saccharomyces
           cerevisiae YBL008w HIR1 histone transcription regulator,
           start by similarity
          Length = 861

 Score = 82.8 bits (203), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 51/206 (24%), Positives = 99/206 (48%), Gaps = 20/206 (9%)

Query: 187 ITGVV-DPAGQIFTVICADRNVSVFQYGAGG--SHKLLHRLNHYLQVDPLR---YSISMS 240
           + GVV DPA + F     DR + +F+Y   G  S  + H +    +  PL      +S S
Sbjct: 179 VKGVVFDPANKYFATASDDRTIKMFRYHKTGETSFSVEHVITEPFKGSPLTTYFRRLSWS 238

Query: 241 PQADTLPLLNSMSGSTPAILLLDRKSGFKLRATLVGHFDKCQICQFSPSLYEKVQKSGTK 300
           P    +   N+M+G    + +++R + ++   +LVGH    ++  F+P ++++ +   T 
Sbjct: 239 PDGQHIAAPNAMNGPVSTVAIIERGT-WESPVSLVGHDQPTEVASFNPRIFKRQKDDSTT 297

Query: 301 VTYN------------LAATSGFDTGSVVIWNTKRLKPLLNTKCTEDSFVTDLQWSDDGS 348
            T +            + A+SG D  ++ +W+T + +PL+  +      +TD+ W+ DG 
Sbjct: 298 DTIDGKKTGISDEVDCIVASSGQDK-TLAVWSTSKARPLIVAQDICGKSITDMSWTPDGK 356

Query: 349 TLFAVTNNGLLFIFAFRDEELGKTLP 374
            LF  + +  + +  F D E G+ +P
Sbjct: 357 ILFITSLDSSIVVLTFEDNEFGEAIP 382

 Score = 31.2 bits (69), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 19/91 (20%), Positives = 36/91 (39%), Gaps = 2/91 (2%)

Query: 540 FEDFLPKLITICTS--GDNFWSCCSDDGTVYVYSDSGRKLLPPMIMGVPCSFLEACGNFL 597
           FE F P ++  C        W   +  G ++     G+   P + +G     L    + +
Sbjct: 697 FELFFPDVVLTCVGCMETKTWILATTTGQLFFIDTLGQARCPRISIGHKIIKLCTSQSHV 756

Query: 598 LCVTSIGQVYCWNVDASRLLFPPTSLYPLLS 628
           + +T    +Y W++ +  L      L PLL+
Sbjct: 757 IAITETALIYVWDLVSMSLTLKNIPLLPLLA 787

>AGR168W [4479] [Homologous to ScYBL008W (HIR1) - SH]
           complement(1061522..1063999) [2478 bp, 825 aa]
          Length = 825

 Score = 82.4 bits (202), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 90/362 (24%), Positives = 143/362 (39%), Gaps = 92/362 (25%)

Query: 187 ITGVV-DPAGQIFTVICADRNVSVFQYGAGG--SHKLLHRLNHYLQVDPLR---YSISMS 240
           + GVV DPA + F     DR V VF+Y  G   S  + H +    Q  PL      +S S
Sbjct: 179 VKGVVFDPANKYFATASDDRTVKVFRYHKGTDLSFTIEHIITEPFQGSPLTTYFRRLSWS 238

Query: 241 PQADTLPLLNSMSGSTPAILLLDRKSGFKLRATLVGHFDKCQICQFSPSLYEK------- 293
           P    + + N+ +G    + ++ R   +    +LVGH    ++  F+P L+E        
Sbjct: 239 PDGQHIAVPNATNGPVSTVAIISR-GNWDTSVSLVGHDQPTEVACFNPRLFEHNDNHERG 297

Query: 294 -------------VQKSGTKVTYN------LAATSGFDTGSVVIWNTKRLKPLLNTKCTE 334
                         + SG +   +      + AT+G D  ++ +W+T R +P+       
Sbjct: 298 EEVDGASKDNSAASESSGKRRLKDDDRVDSVIATAGQDK-TLAVWSTSRARPIFVAYDLT 356

Query: 335 DSFVTDLQWSDDGSTLFAVTNNGLLFIFAFRDEELGKTLP---------KSHVDK----- 380
              VTD+ W+ DG+ LF  + +G + +  F + ELGK +P         +  VDK     
Sbjct: 357 SKSVTDIAWTCDGTALFLTSLDGRIIVITFEEGELGKAIPLEQNVEQLHRYGVDKDSLVF 416

Query: 381 -------------------------LRSDCAT------LSPLPPTEVPDLNQTIKPEIVA 409
                                    L S   T      L+P P     D+     P+  A
Sbjct: 417 PESVKQLILEDKARQYKKPYIETTLLESRIGTVKKPNVLNPRPKHAKNDVAVASIPQAQA 476

Query: 410 P------GSSGVITKVNGKNKVAPTTI-----RSLSMEFIAPSYSVPKDLKRRPKDPLQA 458
           P      G     T  NGK +VAPT I     R+ +++F  P  S+  D   + K+PL+ 
Sbjct: 477 PALKKKEGPLNAATVQNGKKRVAPTLISTGYARAATVKF-EPRSSIDSDFAGK-KEPLKD 534

Query: 459 TT 460
           T+
Sbjct: 535 TS 536

 Score = 57.0 bits (136), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 33/142 (23%), Positives = 66/142 (46%), Gaps = 2/142 (1%)

Query: 535 QEKTIFEDFLPKLITICTSGD--NFWSCCSDDGTVYVYSDSGRKLLPPMIMGVPCSFLEA 592
           Q +   E FLP+++  C        W+  +  G++Y+Y + G+ L+P + +G     L A
Sbjct: 672 QGERTLEAFLPEVVISCVGSKACQCWALATASGSLYIYGNHGQLLVPKISIGHKVIKLIA 731

Query: 593 CGNFLLCVTSIGQVYCWNVDASRLLFPPTSLYPLLSPNLRFSDDVLTRAENITMCTLTAS 652
             +F++  T     + W++ A +L+    S+ P+L  +    + V      +    L  S
Sbjct: 732 WQHFVIAFTETCLFWIWDIRAMKLVEKEISVLPVLVQDQPQCNRVRISRRILDFRMLADS 791

Query: 653 GVPIVTLSNGDGYMYDKVMEVW 674
              +V +S+G  Y++ K +  W
Sbjct: 792 HELLVEMSDGASYVWKKALGCW 813

>Kwal_47.17465
          Length = 800

 Score = 71.2 bits (173), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 54/237 (22%), Positives = 104/237 (43%), Gaps = 51/237 (21%)

Query: 187 ITGVV-DPAGQIFTVICADRNVSVFQYGAGG--SHKLLHRLNHYLQVDPLR---YSISMS 240
           + GV+ DPA + F     DR V +F+Y   G  S  + H ++   +  P+      +S S
Sbjct: 124 VKGVIFDPANKYFATASDDRTVRIFRYHKAGDMSFSIEHVVSEPFKGSPITTYFRRLSWS 183

Query: 241 PQADTLPLLNSMSGSTPAILLLDRKSGFKLRATLVGHFDKCQICQFSPSLYEKVQK---- 296
           P    +   N+ +G   ++ ++ R S +    TL+GH    ++ +F+P L++ ++K    
Sbjct: 184 PDGQHIAAPNATNGPVSSVSIIARGS-WDTSVTLIGHDSPTEVVRFNPRLFQVLEKKTEK 242

Query: 297 ---------------SGTKVTYNLA------------------------ATSGFDTGSVV 317
                          +G K + + A                        AT+G D  ++V
Sbjct: 243 NKPEVESPLVSPETQNGVKDSQDEAGQRKDGQEEQEQEESVEEKVDSVIATAGQDK-TLV 301

Query: 318 IWNTKRLKPLLNTKCTEDSFVTDLQWSDDGSTLFAVTNNGLLFIFAFRDEELGKTLP 374
           +W+T + +P+          +TD+ W+ +G  LF  + +G +  F F ++ELG+ +P
Sbjct: 302 VWSTGKARPIFVAYDIASKSITDMVWNPNGDLLFLTSLDGSIITFHFGEKELGEAIP 358

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 33/144 (22%), Positives = 65/144 (45%), Gaps = 12/144 (8%)

Query: 542 DFLPKLITICTSGD---NFWSCCSDDGTVYVYSDSGRKLLPPMIMGVPCSFLEACGNFLL 598
           D L   + IC  G      W   + DG +Y+Y+  G++ +P + +G     + A   +++
Sbjct: 661 DLLIPDVIICVVGSLKCKCWVLATADGCIYIYTKYGQQKMPKIALGHKVVKMVAVDKYVV 720

Query: 599 CVTSIGQVYCWNVDASRLLFPPTSLYPLLSPNLRFSDDVLTRAE----NITMCTLTASGV 654
            +T  G +Y WN++A   +     + P+L  N   S+ V  + +     + +C L     
Sbjct: 721 ILTETGLLYAWNIEAEICIHKKVPIMPILCNNSVDSNRVRIQKKVVRIGLDLCKLDL--- 777

Query: 655 PIVTLSN-GDGYMYDKVMEVWMLI 677
            ++TL N  + Y +   +  W L+
Sbjct: 778 -LITLINPREAYSWSSNLGCWTLV 800

>CAGL0E02805g complement(265137..267659) similar to sp|P32479
           Saccharomyces cerevisiae YBL008w HIR1 histone
           transcription regulator, start by similarity
          Length = 840

 Score = 67.8 bits (164), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 53/208 (25%), Positives = 97/208 (46%), Gaps = 22/208 (10%)

Query: 187 ITGVV-DPAGQIFTVICADRNVSVFQYGAGG--SHKLLHRLNHYLQVDPLR---YSISMS 240
           + GV+ DPA + F     DR + VF+Y   G  S  +   +       PL      +S S
Sbjct: 176 VKGVIFDPANKYFATASDDRTMRVFRYHKTGEVSFTIEQVIVEPFIASPLTTYFRRLSWS 235

Query: 241 PQADTLPLLNSMSGSTPAILLLDRKSGFKLRATLVGHFDKCQICQFSPSLY----EKVQK 296
           P    + + N+ +G   ++ +++R + +    +L+GH    ++ +F+P L+    EK  K
Sbjct: 236 PDGQHIAVPNATNGPVSSVAIINRGT-WDSSISLIGHDAPTEVARFNPRLFKSDVEKKAK 294

Query: 297 SG----TKVTYN------LAATSGFDTGSVVIWNTKRLKPLLNTKCTEDSFVTDLQWSDD 346
           +     +K T N      + AT+G D  S+ +W T R +P+          +TD+ W+ +
Sbjct: 295 NAKDELSKDTKNNKKLESIIATAGQDK-SLALWITSRPRPIFVAYDIAQKSITDMAWNPN 353

Query: 347 GSTLFAVTNNGLLFIFAFRDEELGKTLP 374
           G+ LF  + +  + +  F   ELG  +P
Sbjct: 354 GNILFVTSLDSSIVMLMFDANELGMPIP 381

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 52/95 (54%), Gaps = 3/95 (3%)

Query: 536 EKTIFEDFLPKLIT--ICTSGDNFWSCCSDDGTVYVYSDSGRKLLPPMIMGVPCSFLEAC 593
           ++TI E F+P +I   + +    +WS  + DG +Y+ S +G+ L+P + +G        C
Sbjct: 671 QRTI-EAFIPNVIISGVGSPVSKYWSLATADGFIYIISYNGQLLIPKINLGQKVVKQVVC 729

Query: 594 GNFLLCVTSIGQVYCWNVDASRLLFPPTSLYPLLS 628
            N+LL +T  G  Y W++ A R +    S+ P+++
Sbjct: 730 SNYLLVLTERGLFYAWDISAKRSVIKNVSILPIIN 764

>YML102W (CAC2) [3869] chr13 (68294..69700) Chromatin assembly
           complex subunit 1, involved in nucleosome assembly
           linked with DNA replication, has WD (WD-40) repeats
           [1407 bp, 468 aa]
          Length = 468

 Score = 52.8 bits (125), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 51/105 (48%), Gaps = 4/105 (3%)

Query: 283 ICQFSPSLYEKVQKSGTKVTYNLAATSGFDTGSVVIWNTKRLKPLLNTKCTEDSFVTDLQ 342
           +  FSP  YE  QKS  K+ Y L       T  V++++T  L+PL        S +TDL 
Sbjct: 322 MAAFSPVFYETCQKSVLKLPYKLVFAIA-TTNEVLVYDTDVLEPLCVVGNIHYSPITDLA 380

Query: 343 WSDDGSTLFAVTNNGLLFIFAFRDE-ELGKTL--PKSHVDKLRSD 384
           WS+DGSTL   + +G     +   E + G  +  P  H + L +D
Sbjct: 381 WSEDGSTLLISSTDGFCSYVSIDTETQFGSRIEPPAMHAEPLDTD 425

>Kwal_27.10385
          Length = 536

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 49/199 (24%), Positives = 89/199 (44%), Gaps = 27/199 (13%)

Query: 271 RATLVGHFDK--CQICQFSPSLYEKVQKSGTKVTYNLAATSGFDTGS---VVIWNTKRLK 325
           R  +V  F K  C +  F+P  Y+   K  T+   NL     F   +   V++++++   
Sbjct: 313 RPAMVIPFLKKPCLVISFNPLYYKLATK--TQPYINLPYKLVFAVATSDEVLVFDSETTS 370

Query: 326 PLLNTKCTEDSFVTDLQWSDDGSTLFAVTNNGLLFIFAFRDEELGKTLPKSHVDKLRSDC 385
           P+        + +TDL WS DG  L   + +G     +F++  LG  + +S V K  +D 
Sbjct: 371 PICVIGNLHYTPITDLSWSQDGLMLMVSSTDGFCSYISFKEGTLGSQIGESVV-KTAND- 428

Query: 386 ATLSPLPPTEVPDLNQTIKPEIVAPGSSGVITKVNGKNKVAPT--TIRSLSMEFIAPSYS 443
                    + P++   + PE+ A  S+ V+  +  K K AP     +S S+  + P   
Sbjct: 429 --------VKAPEVPPEVLPEVPAKKSASVVNILPVKQK-APEVPAKKSASVVNVLP--- 476

Query: 444 VPKDLKRRPKDPLQATTNK 462
               +KR+  D  Q+++N+
Sbjct: 477 ----VKRKVPDSHQSSSNE 491

>KLLA0E11143g 983669..985150 similar to sp|Q04199 Saccharomyces
           cerevisiae YML102w CAC2 chromatin assembly complex,
           subunit p60, start by similarity
          Length = 493

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 41/91 (45%), Gaps = 2/91 (2%)

Query: 283 ICQFSPSLYEKVQKSGTKVTYNLAATSGFDTGSVVIWNTKRLKPLLNTKCTEDSFVTDLQ 342
           + +F+P +YE   +   K  Y L       T  V++++T+   P+        + +TDL 
Sbjct: 324 VVKFNPIMYETASE-WVKAPYTLVFAVA-TTNEVLVYDTQNTSPIAIAGNLHYTPITDLA 381

Query: 343 WSDDGSTLFAVTNNGLLFIFAFRDEELGKTL 373
           WS DG+ L   + +G      F D + G  L
Sbjct: 382 WSQDGTLLMISSTDGFCSYIHFTDNDFGTPL 412

>Sklu_2109.4 YOR254C, Contig c2109 4786-6762
          Length = 658

 Score = 38.1 bits (87), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 47/94 (50%), Gaps = 8/94 (8%)

Query: 361 IFAFRDEELGKTLPKSHVDKLRSDCATLSPLPPTEVPDLNQTIKPEIVAPGSSGVITKVN 420
           +F F D ++GK L     D+L+   A  S +P  ++      I+ E   PG S ++T ++
Sbjct: 387 LFTFDDSKIGKILGIEDEDQLKDTLAVASNIPHLKL------IRSEFKVPGES-MVTPLS 439

Query: 421 GKNKVAPTTIRSLSMEFIAPSYSVPKDLKRRPKD 454
             + V    +RS   +F  P+  +P+D+ + P D
Sbjct: 440 TPHIVLKVLVRSAKHKFFEPT-KIPEDMCKEPLD 472

>AER280C [2782] [Homologous to ScYML102W (CAC2) - SH]
           (1148956..1150488) [1533 bp, 510 aa]
          Length = 510

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 40/91 (43%), Gaps = 3/91 (3%)

Query: 283 ICQFSPSLY--EKVQKSGTKVTYNLAATSGFDTGSVVIWNTKRLKPLLNTKCTEDSFVTD 340
           + +FSP LY  E   +   ++ Y L       T  VVI++T   KP+        + +TD
Sbjct: 324 VVRFSPILYKIETGVEPWIQLPYKLVFAVATST-EVVIYDTVTTKPIAVVGNLHYTPLTD 382

Query: 341 LQWSDDGSTLFAVTNNGLLFIFAFRDEELGK 371
           L WSD G  L   + +G     +  D   G+
Sbjct: 383 LSWSDSGHLLVVSSTDGFCSYISMEDSLFGE 413

>CAGL0I09922g complement(947512..949017) similar to tr|Q12096
           Saccharomyces cerevisiae YOR320c, start by similarity
          Length = 501

 Score = 35.0 bits (79), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 40/82 (48%), Gaps = 5/82 (6%)

Query: 656 IVTLSNGDGYMYDKVMEVWMLINDSWWAYGSQYWDTTKTTTNGTYASEPNDKHDKKNQNW 715
           I+ L N D  + DK+ E++ L ND  +A    YW  ++     TY      +HDK + N 
Sbjct: 193 IIYLDN-DAILQDKMDELFFLPNDITFAAPLTYWFMSEKDLEKTYKEV---QHDKMSINL 248

Query: 716 NSEAKGLTESLKENKSSILNYL 737
           N   K L+  ++ N   I N+L
Sbjct: 249 NKYTKQLSNRIR-NGKEIYNHL 269

>Scas_512.3
          Length = 534

 Score = 34.3 bits (77), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 44/101 (43%), Gaps = 14/101 (13%)

Query: 283 ICQFSPSLY-------EKVQKSGTKVTYNL---AATSGFDTGSVVIWNTKRLKPLLNTKC 332
           +  F+P+ Y       E  +K   K+ Y L    ATS      V+I++T  +KP+     
Sbjct: 339 VVSFNPNFYKLTHEEQEGTKKPYLKLPYRLIYAVATSN----EVLIYDTVNVKPISIIGN 394

Query: 333 TEDSFVTDLQWSDDGSTLFAVTNNGLLFIFAFRDEELGKTL 373
              + +TDL WS DG+ L   + +G        +   G+ L
Sbjct: 395 LHYTALTDLSWSQDGNMLMVSSTDGFCSYITIEENLFGEKL 435

>KLLA0D11748g 1000988..1003369 similar to sp|Q03308 Saccharomyces
           cerevisiae YPL045w VPS16 vacuolar sorting protein
           singleton, start by similarity
          Length = 793

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 37/148 (25%), Positives = 64/148 (43%), Gaps = 10/148 (6%)

Query: 31  PRALHSGKIVGCACIGDNLVTAGQDSV-CVWSCSQLVGAAMG--NISAKEVR-EKFEIKV 86
           P+A+ + KI+      D  V+A  D +  +W    L  A+ G  ++S+ E    +F I  
Sbjct: 320 PKAIENLKIINLKKAVDECVSAAGDEINSIWQKRLLSAASFGKDSLSSTEFNASQFVITC 379

Query: 87  LEARLEPLRLVVGSDACLY----VGTDRTVLYADSLLEKGEKTSFQTLYHVEAPACVTDV 142
              R+      VG    L     +G +  VL   ++ +  E  S+Q + H++ P  +  V
Sbjct: 380 NYLRVLNFLKTVGIFLTLRQFISIGVEAIVLKLVNIRKIYE--SYQIIDHLKCPELIPVV 437

Query: 143 KFDFQTGTIFVLVNQGNEGNYVALLDAA 170
             ++  G I    + GNE  Y  + D A
Sbjct: 438 FNEWSKGKILTSPDSGNEALYQVVHDRA 465

>Scas_585.8
          Length = 460

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 29/115 (25%), Positives = 52/115 (45%), Gaps = 12/115 (10%)

Query: 272 ATLVGHFDKCQICQFSPSLYEKVQKSGTKVTYNLAA---TSGFDTGSVVIW--NTKRLKP 326
           AT  G F       F+ SL +    + + + Y+ A     SG   G + IW  N   +K 
Sbjct: 108 ATYNGEFSLWNGTSFNESLMQAHDSAVSCIQYSHAGDWMCSGDADGGIKIWQPNFNMVKE 167

Query: 327 LLN--TKCTEDSFVTDLQWSDDGSTLFAVTNNGLLFIFAFRDEELGKTLPKSHVD 379
             N  T+C     + D+ +S++ S     +++ +L I+ F + ++ +TL   H D
Sbjct: 168 FENAHTEC-----IRDISFSNNDSKFVTCSDDNVLKIWNFSNGQVERTLSGHHWD 217

>YJL141C (YAK1) [2777] chr10 complement(147885..150308)
           Serine/threonine protein kinase, negative regulator of
           cell growth acting in opposition to cAMP-dependent
           protein kinase A [2424 bp, 807 aa]
          Length = 807

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 30/65 (46%), Gaps = 9/65 (13%)

Query: 530 LKESGQEKTIFEDFLPKLITICTSGD------NFWSCCSDDGTVYVYSDSGRKLLPPMIM 583
           LKES   K I  D  P+ I +C          +F S C +  TVY Y  S     P +I+
Sbjct: 487 LKES---KLIHCDLKPENILLCAPDKPELKIIDFGSSCEEARTVYTYIQSRFYRAPEIIL 543

Query: 584 GVPCS 588
           G+P S
Sbjct: 544 GIPYS 548

>Sklu_2339.2 YLR422W, Contig c2339 3447-9347
          Length = 1966

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 38/82 (46%), Gaps = 3/82 (3%)

Query: 440 PSYSVPKDLKRRPKDPLQATTNKKQKHDLEPMDFLDTSLLMPTVSFSKVRLAAPKVRLSF 499
           P + +  D KRRP  PL    N    +++ PM  +  S +    SF +  +A     L+ 
Sbjct: 145 PQFKLLSDKKRRPPFPLFRLQNTGFLNEIAPMLGVLVSHIYSMYSFGEFEIAQ---NLTE 201

Query: 500 TYYPSTSDSLAISVKNGSGNEQ 521
            YY   S  L + +K  +GNE+
Sbjct: 202 LYYELDSIHLKLQLKLTTGNER 223

>CAGL0I05896g 560169..562505 some similarities with sp|P14680
           Saccharomyces cerevisiae YJL141c YAK1 ser/thr protein
           kinase, hypothetical start
          Length = 778

 Score = 32.0 bits (71), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 27/58 (46%), Gaps = 6/58 (10%)

Query: 537 KTIFEDFLPKLITICTSGD------NFWSCCSDDGTVYVYSDSGRKLLPPMIMGVPCS 588
           K I  D  P+ I +C+         +F S C +  TVY Y  S     P +I+G+P S
Sbjct: 483 KLIHCDLKPENILLCSPDKPDLKVIDFGSSCEETRTVYTYIQSRFYRAPEIILGIPYS 540

>KLLA0A01650g complement(146030..147235) similar to sp|Q02793
           Saccharomyces cerevisiae YGL213c SKI8 antiviral protein
           of the beta-transducin (WD-40) repeat family singleton,
           start by similarity
          Length = 401

 Score = 31.6 bits (70), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 58/122 (47%), Gaps = 15/122 (12%)

Query: 262 LDRKSGFKLRATLV--GHFD-KCQICQFSPSLYEKVQKSGTKVTYNLAATSGFDTGSVVI 318
           LD ++G  L  +LV   HF+ + +I   +P     V  S T+    L AT GF  GSVV+
Sbjct: 159 LDTETGEPLSNSLVYEPHFNFQGKINSQTPRFATAVDVSSTQ----LIAT-GFSDGSVVV 213

Query: 319 WNTKRLKPLLN-----TKCTEDSFVT--DLQWSDDGSTLFAVTNNGLLFIFAFRDEELGK 371
                L+P+ N      K  E+S  T  D+++S  GS L    ++G     +  + E G+
Sbjct: 214 SQLSTLRPVYNFEGFGLKGVEESSSTIRDIKFSPAGSLLAVAHDSGSYGCVSLYETEFGE 273

Query: 372 TL 373
            +
Sbjct: 274 RI 275

>ADR090W [1831] [Homologous to ScYDL195W (SEC31) - SH]
           complement(868744..872445) [3702 bp, 1233 aa]
          Length = 1233

 Score = 32.0 bits (71), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 23/54 (42%)

Query: 313 TGSVVIWNTKRLKPLLNTKCTEDSFVTDLQWSDDGSTLFAVTNNGLLFIFAFRD 366
           T ++  W     +       T D+   DL WS DG+ L     NG++  F  R+
Sbjct: 39  TATLEFWEVGSAESGPQGSVTADAKFNDLDWSRDGAMLAGALENGVVEFFCARE 92

>Scas_651.3
          Length = 793

 Score = 31.6 bits (70), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 27/58 (46%), Gaps = 6/58 (10%)

Query: 537 KTIFEDFLPKLITICTSGD------NFWSCCSDDGTVYVYSDSGRKLLPPMIMGVPCS 588
           K I  D  P+ I +C+         +F S C +  TVY Y  S     P +I+G+P S
Sbjct: 502 KLIHCDLKPENILLCSPDKPALKIIDFGSSCEETRTVYTYIQSRFYRAPEIILGIPYS 559

>Kwal_47.17567
          Length = 590

 Score = 30.8 bits (68), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 26/49 (53%), Gaps = 1/49 (2%)

Query: 333 TEDSFVTDLQWSDDGSTLFAVTNNGLLFIFAFRDEELGKTLPKSHVDKL 381
           T D+  T L W   GS L     NGL+ IF    ++  +T+P  H+D++
Sbjct: 324 TTDNEYTSLSWVGAGSHLAVGQTNGLVNIFDVEKKKCIRTIP-GHIDRV 371

>KLLA0D13838g complement(1189057..1190595) similar to sp|P40560
           Saccharomyces cerevisiae YIL001w singleton, start by
           similarity
          Length = 512

 Score = 30.4 bits (67), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 38/83 (45%), Gaps = 7/83 (8%)

Query: 480 MPTVSFSKVRLAAPKVRLSFTYYPSTSD--SLAISVKNGSGNEQTPTVITLKLKESGQEK 537
           +P VS S V L+  +V LS+ YY ST     +AI V   S    T  + T+      Q K
Sbjct: 330 VPIVSLSVVNLSVAEVVLSYLYYDSTDIPWEIAIDVLRTSDFILTDRLKTMAAVTITQSK 389

Query: 538 TIFEDFLPKLITICTSGDNFWSC 560
               +FL K  +I    D  WSC
Sbjct: 390 ----EFLTKY-SIFDVLDVAWSC 407

>Scas_678.22*
          Length = 860

 Score = 30.4 bits (67), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 33/70 (47%), Gaps = 17/70 (24%)

Query: 753 NLQKFAKTILMKEGYENLEEVVTLSHLENKL------------LVSLRLHEYEEFTKLLT 800
           N+ K+ + +   E YEN      + HLENKL             +  +  +YEE  K+L 
Sbjct: 498 NITKYKEALTKGEEYEN-----RIKHLENKLSALEEQKIANISALGTKDAQYEELEKILA 552

Query: 801 IYCIRLSEMG 810
              I++SE+G
Sbjct: 553 TKNIQISELG 562

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.134    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 29,058,912
Number of extensions: 1332849
Number of successful extensions: 4677
Number of sequences better than 10.0: 54
Number of HSP's gapped: 4799
Number of HSP's successfully gapped: 64
Length of query: 861
Length of database: 16,596,109
Length adjustment: 110
Effective length of query: 751
Effective length of database: 12,788,129
Effective search space: 9603884879
Effective search space used: 9603884879
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)