Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_55.2156134934517650.0
KLLA0E21901g3573058301e-109
ACR090C3663067791e-102
YOR037W (CYC2)3663097751e-101
Scas_699.413183036132e-77
CAGL0I00990g3433055761e-71
KLLA0D04488g2962881293e-08
Kwal_23.54713122861038e-05
CAGL0E06424g298219940.001
Scas_678.6299288900.003
KLLA0F27621g281145870.006
Sklu_2260.2350114850.013
Kwal_47.18159287222830.018
ACR054C306286830.024
ADL087W287150820.026
YIL043C (CBR1)322114810.035
YKL150W (MCR1)302282730.40
CAGL0B02519g312113720.46
YML087C31294720.46
Sklu_2184.2310113700.77
Scas_704.43316115700.92
AFR439C31060681.5
Scas_692.631486671.8
Kwal_23.593536533644.3
YML125C31289644.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_55.21561
         (345 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_55.21561                                                         684   0.0  
KLLA0E21901g 1946190..1947263 similar to sp|P38909 Saccharomyces...   324   e-109
ACR090C [1137] [Homologous to ScYOR037W (CYC2) - SH] (519431..52...   304   e-102
YOR037W (CYC2) [4849] chr15 (401554..402654) Cytochrome c mitoch...   303   e-101
Scas_699.41                                                           240   2e-77
CAGL0I00990g complement(81437..82468) similar to sp|P38909 Sacch...   226   1e-71
KLLA0D04488g complement(381861..382751) similar to sp|P36060 Sac...    54   3e-08
Kwal_23.5471                                                           44   8e-05
CAGL0E06424g 644026..644922 similar to sp|P36060 Saccharomyces c...    41   0.001
Scas_678.6                                                             39   0.003
KLLA0F27621g complement(2560055..2560900) similar to sp|P38626 S...    38   0.006
Sklu_2260.2 YIL043C, Contig c2260 2185-3237                            37   0.013
Kwal_47.18159                                                          37   0.018
ACR054C [1102] [Homologous to ScYKL150W (MCR1) - SH] (454023..45...    37   0.024
ADL087W [1654] [Homologous to ScYIL043C (CBR1) - SH] complement(...    36   0.026
YIL043C (CBR1) [2624] chr9 complement(274071..275039) Cytochrome...    36   0.035
YKL150W (MCR1) [3118] chr11 (166549..167457) NADH-cytochrome b5 ...    33   0.40 
CAGL0B02519g 240486..241424 highly similar to sp|Q12746 Saccharo...    32   0.46 
YML087C (YML087C) [3882] chr13 complement(94431..95369) Protein ...    32   0.46 
Sklu_2184.2 YML125C, Contig c2184 1732-2664 reverse complement         32   0.77 
Scas_704.43                                                            32   0.92 
AFR439C [3631] [Homologous to ScYML125C - SH; ScYML087C - SH] (1...    31   1.5  
Scas_692.6                                                             30   1.8  
Kwal_23.5935                                                           29   4.3  
YML125C (YML125C) [3847] chr13 complement(20762..21700) Protein ...    29   4.6  

>Kwal_55.21561
          Length = 349

 Score =  684 bits (1765), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/345 (96%), Positives = 333/345 (96%)

Query: 1   MWRRPLVARIRSNLVGTEQLRRGFYAKCXXXXXXXXXXXXVWYYKKYHSNVELSQEYFTQ 60
           MWRRPLVARIRSNLVGTEQLRRGFYAKC            VWYYKKYHSNVELSQEYFTQ
Sbjct: 1   MWRRPLVARIRSNLVGTEQLRRGFYAKCLLGGTIITGFGGVWYYKKYHSNVELSQEYFTQ 60

Query: 61  YRISYNQKIDSEHFILELTPIRPQSTNMWALMKSDKLWSVQVKQPEIMVVRNYTPLPLQH 120
           YRISYNQKIDSEHFILELTPIRPQSTNMWALMKSDKLWSVQVKQPEIMVVRNYTPLPLQH
Sbjct: 61  YRISYNQKIDSEHFILELTPIRPQSTNMWALMKSDKLWSVQVKQPEIMVVRNYTPLPLQH 120

Query: 121 VGSGEFKVLADGDNGQGKLSFYLKKYQYGEVARWLSRLPEGHILELRGPYIDYEFPSMDN 180
           VGSGEFKVLADGDNGQGKLSFYLKKYQYGEVARWLSRLPEGHILELRGPYIDYEFPSMDN
Sbjct: 121 VGSGEFKVLADGDNGQGKLSFYLKKYQYGEVARWLSRLPEGHILELRGPYIDYEFPSMDN 180

Query: 181 GEKLDRSFLWGAKPSSDKLMIQPFDISAFTAGTGIAPIMQLLLTEFPFRGRIHLFHSCRQ 240
           GEKLDRSFLWGAKPSSDKLMIQPFDISAFTAGTGIAPIMQLLLTEFPFRGRIHLFHSCRQ
Sbjct: 181 GEKLDRSFLWGAKPSSDKLMIQPFDISAFTAGTGIAPIMQLLLTEFPFRGRIHLFHSCRQ 240

Query: 241 KSELGPLGPILDVLRENNRVELNFFESSKGRDIRQISNEVLNLIDSPSQYLKRPFTGFEG 300
           KSELGPLGPILDVLRENNRVELNFFESSKGRDIRQISNEVLNLIDSPSQYLKRPFTGFEG
Sbjct: 241 KSELGPLGPILDVLRENNRVELNFFESSKGRDIRQISNEVLNLIDSPSQYLKRPFTGFEG 300

Query: 301 PIKPVLSLICGPDSYITTISGPKYDHFQGPIEGLLGQKGWSNQNV 345
           PIKPVLSLICGPDSYITTISGPKYDHFQGPIEGLLGQKGWSNQNV
Sbjct: 301 PIKPVLSLICGPDSYITTISGPKYDHFQGPIEGLLGQKGWSNQNV 345

>KLLA0E21901g 1946190..1947263 similar to sp|P38909 Saccharomyces
           cerevisiae YOR037w CYC2 cytochrome-c mitochondrial
           import factor singleton, hypothetical start
          Length = 357

 Score =  324 bits (830), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 157/305 (51%), Positives = 213/305 (69%), Gaps = 3/305 (0%)

Query: 43  YYKKYHSNVELSQEYFTQYRISYNQKIDSEHFILELTPIRPQSTNMWALMKSDKLWSVQV 102
           YYK+     ELS++YF++Y+IS    ID +H+++ELTP++ Q  N+W  M S KLWSV+V
Sbjct: 50  YYKESLYQRELSRDYFSKYKISKKYSIDQDHYLIELTPLKAQKVNLWKEMNSSKLWSVEV 109

Query: 103 KQPEIMVVRNYTPLPLQHVGSGEFKVLADGDNGQGKLSFYLKKYQYGEVARWLSRLPEGH 162
           KQPEIMVVR+YTPLPL    +G  +VL D +N  G L+FY+K+Y+ GEVARW++ LP GH
Sbjct: 110 KQPEIMVVRSYTPLPLTIEENGAVEVLRDEENASGALTFYIKQYKQGEVARWINHLPLGH 169

Query: 163 ILELRGPYIDYEFPSMDNGEKLDRSFLWGAKPS-SDKLMIQPFDISAFTAGTGIAPIMQL 221
           +LELRGP+++YEFP   +    DRSFLWG +    D    QPFDI  FT GTGI P++Q+
Sbjct: 170 VLELRGPFVEYEFPDTADEITRDRSFLWGNEDCVKDNYKYQPFDILFFTGGTGIVPLLQM 229

Query: 222 LLTEFPFRGRIHLFHSCRQKSELGPLGPILDVLRENNRVELNFFESSKGRDIRQISNEVL 281
            LTE PFRG+I  +HSC+  +ELGPL  IL  L++N+R+EL+  ES++   I   S+  +
Sbjct: 230 TLTESPFRGKIGAYHSCKSLTELGPLNSILTKLQDNDRIELHTHESNR-ISIPLQSDPAM 288

Query: 282 NLIDSPSQY-LKRPFTGFEGPIKPVLSLICGPDSYITTISGPKYDHFQGPIEGLLGQKGW 340
             I SP  Y    PFT  +  ++PVLSL+CGP  +I+T+SGPKYD  QGPI+G+L  +GW
Sbjct: 289 EGIPSPYPYGGNEPFTSLDSKVRPVLSLVCGPGGFISTVSGPKYDLVQGPIKGILAARGW 348

Query: 341 SNQNV 345
            N NV
Sbjct: 349 DNSNV 353

>ACR090C [1137] [Homologous to ScYOR037W (CYC2) - SH]
           (519431..520531) [1101 bp, 366 aa]
          Length = 366

 Score =  304 bits (779), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 152/306 (49%), Positives = 207/306 (67%), Gaps = 4/306 (1%)

Query: 42  WYYKKYHSNVELSQEYFTQYRISYNQKIDSEHFILELTPIRPQSTNMWALMKSDKLWSVQ 101
           ++ + YH+  ELSQEYFT+Y+ISY + ID +H++LELTP++ Q  N+WAL  +  LW+V+
Sbjct: 59  YHRRNYHA--ELSQEYFTKYKISYRKDIDIDHYLLELTPLKQQRNNIWALFGARNLWAVE 116

Query: 102 VKQPEIMVVRNYTPLPLQHVGSGE-FKVLADGDNGQGKLSFYLKKYQYGEVARWLSRLPE 160
           +KQPEIMVVR YTPLPL     GE  + L DGDNG GKL  Y+K+Y  GEVARWL +LP+
Sbjct: 117 IKQPEIMVVRQYTPLPLVADEDGEQLRALRDGDNGGGKLMLYIKEYGSGEVARWLRKLPK 176

Query: 161 GHILELRGPYIDYEFPSMDNGEKLDRSFL-WGAKPSSDKLMIQPFDISAFTAGTGIAPIM 219
           GHI+E+RGPY ++EFP +D   K DR F   G    +      PFDI+ F AGTGI   +
Sbjct: 177 GHIVEVRGPYPEFEFPELDADTKRDREFSGRGRACVAAAARAGPFDIALFAAGTGIVTAL 236

Query: 220 QLLLTEFPFRGRIHLFHSCRQKSELGPLGPILDVLRENNRVELNFFESSKGRDIRQISNE 279
           QLL TE PF+G+I LF+SC+   +LGPLG +L    +++RV+L+ FES KG  +R   ++
Sbjct: 237 QLLTTEDPFKGKIQLFYSCKSWGQLGPLGDLLRRCAQHDRVDLHVFESEKGESLRLGLSK 296

Query: 280 VLNLIDSPSQYLKRPFTGFEGPIKPVLSLICGPDSYITTISGPKYDHFQGPIEGLLGQKG 339
           + +L+  P  + +          +PVLSL+CGPD YI  I+GP++   QGP+ GLLG KG
Sbjct: 297 ISDLVSGPFPFSENAPFEQRPKAEPVLSLVCGPDDYIAFIAGPRHGLSQGPVTGLLGTKG 356

Query: 340 WSNQNV 345
           W N NV
Sbjct: 357 WDNSNV 362

>YOR037W (CYC2) [4849] chr15 (401554..402654) Cytochrome c
           mitochondrial import factor, primarily involved in
           import of Cyc1p and also involved in import of Cyc7p
           [1101 bp, 366 aa]
          Length = 366

 Score =  303 bits (775), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 158/309 (51%), Positives = 209/309 (67%), Gaps = 20/309 (6%)

Query: 52  ELSQEYFTQYRISYNQKIDSEHFILELTPIRPQSTNMWALMKSDKLWSVQVKQPEIMVVR 111
           ELS  YF +Y+IS+ + IDS HF+LE+TP+  Q  N+W+LM ++ LWSV++KQPE+MVVR
Sbjct: 59  ELSPSYFVKYKISHKRDIDSSHFLLEVTPLFKQKVNIWSLMTAENLWSVEIKQPEVMVVR 118

Query: 112 NYTPLPLQ-HVGSGEFKVLADGDNGQGKLSFYLKKYQYGEVARWLSRLPEGHILELRGPY 170
           NYTPLPL+ +  S E ++L DGDN  GKLSFY+KKY+ GEVARWL  LP+GHI+E+RGP+
Sbjct: 119 NYTPLPLKFNPASKEIEILKDGDNADGKLSFYIKKYENGEVARWLHHLPKGHIIEIRGPF 178

Query: 171 IDYEFPSMDNGEKLDRSFLWGAKPS--------SDKLMIQPFDISAFTAGTGIAPIMQLL 222
           IDYEFP + N  K  R  L+    +        + + + QP+DI  FTAGTGI   +QLL
Sbjct: 179 IDYEFPHLPNELKRSRDCLYMDNRNERGNNVRENSQFIYQPYDIMMFTAGTGIVTALQLL 238

Query: 223 LTEFPFRGRIHLFHSCRQKSELGPLGPILDVLRENNRVELNFFESSKGRDIRQISNEVLN 282
           LTE PFRG I LFH+ +   +LGPL PIL  L+ +NRV+L  FE+      RQ   +VL 
Sbjct: 239 LTESPFRGTIKLFHTDKNIKQLGPLYPILLRLQASNRVQLKIFETD-----RQTKQDVLK 293

Query: 283 LID----SPSQYLK-RPFTGFEGP-IKPVLSLICGPDSYITTISGPKYDHFQGPIEGLLG 336
            I      P  Y    PF+      I PVL+L+CGP+SYI++ISG KYD  QGP+ GLL 
Sbjct: 294 SIQKSITKPYPYKGLLPFSNVNNKNIMPVLALVCGPESYISSISGRKYDLNQGPVGGLLS 353

Query: 337 QKGWSNQNV 345
           ++GW++ NV
Sbjct: 354 KEGWNSDNV 362

>Scas_699.41
          Length = 318

 Score =  240 bits (613), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 133/303 (43%), Positives = 174/303 (57%), Gaps = 35/303 (11%)

Query: 49  SNVELSQEYFTQYRISYNQKIDSEHFILELTPIRPQSTNMWALMKSDKLWSVQVKQPEIM 108
           S  ELS  +FT Y+ISY Q ID+ H++LELTP  PQ TN+W  +  + +WSV++KQPEIM
Sbjct: 41  SRTELSPTHFTPYKISYRQDIDASHYLLELTPSNPQKTNIWEQIPRNVIWSVEIKQPEIM 100

Query: 109 VVRNYTPLPLQHVGSGEFKVLADGDNGQGKLSFYLKKYQYGEVARWLSRLPEGHILELRG 168
           VVRNYTP+PL  V      +     N  GKL FYLK+Y  GEVARWL RLP    +E+RG
Sbjct: 101 VVRNYTPVPLSFVQDHNDLIPMTDKNDTGKLVFYLKQYSNGEVARWLHRLPVNSTVEIRG 160

Query: 169 PYIDYEFPSMDNGEKLDRSFLWGAKPSSDKLMIQPFDISAFTAGTGIAPIMQLLL---TE 225
           P+IDY+F   DN +                     FD+S FTAG G+    QLLL   ++
Sbjct: 161 PFIDYKFQETDNTK---------------------FDVSMFTAGAGVVTAFQLLLSPSSK 199

Query: 226 FPFRGRIHLFHSCRQKSELGPLGPILDVLRENNR-VELNFFESSKGRDIRQISNEVLNLI 284
             FRG + LFHSC   +ELGPL  I+  L+ +N  +++ FFES KG DIR     V  L 
Sbjct: 200 NDFRGSVRLFHSCGSLNELGPLKKIMFSLQHDNGPIDMKFFESEKGDDIRTQLKSVSQLF 259

Query: 285 D--SPSQYLKRPFTGFEGPIKPVLSLICGPDSYITTISGPKYDHFQGPIEGLLGQKGWSN 342
               PSQ  +             L+L+CGP+ +I T++G   D  QGP+ G+L Q GW  
Sbjct: 260 PQFKPSQLGRSNLRQ--------LALVCGPEGFIDTVAGASVDLEQGPVGGILKQNGWPR 311

Query: 343 QNV 345
           +NV
Sbjct: 312 ENV 314

>CAGL0I00990g complement(81437..82468) similar to sp|P38909
           Saccharomyces cerevisiae YOR037w CYC2, hypothetical
           start
          Length = 343

 Score =  226 bits (576), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 130/305 (42%), Positives = 180/305 (59%), Gaps = 21/305 (6%)

Query: 43  YYKKYHSNVELSQEYFTQYRISYNQKIDSEHFILELTPIRPQSTNMWALMKSDKLWSVQV 102
           Y + +    ELS   FT+Y+I+    ID+ H+++ELTP++ Q+ N+W  ++ + LWS++V
Sbjct: 54  YVETFTKTKELSPNDFTEYKITRRHDIDNCHYLIELTPLKRQNVNLWKELERNILWSIEV 113

Query: 103 KQPEIMVVRNYTPLPLQHVGSGEFKVLADGDNGQG-KLSFYLKKYQYGEVARWLSRLPEG 161
           KQPEIMVVRNYTPLPLQ   +G    L   D  +  KL FY+K Y  GEVARW+  LP G
Sbjct: 114 KQPEIMVVRNYTPLPLQLKSNGNIVPLDLNDPVESKKLLFYIKSYNNGEVARWIKSLPVG 173

Query: 162 HILELRGPYIDYEFPSMDNGEKLDRSFLWGAKPSSDKLMIQPFDISAFTAGTGIAPIMQL 221
             LELRGP+IDY+F   ++  K  R        +  +L   PF    F  GTGI   +Q 
Sbjct: 174 STLELRGPFIDYKF--RNDLSKHHRDANGSTLINKTQLSNVPF----FAGGTGIVTALQP 227

Query: 222 LLTEF-PFRGRIHLFHSCRQKSELGPLGPILDVLRENNRVELNFFESSKGRDIRQISNEV 280
           +L  +  F   + LFHSC+   ELG L  +++ L + N++  + FE+SKG          
Sbjct: 228 ILNPYGQFNYNMTLFHSCKSIQELGCLYHLVNGLAQQNKITYHLFETSKGD--------- 278

Query: 281 LNLIDSPSQYLKRPFTGFEGPIKPVLSLICGPDSYITTISGPKYDHFQGPIEGLLGQKGW 340
            N+ID   Q +  P T   G +    S++CGP+ YITT++G KYD  QGPIEGLLG+KGW
Sbjct: 279 -NIIDF-KQLIPGPNTSNAGNLDT--SIVCGPEGYITTVAGAKYDTSQGPIEGLLGEKGW 334

Query: 341 SNQNV 345
            N NV
Sbjct: 335 DNSNV 339

>KLLA0D04488g complement(381861..382751) similar to sp|P36060
           Saccharomyces cerevisiae YKL150w MCR1 cytochrome-b5
           reductase, start by similarity
          Length = 296

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 68/288 (23%), Positives = 123/288 (42%), Gaps = 69/288 (23%)

Query: 70  DSEHFILELTPIRPQSTNMWALMKSDKLWSVQVKQPEIMVVRNYTPLPLQHVGSGEFKVL 129
           D++ F   L    P+   +  L+ +  + +  V      V+R YTP+             
Sbjct: 63  DTKRFTFAL----PKKDQVSGLITASCILAKFVTPKGSNVIRPYTPV------------- 105

Query: 130 ADGDNG-QGKLSFYLKKYQYGEVARWLSRLPEGHILELRGPYIDYEFPSMDNGEKLDRSF 188
              DNG +GK+   +K Y+ G+    L  L E   +  +GP   +E+             
Sbjct: 106 --SDNGTKGKMELVVKHYENGKFTSHLFGLKENDTVSFKGPITKWEW------------- 150

Query: 189 LWGAKPSSDKLMIQPFD-ISAFTAGTGIAPIMQLL--LTEFP-FRGRIHLFHSCRQKSEL 244
               KP+S       +D I+   AGTGI P+ QL+  + E P    +IHL++  +   ++
Sbjct: 151 ----KPNS-------YDSITLLGAGTGINPLYQLVHHIAENPEDNTKIHLYYGNKTPEDI 199

Query: 245 GPLGPILDVLREN--NRVELNFF-ESSKGRDIRQISNEVLNLIDSPSQYLKRPFTGFEGP 301
             L   LD L++   ++V++ +F + ++G              +  + ++ + +   + P
Sbjct: 200 -LLKSELDNLQKKYPDQVKITYFVDKAEGN------------FEGETGFITKDYLSHQAP 246

Query: 302 IKPVLS---LICGPDSYITTISGPKYD-HFQGPIEGLLGQKGWSNQNV 345
            KP       +CGP  ++   SGPK     QG + G+L + G+S  NV
Sbjct: 247 -KPSEKNQVFVCGPPPFMKAYSGPKVSPQDQGELTGILAELGYSKSNV 293

>Kwal_23.5471
          Length = 312

 Score = 44.3 bits (103), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 65/286 (22%), Positives = 116/286 (40%), Gaps = 65/286 (22%)

Query: 70  DSEHFILELTPIRPQSTNMWALMKSDKLWSVQVKQPEIMVVRNYTPLPLQHVGSGEFKVL 129
           D+  F+  L    PQ   +  L+ +  L +         V+R YTP+             
Sbjct: 79  DTRRFVFSL----PQEDQVSGLITASALLAKLQTPKGSNVIRPYTPV------------- 121

Query: 130 ADGDNGQGKLSFYLKKYQYGEVARWLSRLPEGHILELRGPYIDYEFPSMDNGEKLDRSFL 189
               + +G + F +K Y+ G++   L        +  +GP I +E+              
Sbjct: 122 -SDVSTKGHIEFVIKHYKGGKMTEMLFDKKPSDTVAFKGPIIKWEW-------------- 166

Query: 190 WGAKPSSDKLMIQPFD-ISAFTAGTGIAPIMQLL--LTEFPF-RGRIHLFHSCRQKSELG 245
              KP+S       FD I+   AG+GI P+ QLL  +++ P  + +IHL +  +  +++ 
Sbjct: 167 ---KPNS-------FDSITLIGAGSGITPLYQLLHHISQNPEDKTKIHLLYGNKTPNDIL 216

Query: 246 PLGPILDV-LRENNRVELNFF----ESSKGRDIRQISNEVLNLIDSPSQYLKRPFTGFEG 300
               + +V  +  ++V+++FF    E     +I  I+ E L   + P    K        
Sbjct: 217 LKKELEEVQAKYADQVKIHFFVDKAEGPFDGEIGFITKEFLEK-NVPKASEKNQV----- 270

Query: 301 PIKPVLSLICGPDSYITTISGPKYD-HFQGPIEGLLGQKGWSNQNV 345
                   +CGP  ++   SGPK     QG + G+L   G+S + V
Sbjct: 271 -------FVCGPPPFMQAYSGPKVSPKDQGELTGILKDLGFSKEQV 309

>CAGL0E06424g 644026..644922 similar to sp|P36060 Saccharomyces
           cerevisiae YKL150w MCR1 cytochrome-b5 reductase, start
           by similarity
          Length = 298

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 53/219 (24%), Positives = 89/219 (40%), Gaps = 44/219 (20%)

Query: 136 QGKLSFYLKKYQYGEVARWLSRLPEGHILELRGPYIDYEFPSMDNGEKLDRSFLWGAKPS 195
           +G + F +K Y+ G++   L +L     L  +GP      P             W  KP+
Sbjct: 112 KGYIEFVIKHYEGGKMTDHLFQLKPKDTLAFQGP-----IPK------------WQWKPN 154

Query: 196 SDKLMIQPFD-ISAFTAGTGIAPIMQL---LLTEFPFRGRIHLFHSCRQKSELGPLGPIL 251
           S       FD I+    GTGI P+ QL   +      + +I+LF+  +  S++  L   L
Sbjct: 155 S-------FDTITLLGGGTGITPLYQLVHHITQNKEDKTKINLFYGSKTPSDI-LLKKEL 206

Query: 252 DVLRENNRVELN--FFESSKGRDIRQISNEVLNLIDSPSQYLKRPFTG--FEGPIKPVLS 307
           D L++    +LN  +F          +  +     D    ++ + F      GP +    
Sbjct: 207 DDLQKKYPEQLNIQYF----------VDKDDTGKFDGNKGFITKDFLAKNAPGPKEKTQV 256

Query: 308 LICGPDSYITTISGPKYDHF-QGPIEGLLGQKGWSNQNV 345
            +CGP  ++ ++SG K     QG + G L   G+S   V
Sbjct: 257 FVCGPPPFMDSLSGQKKSPMEQGDLTGALKDLGYSQDQV 295

>Scas_678.6
          Length = 299

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 67/288 (23%), Positives = 106/288 (36%), Gaps = 67/288 (23%)

Query: 70  DSEHFILELTPIRPQSTNMWALMKSDKLWSVQVKQPEIMVVRNYTPL-PLQHVGSGEFKV 128
           D++ F  +L    P    +  L  +  +++  V      VVR YTP+ PL          
Sbjct: 64  DTKRFTFKL----PSEDAITGLTLASAIFTKYVTAKGNNVVRPYTPVSPLDQ-------- 111

Query: 129 LADGDNGQGKLSFYLKKYQYGEVARWLSRLPEGHILELRGPYIDYEFPSMDNGEKLDRSF 188
                  QG     +K Y  G+++  L  L    ++  +GP                   
Sbjct: 112 -------QGTFELVIKHYNDGKMSSHLFSLKPNDVVSFKGPIKK---------------- 148

Query: 189 LWGAKPSSDKLMIQPFDISAFTAGTGIAPIMQLL--LTEFP-FRGRIHLFHSCRQKSELG 245
            W   P+S K       I+   AGTG  P+ QL   +   P  + +I++F+  +  S   
Sbjct: 149 -WQWVPNSFK------SITLLGAGTGTTPLYQLASHIARNPEDKTKINVFYGNKTSS--- 198

Query: 246 PLGPILDVLRENNRVELNFFESSKGRDIRQISNEVLNLIDSPSQYLKRPFTGFE------ 299
                 D+L +    EL      K  D  +++  V  L D     ++  F   E      
Sbjct: 199 ------DILLKKEWNELQ----EKYPDQVKVTYFVDKLDDGKENGVELGFISKEFIAKNA 248

Query: 300 -GPIKPVLSLICGPDSYITTISGPKYDHF-QGPIEGLLGQKGWSNQNV 345
            GP +     ICGP  ++   SG K     QG + GLL + G+S   V
Sbjct: 249 PGPKEDTHLFICGPPPFMKAYSGEKAKPTDQGELTGLLQELGYSKDQV 296

>KLLA0F27621g complement(2560055..2560900) similar to sp|P38626
           Saccharomyces cerevisiae YIL043c CBR1 cytochrome-b5
           reductase, hypothetical start
          Length = 281

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 35/145 (24%), Positives = 61/145 (42%), Gaps = 39/145 (26%)

Query: 83  PQSTNMWALMKSDKLWSVQVKQPEIMVVRNYTPLPLQHVGSGEFKVLADGDNGQGKLSFY 142
           P+ST +  L     + SVQ       ++R+YTP  L     G F++L             
Sbjct: 62  PKSTQVLGLPIGQHI-SVQANINGKDILRSYTPTSLDSDAVGHFELL------------- 107

Query: 143 LKKYQYGEVARWLSRLPEGHILELRGPYIDYEF-PSMDNGEKLDRSFLWGAKPSSDKLMI 201
           +K Y+ G +++  ++L  G  +++RGP   Y + P+M+                      
Sbjct: 108 IKSYEKGNISKHFAQLNIGDKIKVRGPKGFYHYQPNMNE--------------------- 146

Query: 202 QPFDISAFTAGTGIAPIMQLLLTEF 226
              +I     GTGIAP+ Q++ + F
Sbjct: 147 ---EIGMIAGGTGIAPMYQIMKSIF 168

>Sklu_2260.2 YIL043C, Contig c2260 2185-3237
          Length = 350

 Score = 37.4 bits (85), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 26/114 (22%), Positives = 47/114 (41%), Gaps = 36/114 (31%)

Query: 109 VVRNYTPLPLQHVGSGEFKVLADGDNGQGKLSFYLKKYQYGEVARWLSRLPEGHILELRG 168
           +VR+YTP  L    +G F++L             +K Y+ G +++ +  L  G  +++RG
Sbjct: 91  IVRSYTPTSLDSDATGHFELL-------------IKSYEKGNISKMIGELKIGDRIKVRG 137

Query: 169 PYIDYEFPSMDNGEKLDRSFLWGAKPSSDKLMIQPFDISAFTAGTGIAPIMQLL 222
           P   Y + +  N                         ++    GTGIAP+ Q++
Sbjct: 138 PKGFYTYTANMNSS-----------------------LAMVAGGTGIAPMYQII 168

>Kwal_47.18159
          Length = 287

 Score = 36.6 bits (83), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 45/222 (20%), Positives = 94/222 (42%), Gaps = 62/222 (27%)

Query: 109 VVRNYTPLPLQHVGSGEFKVLADGDNGQGKLSFYLKKYQYGEVARWLSRLPEGHILELRG 168
           ++R+YTP  L     G F++L             +K Y+ G V++ +  L  G  +++RG
Sbjct: 92  IMRSYTPTSLDSDSVGFFELL-------------IKSYEQGNVSKMIGELQIGDKIKVRG 138

Query: 169 PYIDYEF-PSMDNGEKLDRSFLWGAKPSSDKLMIQPFDISAFTAGTGIAPIMQLLL---T 224
           P   Y + P+M++                        +I     GTGIAP+ Q++    +
Sbjct: 139 PKGFYTYTPNMNS------------------------EIGMIAGGTGIAPMYQIIKSIHS 174

Query: 225 EFPFRGRIHLFHSCRQKSELGPLGPILDVLRENN--RVELNFFESSKGRD-----IRQIS 277
           +   R ++ + +  + + ++  L   +D + E+N  + ++++      RD     +  ++
Sbjct: 175 DPKDRTKVSIIYGSQTEDDI-LLKKEIDAIVESNPDQFKVHYLLDKPARDTWTGGVGYVT 233

Query: 278 NEVLNLIDSPSQYLKRPFTGFEGPIKPVLSLICGPDSYITTI 319
            EV+       ++L     G       V  L+CGP   +++I
Sbjct: 234 AEVMK------EHLPAAGDG-------VQLLVCGPPGMVSSI 262

>ACR054C [1102] [Homologous to ScYKL150W (MCR1) - SH]
           (454023..454943) [921 bp, 306 aa]
          Length = 306

 Score = 36.6 bits (83), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 63/286 (22%), Positives = 107/286 (37%), Gaps = 65/286 (22%)

Query: 70  DSEHFILELTPIRPQSTNMWALMKSDKLWSVQVKQPEIMVVRNYTPLPLQHVGSGEFKVL 129
           D+  F   L    P   ++  L  +  L +  V      V+R YTP+             
Sbjct: 73  DTRRFTFAL----PSQDHVTGLTTASALLAKYVTPKGSNVIRPYTPV------------- 115

Query: 130 ADGDN-GQGKLSFYLKKYQYGEVARWLSRLPEGHILELRGPYIDYEF-PSMDNGEKLDRS 187
              DN  +G     +K Y  G+    L  L E   +E +GP   + + P+M      D  
Sbjct: 116 --SDNMARGMFQLVIKHYDGGKFTTHLFGLKENDTVEFKGPIQKWRWDPNM-----FDSI 168

Query: 188 FLWGAKPSSDKLMIQPFDISAFTAGTGIAPIMQLL--LTEFPF-RGRIHLFHSCRQKSEL 244
            L G                   AGTGI P+ Q++  + E P    ++HL +  +   ++
Sbjct: 169 VLMG-------------------AGTGITPLFQMMHHIAENPTDNTKVHLLYGNKTPQDI 209

Query: 245 GPLGPILDVLREN--NRVELNFFESSKGRDIRQISNEVLNLIDSPSQYLKR--PFTGFEG 300
             L   L+ L     ++V++ +F      D +     +         +LK+  P  G   
Sbjct: 210 -LLRKELEELASKYPDQVKVTYFVDKPEGDYKGEKGFITK------DFLKQNLPTPGSNS 262

Query: 301 PIKPVLSLICGPDSYITTISGPKYD-HFQGPIEGLLGQKGWSNQNV 345
            I      +CGP  ++   SG K     QG + G+L + G++  +V
Sbjct: 263 HI-----FVCGPPPFMDAFSGNKVSPSDQGQVTGVLSELGYTKDHV 303

>ADL087W [1654] [Homologous to ScYIL043C (CBR1) - SH]
           complement(532195..533058) [864 bp, 287 aa]
          Length = 287

 Score = 36.2 bits (82), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 35/150 (23%), Positives = 64/150 (42%), Gaps = 42/150 (28%)

Query: 109 VVRNYTPLPLQHVGSGEFKVLADGDNGQGKLSFYLKKYQYGEVARWLSRLPEGHILELRG 168
           ++R+YTP  L    +G F++L             +K Y+ G +++ L+ L  G  +++RG
Sbjct: 91  MLRSYTPTSLDSDATGYFELL-------------VKSYEKGNISKMLAELAIGDRIKVRG 137

Query: 169 PYIDYEF-PSMDNGEKLDRSFLWGAKPSSDKLMIQPFDISAFTAGTGIAPIMQLLLTEFP 227
           P   Y + P+M                          +I     GTGI+P+ Q++   F 
Sbjct: 138 PKGFYHYEPNMYK------------------------EIGMIAGGTGISPMYQIIRAIFS 173

Query: 228 F---RGRIHLFHSCRQKSELGPLGPILDVL 254
               + R+ L +  + K ++  L P LD +
Sbjct: 174 NPRDKTRVCLVYGNQTKDDI-LLKPELDAM 202

>YIL043C (CBR1) [2624] chr9 complement(274071..275039) Cytochrome b5
           reductase, converts 2 ferricytochrome B5 + NADH to 2
           ferrocytochrome B5 + NAD(+), uses FAD cofactor [969 bp,
           322 aa]
          Length = 322

 Score = 35.8 bits (81), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 46/114 (40%), Gaps = 36/114 (31%)

Query: 109 VVRNYTPLPLQHVGSGEFKVLADGDNGQGKLSFYLKKYQYGEVARWLSRLPEGHILELRG 168
           + R+YTP  L            DGD  +G     +K Y  G V++ +  L  G  ++++G
Sbjct: 126 ITRSYTPTSL------------DGDT-KGNFELLVKSYPTGNVSKMIGELKIGDSIQIKG 172

Query: 169 PYIDYEFPSMDNGEKLDRSFLWGAKPSSDKLMIQPFDISAFTAGTGIAPIMQLL 222
           P  +Y +      E+  RS L                      GTGIAP+ Q++
Sbjct: 173 PRGNYHY------ERNCRSHL-----------------GMIAGGTGIAPMYQIM 203

>YKL150W (MCR1) [3118] chr11 (166549..167457) NADH-cytochrome b5
           reductase, mitochondrial protein that may be involved in
           the response to oxidative damage [909 bp, 302 aa]
          Length = 302

 Score = 32.7 bits (73), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 60/282 (21%), Positives = 105/282 (37%), Gaps = 55/282 (19%)

Query: 70  DSEHFILELTPIRPQSTNMWALMKSDKLWSVQVKQPEIMVVRNYTPLPLQHVGSGEFKVL 129
           D+  F  +L    P   +   L+ +  L++  V      VVR YTP+             
Sbjct: 67  DTRRFTFKL----PTEDSEMGLVLASALFAKFVTPKGSNVVRPYTPV------------- 109

Query: 130 ADGDNGQGKLSFYLKKYQYGEVARWLSRLPEGHILELRGPYIDYEFPSMDNGEKLDRSFL 189
               + +G     +K Y+ G++   L  L     +  +GP +                  
Sbjct: 110 -SDLSQKGHFQLVVKHYEGGKMTSHLFGLKPNDTVSFKGPIMK----------------- 151

Query: 190 WGAKPSSDKLMIQPFDISAFTAGTGIAPIMQLL--LTEFPF-RGRIHLFHSCRQKSELGP 246
           W  +P+  K       I+   AGTGI P+ QL   + E P  + +++L +  +   ++  
Sbjct: 152 WKWQPNQFK------SITLLGAGTGINPLYQLAHHIVENPNDKTKVNLLYGNKTPQDI-L 204

Query: 247 LGPILDVLREN--NRVELNFFESSKGRDIRQISNEVLNLIDSPSQYLKRPFTGFEGPIKP 304
           L   LD L+E   ++  + +F   K  D            D   +++        GP + 
Sbjct: 205 LRKELDALKEKYPDKFNVTYFVDDKQDDQDFDGEISFISKDFIQEHV-------PGPKES 257

Query: 305 VLSLICGPDSYITTISGPKYD-HFQGPIEGLLGQKGWSNQNV 345
               +CGP  ++   SG K     QG + G+L   G+S   V
Sbjct: 258 THLFVCGPPPFMNAYSGEKKSPKDQGELIGILNNLGYSKDQV 299

>CAGL0B02519g 240486..241424 highly similar to sp|Q12746
           Saccharomyces cerevisiae YML125c, start by similarity
          Length = 312

 Score = 32.3 bits (72), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 27/113 (23%), Positives = 49/113 (43%), Gaps = 37/113 (32%)

Query: 110 VRNYTPLPLQHVGSGEFKVLADGDNGQGKLSFYLKKYQYGEVARWLSRLPEGHILELRGP 169
           VRNY P+      S  F+        +G +   +K Y+ G+V+++ + +  G  ++ RGP
Sbjct: 121 VRNYNPI------STRFE--------KGHIDLLVKSYKDGKVSKYFASMKPGETVDFRGP 166

Query: 170 YIDYEFPSMDNGEKLDRSFLWGAKPSSDKLMIQPFDISAFTAGTGIAPIMQLL 222
                            S ++  KP++ K      +I     G+GI P +Q+L
Sbjct: 167 V---------------GSLVY--KPNTYK------NIGMVCGGSGITPALQML 196

>YML087C (YML087C) [3882] chr13 complement(94431..95369) Protein
           containing an oxidoreductase FAD-binding domain and an
           oxidoreductase FAD or NAD-binding domain, has moderate
           similarity to cytochrome b5 reductase (S. cerevisiae
           Cbr1p), which converts 2 ferricytochrome B5 + NADH to 2
           ferrocytochrome B5 + NAD(+) [939 bp, 312 aa]
          Length = 312

 Score = 32.3 bits (72), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 21/94 (22%), Positives = 38/94 (40%), Gaps = 23/94 (24%)

Query: 134 NGQGKLSFYLKKYQYGEVARWLSRLPEGHILELRGPYIDYEFPSMDNGEKLDRSFLWGAK 193
           N +G L   +K Y++G V+++  +L     +E +GP  + E+   D   +L         
Sbjct: 131 NTEGHLELVVKTYKHGVVSKYFDKLKIRQYVEFKGPLGELEY-DQDTATEL--------- 180

Query: 194 PSSDKLMIQPFDISAFTAGTGIAPIMQLLLTEFP 227
                             G+GI P++Q+L    P
Sbjct: 181 -------------GIIAGGSGITPVLQVLQEIIP 201

>Sklu_2184.2 YML125C, Contig c2184 1732-2664 reverse complement
          Length = 310

 Score = 31.6 bits (70), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 25/113 (22%), Positives = 46/113 (40%), Gaps = 37/113 (32%)

Query: 110 VRNYTPLPLQHVGSGEFKVLADGDNGQGKLSFYLKKYQYGEVARWLSRLPEGHILELRGP 169
           +R YTP+  Q   +G F ++             +K Y  G+V+++ + L  G ++E +GP
Sbjct: 119 IRYYTPI-TQRYDTGHFDII-------------VKSYTDGKVSKYFASLKPGQLVEFQGP 164

Query: 170 YIDYEFPSMDNGEKLDRSFLWGAKPSSDKLMIQPFDISAFTAGTGIAPIMQLL 222
              + + +  N  K                      I     G+GI P++Q+L
Sbjct: 165 VGRFNYAT--NSSKA---------------------IGMIAGGSGITPMLQVL 194

>Scas_704.43
          Length = 316

 Score = 31.6 bits (70), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 25/115 (21%), Positives = 45/115 (39%), Gaps = 38/115 (33%)

Query: 109 VVRNYTPLPLQHVGSGEFKVLADGDNGQGKLSFYLKKYQYGEVARWLSRLPEGHILELRG 168
           ++R+YTP  L     G F++L             +K Y  G +++++  L  G  + + G
Sbjct: 120 IMRSYTPTSLDSETKGSFELL-------------VKSYPNGNISKFIGNLNIGDEINVCG 166

Query: 169 PYIDYEF-PSMDNGEKLDRSFLWGAKPSSDKLMIQPFDISAFTAGTGIAPIMQLL 222
           P  +Y + P+  N                         +     GTGIAP+ Q++
Sbjct: 167 PAGNYHYEPNCRN------------------------KLGMIAGGTGIAPMFQIM 197

>AFR439C [3631] [Homologous to ScYML125C - SH; ScYML087C - SH]
           (1228716..1229648) [933 bp, 310 aa]
          Length = 310

 Score = 30.8 bits (68), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 28/60 (46%), Gaps = 14/60 (23%)

Query: 110 VRNYTPLPLQHVGSGEFKVLADGDNGQGKLSFYLKKYQYGEVARWLSRLPEGHILELRGP 169
           VR YTP+      S +F         +G     +K Y  G+V++W + L  G  +E +GP
Sbjct: 119 VRYYTPI------SNKF--------AEGHFDIIVKSYVDGKVSKWFAGLQPGQTVEFKGP 164

>Scas_692.6
          Length = 314

 Score = 30.4 bits (67), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 19/86 (22%), Positives = 35/86 (40%), Gaps = 23/86 (26%)

Query: 137 GKLSFYLKKYQYGEVARWLSRLPEGHILELRGPYIDYEFPSMDNGEKLDRSFLWGAKPSS 196
           G     +K Y  G+V+++ + L  G  +E +GP  +  +                  P+S
Sbjct: 136 GHFDLLIKSYADGKVSKYFAGLKPGDTVEFKGPIGELHY-----------------APNS 178

Query: 197 DKLMIQPFDISAFTAGTGIAPIMQLL 222
            K +           G+GI P++Q+L
Sbjct: 179 SKAL------GIVAGGSGITPVLQML 198

>Kwal_23.5935
          Length = 365

 Score = 29.3 bits (64), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 21/33 (63%)

Query: 254 LRENNRVELNFFESSKGRDIRQISNEVLNLIDS 286
           LR +N+VEL +   + G D+  +  EV N+I++
Sbjct: 257 LRVSNKVELTYLSDTLGIDLMIVQEEVCNMIET 289

>YML125C (YML125C) [3847] chr13 complement(20762..21700) Protein
           with similarity to NADH-cytochrome b5 reductase [939 bp,
           312 aa]
          Length = 312

 Score = 29.3 bits (64), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 21/89 (23%), Positives = 38/89 (42%), Gaps = 27/89 (30%)

Query: 136 QGKLSFYLKKYQYGEVARWLSRLPEGHILELRGPY--IDYEFPSMDNGEKLDRSFLWGAK 193
            G L   +K Y  G+V+++ + L  G  ++ +GP   ++YE                   
Sbjct: 133 SGYLDLVVKAYVDGKVSKYFAGLNSGDTVDFKGPIGTLNYE------------------- 173

Query: 194 PSSDKLMIQPFDISAFTAGTGIAPIMQLL 222
           P+S K       +     G+GI P++Q+L
Sbjct: 174 PNSSK------HLGIVAGGSGITPVLQIL 196

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.139    0.432 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 11,717,329
Number of extensions: 509567
Number of successful extensions: 1066
Number of sequences better than 10.0: 27
Number of HSP's gapped: 1052
Number of HSP's successfully gapped: 27
Length of query: 345
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 243
Effective length of database: 13,065,073
Effective search space: 3174812739
Effective search space used: 3174812739
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 62 (28.5 bits)