Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_55.2156337236718720.0
KLLA0E21923g37835411981e-165
YDR268W (MSW1)37936511621e-159
Sklu_1979.431429910861e-149
CAGL0M08624g33732910861e-148
ACR089C38935310791e-146
Scas_615.1037935310151e-137
AFR223W53493681.9
YGR100W (MDR1)95083638.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_55.21563
         (367 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_55.21563                                                         725   0.0  
KLLA0E21923g 1947496..1948632 similar to sp|P04803 Saccharomyces...   466   e-165
YDR268W (MSW1) [1101] chr4 (1003996..1005135) Tryptophanyl-tRNA ...   452   e-159
Sklu_1979.4 YDR268W, Contig c1979 7588-8532 reverse complement        422   e-149
CAGL0M08624g complement(859796..860809) highly similar to sp|P04...   422   e-148
ACR089C [1136] [Homologous to ScYDR268W (MSW1) - SH] (518154..51...   420   e-146
Scas_615.10                                                           395   e-137
AFR223W [3415] [Homologous to ScYLR033W (RSC58) - SH] complement...    31   1.9  
YGR100W (MDR1) [2060] chr7 (690247..693099) GTPase-activating pr...    29   8.8  

>Kwal_55.21563
          Length = 372

 Score =  725 bits (1872), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/367 (96%), Positives = 354/367 (96%)

Query: 1   MLRKPPSFVSVRLLSKTVKTTDYKINASDLPDNAVVFSMVQPTGKFHLGNYLGAVRVWKD 60
           MLRKPPSFVSVRLLSKTVKTTDYKINASDLPDNAVVFSMVQPTGKFHLGNYLGAVRVWKD
Sbjct: 1   MLRKPPSFVSVRLLSKTVKTTDYKINASDLPDNAVVFSMVQPTGKFHLGNYLGAVRVWKD 60

Query: 61  LCDQKAPSTQLMFGVADLHAITIPIPDGMKLRQSRREAMASILSVGVDPSKAVLFNQSRV 120
           LCDQKAPSTQLMFGVADLHAITIPIPDGMKLRQSRREAMASILSVGVDPSKAVLFNQSRV
Sbjct: 61  LCDQKAPSTQLMFGVADLHAITIPIPDGMKLRQSRREAMASILSVGVDPSKAVLFNQSRV 120

Query: 121 HQHTELHWLLSTLAPMGLLNRMTQWKSKSNLKNMSDEQALGTVKLGLFSYPVLQAADILL 180
           HQHTELHWLLSTLAPMGLLNRMTQWKSKSNLKNMSDEQALGTVKLGLFSYPVLQAADILL
Sbjct: 121 HQHTELHWLLSTLAPMGLLNRMTQWKSKSNLKNMSDEQALGTVKLGLFSYPVLQAADILL 180

Query: 181 YRSTHVPVGDDQAQHLELTRTLAQYFNKLYKRXXXXXXXXXXXXXKRILSLADIDSKMSK 240
           YRSTHVPVGDDQAQHLELTRTLAQYFNKLYKR             KRILSLADIDSKMSK
Sbjct: 181 YRSTHVPVGDDQAQHLELTRTLAQYFNKLYKRPILPLPTTILAPTKRILSLADIDSKMSK 240

Query: 241 SDQNQNATIYLNDEPDSIVKKIRKAVTDSNSKAFYYDPSSRPGVSNLINIVSGLQRQSIQ 300
           SDQNQNATIYLNDEPDSIVKKIRKAVTDSNSKAFYYDPSSRPGVSNLINIVSGLQRQSIQ
Sbjct: 241 SDQNQNATIYLNDEPDSIVKKIRKAVTDSNSKAFYYDPSSRPGVSNLINIVSGLQRQSIQ 300

Query: 301 QVEKDISRFNSHSEFKSYVSEVLVETLQGPRERFNLYMKDPDYLDKVFESGAENASKHAE 360
           QVEKDISRFNSHSEFKSYVSEVLVETLQGPRERFNLYMKDPDYLDKVFESGAENASKHAE
Sbjct: 301 QVEKDISRFNSHSEFKSYVSEVLVETLQGPRERFNLYMKDPDYLDKVFESGAENASKHAE 360

Query: 361 KSIKEIK 367
           KSIKEIK
Sbjct: 361 KSIKEIK 367

>KLLA0E21923g 1947496..1948632 similar to sp|P04803 Saccharomyces
           cerevisiae YDR268w MSW1 tryptophanyl-tRNA synthetase,
           mitochondrial singleton, start by similarity
          Length = 378

 Score =  466 bits (1198), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 222/354 (62%), Positives = 272/354 (76%)

Query: 14  LSKTVKTTDYKINASDLPDNAVVFSMVQPTGKFHLGNYLGAVRVWKDLCDQKAPSTQLMF 73
            + +VKTT +K+  SDLP NA +FS++QPTGKFHLGNYLGAVRVWKD+ D K   T L+F
Sbjct: 19  FNSSVKTTGFKLRESDLPKNATIFSLIQPTGKFHLGNYLGAVRVWKDITDLKDDGTTLLF 78

Query: 74  GVADLHAITIPIPDGMKLRQSRREAMASILSVGVDPSKAVLFNQSRVHQHTELHWLLSTL 133
           G ADLHAIT+P P+  + R  R EA+ASILS+G+DP KA++F+QSRV QHTELHWLLS+L
Sbjct: 79  GTADLHAITVPKPNAKEFRNYRIEAIASILSIGIDPEKAIVFHQSRVSQHTELHWLLSSL 138

Query: 134 APMGLLNRMTQWKSKSNLKNMSDEQALGTVKLGLFSYPVLQAADILLYRSTHVPVGDDQA 193
           A MG LNRMTQWKSKSN+ + SD+ ALG +KLGLFSYPVLQAADILLY+STHVPVGDDQ+
Sbjct: 139 ASMGSLNRMTQWKSKSNINDQSDDAALGAIKLGLFSYPVLQAADILLYKSTHVPVGDDQS 198

Query: 194 QHLELTRTLAQYFNKLYKRXXXXXXXXXXXXXKRILSLADIDSKMSKSDQNQNATIYLND 253
           QHLELTR L+  FNK YK              K+ILSL + + KMSKSD NQN+ IY+ D
Sbjct: 199 QHLELTRQLSNTFNKFYKTKYFPMPTTILAPTKKILSLLNPEKKMSKSDTNQNSVIYITD 258

Query: 254 EPDSIVKKIRKAVTDSNSKAFYYDPSSRPGVSNLINIVSGLQRQSIQQVEKDISRFNSHS 313
           EP+ I KKI++AVTDS S +FY+DP  RPG+SNLIN +SG+QR SI+ VEKDI+    H 
Sbjct: 259 EPEIIAKKIKRAVTDSISDSFYFDPVKRPGISNLINTLSGVQRVSIEDVEKDIAHIKDHK 318

Query: 314 EFKSYVSEVLVETLQGPRERFNLYMKDPDYLDKVFESGAENASKHAEKSIKEIK 367
           +FK +V++VLVE L   RE+F+ YMK+PDYL KV E GA  A + A K+I EIK
Sbjct: 319 DFKQHVTDVLVEELAPSREQFHRYMKNPDYLHKVSEDGASKAREIAAKNITEIK 372

>YDR268W (MSW1) [1101] chr4 (1003996..1005135) Tryptophanyl-tRNA
           synthetase, mitochondrial, member of class I family of
           aminoacyl-tRNA synthetases [1140 bp, 379 aa]
          Length = 379

 Score =  452 bits (1162), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 220/365 (60%), Positives = 274/365 (75%), Gaps = 7/365 (1%)

Query: 8   FVSVRLLSKTVKTTDYKINASDLPDNAVVFSMVQPTGKFHLGNYLGAVRVWKDLCDQKAP 67
            +S R +S TV+  D+K+N+  L  NA VFSM+QPTG FHLGNYLGA RVW DLC+ K P
Sbjct: 10  LISKRWIS-TVQRADFKLNSEALHSNATVFSMIQPTGCFHLGNYLGATRVWTDLCELKQP 68

Query: 68  STQLMFGVADLHAITIPIPDGMKLRQSRREAMASILSVGVDPSKAVLFNQSRVHQHTELH 127
             +L+FGVADLHAIT+P PDG   R+ R EA+ASIL+VGVDP KA +  QS + QH+ELH
Sbjct: 69  GQELIFGVADLHAITVPKPDGEMFRKFRHEAVASILAVGVDPEKASVIYQSAIPQHSELH 128

Query: 128 WLLSTLAPMGLLNRMTQWKSKSNLKN------MSDEQALGTVKLGLFSYPVLQAADILLY 181
           WLLSTLA MGLLNRMTQWKSKSN+K       + ++  +G V+LGLFSYPVLQAADILLY
Sbjct: 129 WLLSTLASMGLLNRMTQWKSKSNIKQSTNGDYLVNDSDVGKVRLGLFSYPVLQAADILLY 188

Query: 182 RSTHVPVGDDQAQHLELTRTLAQYFNKLYKRXXXXXXXXXXXXXKRILSLADIDSKMSKS 241
           +STHVPVGDDQ+QHLELTR LA+ FNK+YK+             K++LSL+  + KMSKS
Sbjct: 189 KSTHVPVGDDQSQHLELTRHLAEKFNKMYKKNFFPKPVTMLAQTKKVLSLSTPEKKMSKS 248

Query: 242 DQNQNATIYLNDEPDSIVKKIRKAVTDSNSKAFYYDPSSRPGVSNLINIVSGLQRQSIQQ 301
           D N ++ I+LNDEP +I KKIRKA+TDS S  FYYDP  RPGVSNLINIVSG+QR+SI+ 
Sbjct: 249 DPNHDSVIFLNDEPKAIQKKIRKALTDSISDRFYYDPVERPGVSNLINIVSGIQRKSIED 308

Query: 302 VEKDISRFNSHSEFKSYVSEVLVETLQGPRERFNLYMKDPDYLDKVFESGAENASKHAEK 361
           V +D+SRFN++ +FK YVSEV++E L+GPR  F  Y+ +P YL  V ESG   A + A K
Sbjct: 309 VVEDVSRFNNYRDFKDYVSEVIIEELKGPRTEFEKYINEPTYLHSVVESGMRKAREKAAK 368

Query: 362 SIKEI 366
           ++ +I
Sbjct: 369 NLADI 373

>Sklu_1979.4 YDR268W, Contig c1979 7588-8532 reverse complement
          Length = 314

 Score =  422 bits (1086), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 203/299 (67%), Positives = 244/299 (81%), Gaps = 2/299 (0%)

Query: 7   SFVSVRLLSKTVKTTDYKINASDLPDNAVVFSMVQPTGKFHLGNYLGAVRVWKDLCDQKA 66
           S +S R L+ TVKTTDY +++ D+PD + +FS++QPTGKFHLGNYLGAVRVWKDLCD   
Sbjct: 7   SSISKRFLT-TVKTTDYTLHSHDIPDKSTIFSLIQPTGKFHLGNYLGAVRVWKDLCDTDL 65

Query: 67  PSTQLMFGVADLHAITIPIPDGMKLRQSRREAMASILSVGVDPSKAVLFNQSRVHQHTEL 126
             ++L+FGVADLHAITIP P+  + RQ R EA+ASILS+G+DP KA++F+QS+VHQH EL
Sbjct: 66  DESKLLFGVADLHAITIPKPNSSEFRQYRTEAIASILSIGIDPKKAIIFHQSQVHQHAEL 125

Query: 127 HWLLSTLAPMGLLNRMTQWKSKSNLK-NMSDEQALGTVKLGLFSYPVLQAADILLYRSTH 185
           HW+LST+AP+G LNRMTQWKSKSNL+ + SD +ALG VKLGLF+YPVLQAADILLY STH
Sbjct: 126 HWILSTIAPVGYLNRMTQWKSKSNLRQDASDAEALGNVKLGLFAYPVLQAADILLYHSTH 185

Query: 186 VPVGDDQAQHLELTRTLAQYFNKLYKRXXXXXXXXXXXXXKRILSLADIDSKMSKSDQNQ 245
           VPVGDDQ+QHLELTR LAQ FNKLYK+             K+ILSLA    KMSKSD NQ
Sbjct: 186 VPVGDDQSQHLELTRFLAQQFNKLYKKSYFPLPTTILAPTKKILSLASPGKKMSKSDANQ 245

Query: 246 NATIYLNDEPDSIVKKIRKAVTDSNSKAFYYDPSSRPGVSNLINIVSGLQRQSIQQVEK 304
           N+ IYLND+P++I KKI+KAVTDS S  F YDP +RPGVSNLINIVSG+QR+SI +VEK
Sbjct: 246 NSVIYLNDDPETISKKIKKAVTDSISHEFKYDPENRPGVSNLINIVSGIQRRSIAEVEK 304

>CAGL0M08624g complement(859796..860809) highly similar to sp|P04803
           Saccharomyces cerevisiae YDR268w MSW1 tryptophanyl-tRNA
           synthetase, mitochondrial, start by similarity
          Length = 337

 Score =  422 bits (1086), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 199/329 (60%), Positives = 253/329 (76%), Gaps = 2/329 (0%)

Query: 39  MVQPTGKFHLGNYLGAVRVWKDLCDQKAPSTQLMFGVADLHAITIPIPDGMKLRQSRREA 98
           MVQPTGKFHLGNYLGA RVWKDLCD K P  +L+FGVADLHAITIP PD  + +Q RREA
Sbjct: 1   MVQPTGKFHLGNYLGATRVWKDLCDIKQPGQRLIFGVADLHAITIPKPDAAQFKQLRREA 60

Query: 99  MASILSVGVDPSKAVLFNQSRVHQHTELHWLLSTLAPMGLLNRMTQWKSKSNLKNMSDEQ 158
           +ASIL+VGVDP++A +  QS +  H++L+WLLST+APMG LNRMTQWKSKSNL+   D  
Sbjct: 61  IASILAVGVDPARASIMYQSAIPAHSQLYWLLSTVAPMGYLNRMTQWKSKSNLREDKDAT 120

Query: 159 A--LGTVKLGLFSYPVLQAADILLYRSTHVPVGDDQAQHLELTRTLAQYFNKLYKRXXXX 216
           A  LG VKLGLF YPVLQAADILLY++THVPVGDDQ QHLELTRTLA+ FNKLYK+    
Sbjct: 121 AKELGEVKLGLFGYPVLQAADILLYKATHVPVGDDQVQHLELTRTLAENFNKLYKKQVFP 180

Query: 217 XXXXXXXXXKRILSLADIDSKMSKSDQNQNATIYLNDEPDSIVKKIRKAVTDSNSKAFYY 276
                    K+ILSL     KMSKSD NQ+  IY+ND P++I++KI+KA TDS +  FYY
Sbjct: 181 LPRTLLAPTKKILSLTHDTKKMSKSDPNQDGVIYVNDPPETIIRKIKKARTDSITDKFYY 240

Query: 277 DPSSRPGVSNLINIVSGLQRQSIQQVEKDISRFNSHSEFKSYVSEVLVETLQGPRERFNL 336
           DP  RPG+SNLINIVSG+ +Q +  VE+++ +F+++ + K++VSEV++E L+ PRE+F+ 
Sbjct: 241 DPVHRPGLSNLINIVSGITKQPVHAVEQELQKFDNYRDLKAHVSEVIIEELRVPREKFHQ 300

Query: 337 YMKDPDYLDKVFESGAENASKHAEKSIKE 365
           YM+DP +LD   + G + AS+ A  ++KE
Sbjct: 301 YMEDPQFLDDTVQQGTQRASEIAASTMKE 329

>ACR089C [1136] [Homologous to ScYDR268W (MSW1) - SH]
           (518154..519323) [1170 bp, 389 aa]
          Length = 389

 Score =  420 bits (1079), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 198/353 (56%), Positives = 256/353 (72%), Gaps = 1/353 (0%)

Query: 15  SKTVKTTDYKINASDLPDNAVVFSMVQPTGKFHLGNYLGAVRVWKDLCDQKAPSTQLMFG 74
           + T++  DY   +  LPD AVVFS++QPTGKFHLGNYLGAVRVW +L +      + +FG
Sbjct: 33  ASTIQNIDYANRSLKLPDGAVVFSLIQPTGKFHLGNYLGAVRVWTELSEDAPAGGKCIFG 92

Query: 75  VADLHAITIPIPDGMKLRQSRREAMASILSVGVDPSKAVLFNQSRVHQHTELHWLLSTLA 134
            ADLHAITIP PDG   RQ R EA+AS+L+VG+DP+K++LF+QS+V +H EL W LSTL 
Sbjct: 93  TADLHAITIPKPDGNAFRQMRHEAIASLLAVGIDPTKSILFHQSQVPEHAELCWYLSTLT 152

Query: 135 PMGLLNRMTQWKSKSNLKNMSDEQALGTVKLGLFSYPVLQAADILLYRSTHVPVGDDQAQ 194
            MG LNRMTQWK+K+N+K+ S E+ +G VKLGLF+YPVLQAAD+LLY+STH+PVG+DQ Q
Sbjct: 153 SMGALNRMTQWKTKANIKDTSSEK-VGAVKLGLFTYPVLQAADVLLYKSTHIPVGEDQVQ 211

Query: 195 HLELTRTLAQYFNKLYKRXXXXXXXXXXXXXKRILSLADIDSKMSKSDQNQNATIYLNDE 254
            LELTR LAQ FN  YK              +++LSL +   KMSKSD NQN+ I + DE
Sbjct: 212 QLELTRQLAQAFNSTYKTRYFREPTTLLTPTRKVLSLQNPLKKMSKSDANQNSCICVTDE 271

Query: 255 PDSIVKKIRKAVTDSNSKAFYYDPSSRPGVSNLINIVSGLQRQSIQQVEKDISRFNSHSE 314
           PD+I +KIR AVTDS    F YDP  RPGVSNLINIV+G+Q+++I  VE DI+ F  H+ 
Sbjct: 272 PDAIRRKIRSAVTDSIGHEFKYDPEGRPGVSNLINIVAGIQKKTIAAVEADIAGFKDHAT 331

Query: 315 FKSYVSEVLVETLQGPRERFNLYMKDPDYLDKVFESGAENASKHAEKSIKEIK 367
           FK+YV+++LV  L+GPRE F  YM D  Y+ +V  +GAE A   A K++ E++
Sbjct: 332 FKNYVTDILVAELRGPREEFARYMNDKSYIYEVERNGAERAGAIAAKTLAEVR 384

>Scas_615.10
          Length = 379

 Score =  395 bits (1015), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 191/353 (54%), Positives = 253/353 (71%), Gaps = 10/353 (2%)

Query: 17  TVKTTDYKIN--ASDLPDNAVVFSMVQPTGKFHLGNYLGAVRVWKDLCDQKAPSTQLMFG 74
           TV+ TDY +   +  LP +A +FS++QPTGKFHLGNYLGA R+WK +   K P+   +FG
Sbjct: 28  TVQNTDYALQDISQTLPSDATIFSLIQPTGKFHLGNYLGATRIWKQISQSKQPTQTAIFG 87

Query: 75  VADLHAITIPIPDGMKLRQSRREAMASILSVGVDPSKAVLFNQSRVHQHTELHWLLSTLA 134
           VADLHAIT+P PD M+  Q RREA+ASILS+G+DP  A++  QS V QHT+LHW+LST  
Sbjct: 88  VADLHAITVPKPDPMEFLQCRREALASILSLGIDPQNAIMMYQSEVPQHTQLHWVLSTFT 147

Query: 135 PMGLLNRMTQWKSKSNLKNMSDEQALGTVKLGLFSYPVLQAADILLYRSTHVPVGDDQAQ 194
            MG+LNRMTQWK+K+   +MS       VKLGLFSYPVLQAADILLY++THVPVGDDQ Q
Sbjct: 148 SMGVLNRMTQWKAKAKSNHMS-------VKLGLFSYPVLQAADILLYKATHVPVGDDQCQ 200

Query: 195 HLELTRTLAQYFNKLYK-RXXXXXXXXXXXXXKRILSLADIDSKMSKSDQNQNATIYLND 253
            LEL R++AQ FN+ Y                K+ILSL D   KMSKSD N+++ IY+ND
Sbjct: 201 PLELCRSIAQQFNQFYGDENFFPIPRTILAPTKKILSLGDPLKKMSKSDPNKDSNIYVND 260

Query: 254 EPDSIVKKIRKAVTDSNSKAFYYDPSSRPGVSNLINIVSGLQRQSIQQVEKDISRFNSHS 313
             D IVKKIRKAVTDS +    +DP +RPGVSNL+N+VSG+ ++ +  VE+++S  +   
Sbjct: 261 AADVIVKKIRKAVTDSVTGPITFDPVNRPGVSNLLNMVSGITQREMSAVEQEVSHLSHLG 320

Query: 314 EFKSYVSEVLVETLQGPRERFNLYMKDPDYLDKVFESGAENASKHAEKSIKEI 366
           EFK+YV+E++VE L+GPRER+   M +P+YL +V + GAE A   AE +++++
Sbjct: 321 EFKNYVAEIVVEELRGPRERYEQLMNEPEYLKQVGDQGAERARAIAEVNMRQV 373

>AFR223W [3415] [Homologous to ScYLR033W (RSC58) - SH]
           complement(838660..838715,838783..840331) [1605 bp, 534
           aa]
          Length = 534

 Score = 30.8 bits (68), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 23/93 (24%), Positives = 40/93 (43%), Gaps = 3/93 (3%)

Query: 13  LLSKTVKTTDYKINASDLPDNAVVFSMVQPTGKFHLGNYLGAVRV-WKDLCDQKAPSTQL 71
           L S T+ ++       DLP++    + + P    HL N LG V     ++ D   P T++
Sbjct: 184 LFSSTISSSPLDERPPDLPNSNFEVTKIIPHTGLHLSNKLGYVAANTSNIPDPTLPPTEM 243

Query: 72  MFGVADLHAITIPIPDGMKLRQSRREAMASILS 104
           M     LH     +P  + L+    E+ A  ++
Sbjct: 244 MTKF--LHPNWYALPTTLWLKYGGYESFAPTIT 274

>YGR100W (MDR1) [2060] chr7 (690247..693099) GTPase-activating
           protein for Ypt6p and Sec4p [2853 bp, 950 aa]
          Length = 950

 Score = 28.9 bits (63), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 41/83 (49%), Gaps = 6/83 (7%)

Query: 261 KIRKAVTDSNSKAFYYDPSSRPGVSNLINIVSGLQRQSIQQVEKDISRFNSHSEFKSYVS 320
           ++R  + +  S A Y   ++      ++N  +G   Q+I ++EKD+ R  S  E+ +Y +
Sbjct: 248 RMRGEIWELCSGAMYMRYANSGEYERILNENAGKTSQAIDEIEKDLKR--SLPEYSAYQT 305

Query: 321 EVLVETLQGPRERFNLY-MKDPD 342
           E   E +Q  R     Y  K+PD
Sbjct: 306 E---EGIQRLRNVLTAYSWKNPD 325

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.131    0.368 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 11,172,814
Number of extensions: 445393
Number of successful extensions: 1485
Number of sequences better than 10.0: 17
Number of HSP's gapped: 1502
Number of HSP's successfully gapped: 17
Length of query: 367
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 264
Effective length of database: 13,030,455
Effective search space: 3440040120
Effective search space used: 3440040120
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 62 (28.5 bits)