Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_55.2155935134716680.0
ACR091W32832710861e-149
YDR267C33032610461e-143
KLLA0E21879g33332910261e-139
Scas_615.1134934510171e-138
CAGL0M08646g3373339881e-134
Sklu_1710.12402308371e-112
CAGL0I03718g12011751902e-15
CAGL0J10340g3381721765e-14
Kwal_23.53514742151741e-13
Scas_679.288151561732e-13
AEL269C4551881722e-13
Kwal_56.2452612101751733e-13
ADR077C12041701723e-13
KLLA0E23529g8262701706e-13
KLLA0F04884g12121751698e-13
YLR222C (UTP13)8171921672e-12
Scas_652.163451671642e-12
YDL145C (COP1)12011751662e-12
AEL246C8152691662e-12
Scas_624.1112051751662e-12
KLLA0D16390g9362491653e-12
CAGL0C00737g8161801653e-12
YGL100W (SEH1)3491671623e-12
YCR072C5152551643e-12
CAGL0J03476g5171951624e-12
AGL196C9352421635e-12
Kwal_55.220674512131616e-12
Scas_721.328222201618e-12
Kwal_23.63245141831608e-12
AGR180W8062251619e-12
CAGL0M04081g4552131591e-11
Scas_720.955151601591e-11
Scas_630.66211791591e-11
YFL009W (CDC4)7792641591e-11
KLLA0F06754g3441421571e-11
AER263C5131851581e-11
KLLA0C08547g5151601572e-11
Sklu_2431.127492691582e-11
Scas_631.174742271562e-11
Kwal_56.245962942631543e-11
Sklu_2173.25151601545e-11
ADL184W4492131519e-11
Scas_713.509832421539e-11
CAGL0M05335g8062551521e-10
Sklu_2416.54592131501e-10
KLLA0E07073g4521641492e-10
YNL317W (PFS2)4652131483e-10
YBR198C (TAF5)7982231483e-10
CAGL0C03608g6432581484e-10
Kwal_27.115858232011484e-10
AFL038C3301801454e-10
Kwal_23.50357443021465e-10
CAGL0E00561g8361861466e-10
YCR084C (TUP1)7131951466e-10
CAGL0M04279g9401931458e-10
ACR137W4251771439e-10
AGR168W8251441431e-09
CAGL0I03454g3031881402e-09
KLLA0F10263g6821761422e-09
YPL151C (PRP46)4511731412e-09
Kwal_27.120537552721412e-09
YBL008W (HIR1)8402071412e-09
Scas_629.126711771412e-09
YLR208W (SEC13)2971631382e-09
Kwal_23.64297501801412e-09
CAGL0J08778g2981631383e-09
Scas_674.202971631383e-09
KLLA0F13244g8141491403e-09
CAGL0E02805g8402301403e-09
Kwal_14.16113341421383e-09
Kwal_56.239209372421403e-09
Sklu_2420.24411751375e-09
CAGL0L00781g6731741386e-09
YLR129W (DIP2)9431931386e-09
Kwal_47.174658001351386e-09
YIL046W (MET30)6401741376e-09
CAGL0G09845g5002241368e-09
KLLA0F11231g4341601359e-09
Scas_585.84601751351e-08
ACR199C2951701331e-08
YGL137W (SEC27)8892651351e-08
CAGL0L02629g7952281342e-08
YNL006W (LST8)3032461312e-08
Kwal_26.87764331581323e-08
Scas_704.406081741323e-08
KLLA0D07546g6472301314e-08
ADL082C5691671305e-08
AGL234W6291801297e-08
AFL118W8322081297e-08
Kwal_23.57696271741297e-08
KLLA0A04928g8612231298e-08
KLLA0B01958g8902291299e-08
YPR178W (PRP4)4652481289e-08
KLLA0E12287g3261331261e-07
Scas_702.168161931281e-07
CAGL0H08932g9022651262e-07
Scas_707.227302601262e-07
Scas_695.153272891232e-07
AGL024W7562251252e-07
KLLA0C16643g3021631223e-07
Scas_603.55892291234e-07
Scas_673.114341831224e-07
YKL213C (DOA1)7152231216e-07
KLLA0F27511g6231741209e-07
CAGL0B00748g8121221209e-07
Scas_720.83d9151811201e-06
CAGL0H03729g3032581181e-06
Sklu_2160.37601551182e-06
KLLA0E04741g4591531172e-06
AAR057W9221841172e-06
Kwal_23.62409132041163e-06
Kwal_26.75702181351123e-06
YCR057C (PWP2)9232581154e-06
CAGL0L03201g5792431145e-06
Kwal_56.241637291471145e-06
YPL183C10131181145e-06
AFL014C5572041136e-06
AER114W6331331137e-06
CAGL0G04345g7112421128e-06
KLLA0D04840g3032431109e-06
CAGL0M02277g4271601101e-05
Kwal_27.122393161841101e-05
KLLA0E21263g4291821092e-05
YLR429W (CRN1)6511481092e-05
CAGL0K09284g9111281102e-05
Scas_558.37251771092e-05
Scas_465.410021181092e-05
KLLA0E18986g9901671092e-05
Sklu_2114.211401301083e-05
Scas_680.113471211064e-05
KLLA0E24508g3272021055e-05
ACR017W4231721056e-05
CAGL0K00957g7931961057e-05
YIR012W (SQT1)4311831047e-05
Scas_719.526281971049e-05
AER448W7141611049e-05
AER280C5101781031e-04
YBR175W (SWD3)3151381021e-04
Kwal_27.103855361771031e-04
KLLA0E03982g3722531021e-04
ACL116W8042621031e-04
Scas_721.115*3182041011e-04
YMR102C8341311022e-04
AGR207C3201871002e-04
Scas_571.46011481012e-04
Scas_592.4*318204992e-04
KLLA0F17237g5231971002e-04
Scas_692.254883041002e-04
KLLA0D02530g7072331003e-04
Scas_720.457551231003e-04
CAGL0K00275g715105993e-04
CAGL0J04818g654123984e-04
Kwal_33.15591714171984e-04
Kwal_0.212303236974e-04
KLLA0C08976g911165985e-04
Scas_721.7325217965e-04
Scas_718.6*546261976e-04
Scas_658.1442178976e-04
Sklu_2442.2303243966e-04
KLLA0C07425g444217967e-04
Kwal_47.17827523197967e-04
AAL009C303245958e-04
CAGL0J03344g54398968e-04
AER337W445298958e-04
YDR364C (CDC40)455222958e-04
CAGL0G00704g440104959e-04
CAGL0C01441g1005156960.001
AEL314W715242950.001
YGR200C (ELP2)788273940.001
CAGL0L09647g429187930.001
KLLA0F10791g545177940.001
Sklu_2092.4520189930.001
KLLA0E11143g493186930.002
CAGL0A00605g640131930.002
ACR097W467230930.002
YER082C (UTP7)554166920.002
Sklu_1963.2314189910.002
Scas_693.36375197920.002
AFL056C976124920.002
KLLA0E07942g390128910.003
Kwal_26.897544590910.003
ACL034W550139910.003
YER066W18585880.003
Scas_642.193498910.004
Kwal_55.21450503141900.004
Kwal_56.236851102130900.004
CAGL0D02090g277144890.004
AER439W414158890.004
Sklu_2172.6263163880.005
Sklu_2364.4555237890.005
CAGL0L06952g34799880.005
Kwal_26.8628422232880.005
CAGL0F06853g388134880.006
ADR242C521182880.007
Kwal_33.15475783186880.007
KLLA0B14410g70656880.007
Scas_692.29456189870.008
Scas_442.2*795160880.008
ADR264C346185860.010
Sklu_2167.5303190850.011
Sklu_1048.1433184860.011
KLLA0F10615g370159860.011
Kwal_47.1755541782860.012
YDL195W (SEC31)1273201860.012
YKL021C (MAK11)468159860.013
Kwal_27.12667721138860.013
Scas_712.34399148850.013
Kwal_14.171057496860.014
AER255C467175850.014
Sklu_2291.4997143860.014
CAGL0L10890g457188850.015
ADR176W461115850.015
Kwal_26.765574385850.016
CAGL0J03564g1029107850.016
Scas_700.27*433114840.017
Kwal_47.17567590237850.017
Sklu_1513.2448114840.017
ADR090W1233202850.020
AFR199C334199830.021
Sklu_2318.1711106840.022
CAGL0B01529g369136830.023
Scas_710.3349897830.025
ABR101C82778830.029
CAGL0J06512g545150830.029
AGL190W370235820.032
AFL006C43382820.032
CAGL0M06193g316206810.035
CAGL0C02937g467251820.038
Kwal_27.12586509132820.038
Scas_706.24460208820.038
Sklu_2438.457398820.040
KLLA0F22000g793124820.041
KLLA0A08822g582220810.045
CAGL0J03806g420118810.046
KLLA0E11297g512233810.048
YMR116C (ASC1)319207800.051
Sklu_2431.8425149800.053
YMR093W (UTP15)513131800.054
Scas_693.221145134810.056
Scas_605.18424232800.057
CAGL0L02761g419180800.066
Scas_652.7380134790.067
Scas_701.451276336800.067
Kwal_14.88439568790.070
Scas_627.950097800.070
KLLA0F21406g705141800.070
CAGL0A00561g41282790.070
AGR242C419183790.076
CAGL0K07095g371113790.076
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_55.21559
         (347 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_55.21559                                                         647   0.0  
ACR091W [1138] [Homologous to ScYDR267C - SH] complement(520609....   422   e-149
YDR267C (YDR267C) [1100] chr4 complement(1002502..1003494) Prote...   407   e-143
KLLA0E21879g complement(1944865..1945866) similar to sgd|S000267...   399   e-139
Scas_615.11                                                           396   e-138
CAGL0M08646g 861488..862501 similar to tr|Q05583 Saccharomyces c...   385   e-134
Sklu_1710.1 YDR267C, Contig c1710 17-739                              327   e-112
CAGL0I03718g complement(317565..321170) highly similar to sp|P53...    78   2e-15
CAGL0J10340g complement(1008637..1009653) highly similar to sp|P...    72   5e-14
Kwal_23.5351                                                           72   1e-13
Scas_679.28                                                            71   2e-13
AEL269C [2236] [Homologous to ScYPR178W (PRP4) - SH] (134760..13...    71   2e-13
Kwal_56.24526                                                          71   3e-13
ADR077C [1818] [Homologous to ScYDL145C (COP1) - SH] (843171..84...    71   3e-13
KLLA0E23529g 2088516..2090996 similar to sp|P38129 Saccharomyces...    70   6e-13
KLLA0F04884g complement(478044..481682) similar to sp|P53622 Sac...    70   8e-13
YLR222C (UTP13) [3622] chr12 complement(579320..581773) Componen...    69   2e-12
Scas_652.16                                                            68   2e-12
YDL145C (COP1) [723] chr4 complement(194572..198177) Coatomer (C...    69   2e-12
AEL246C [2260] [Homologous to ScYBR198C (TAF90) - SH] (172849..1...    69   2e-12
Scas_624.11                                                            69   2e-12
KLLA0D16390g 1378884..1381694 similar to sp|Q12220 Saccharomyces...    68   3e-12
CAGL0C00737g complement(75028..77478) similar to tr|Q05946 Sacch...    68   3e-12
YGL100W (SEH1) [1883] chr7 (313235..314284) Protein found in com...    67   3e-12
YCR072C (YCR072C) [597] chr3 complement(240800..242347) Protein ...    68   3e-12
CAGL0J03476g 331933..333486 highly similar to sp|P25382 Saccharo...    67   4e-12
AGL196C [4116] [Homologous to ScYLR129W (DIP2) - SH] (328838..33...    67   5e-12
Kwal_55.22067                                                          67   6e-12
Scas_721.32                                                            67   8e-12
Kwal_23.6324                                                           66   8e-12
AGR180W [4491] [Homologous to ScYLR222C - SH] complement(1090647...    67   9e-12
CAGL0M04081g complement(450572..451939) highly similar to sp|P42...    66   1e-11
Scas_720.95                                                            66   1e-11
Scas_630.6                                                             66   1e-11
YFL009W (CDC4) [1673] chr6 (116139..118478) F-box protein and co...    66   1e-11
KLLA0F06754g complement(650475..651509) similar to sp|P53011 Sac...    65   1e-11
AER263C [2765] [Homologous to ScYCR072C - SH] (1118228..1119769)...    65   1e-11
KLLA0C08547g 749737..751284 highly similar to sp|P25382 Saccharo...    65   2e-11
Sklu_2431.12 YBR198C, Contig c2431 17817-20066 reverse complement      65   2e-11
Scas_631.17                                                            65   2e-11
Kwal_56.24596                                                          64   3e-11
Sklu_2173.2 YCR072C, Contig c2173 2732-4279                            64   5e-11
ADL184W [1557] [Homologous to ScYNL317W (PFS2) - SH] complement(...    63   9e-11
Scas_713.50                                                            64   9e-11
CAGL0M05335g complement(569132..571552) similar to sp|P38129 Sac...    63   1e-10
Sklu_2416.5 YNL317W, Contig c2416 8692-10071                           62   1e-10
KLLA0E07073g 645766..647124 similar to sp|P42841 Saccharomyces c...    62   2e-10
YNL317W (PFS2) [4296] chr14 (40618..42015) Polyadenylation facto...    62   3e-10
YBR198C (TAF5) [381] chr2 complement(616084..618480) Component o...    62   3e-10
CAGL0C03608g 360681..362612 similar to sp|P16649 Saccharomyces c...    62   4e-10
Kwal_27.11585                                                          62   4e-10
AFL038C [3155] [Homologous to ScYGL100W (SEH1) - SH] (367581..36...    60   4e-10
Kwal_23.5035                                                           61   5e-10
CAGL0E00561g 49750..52260 some similarities with sp|P16649 Sacch...    61   6e-10
YCR084C (TUP1) [608] chr3 complement(260307..262448) General rep...    61   6e-10
CAGL0M04279g 469040..471862 highly similar to sp|Q12220 Saccharo...    60   8e-10
ACR137W [1184] [Homologous to ScYPL151C (PRP46) - SH] complement...    60   9e-10
AGR168W [4479] [Homologous to ScYBL008W (HIR1) - SH] complement(...    60   1e-09
CAGL0I03454g 292823..293734 similar to sp|Q04491 Saccharomyces c...    59   2e-09
KLLA0F10263g 949926..951974 gi|2494900|sp|P56094|TUP1_KLULA Kluy...    59   2e-09
YPL151C (PRP46) [5296] chr16 complement(266179..267534) Putative...    59   2e-09
Kwal_27.12053                                                          59   2e-09
YBL008W (HIR1) [186] chr2 (209618..212140) Histone transcription...    59   2e-09
Scas_629.12                                                            59   2e-09
YLR208W (SEC13) [3609] chr12 (559553..560446) Component of the C...    58   2e-09
Kwal_23.6429                                                           59   2e-09
CAGL0J08778g 866175..867071 highly similar to sp|Q04491 Saccharo...    58   3e-09
Scas_674.20                                                            58   3e-09
KLLA0F13244g 1224178..1226622 similar to sgd|S0004212 Saccharomy...    59   3e-09
CAGL0E02805g complement(265137..267659) similar to sp|P32479 Sac...    59   3e-09
Kwal_14.1611                                                           58   3e-09
Kwal_56.23920                                                          59   3e-09
Sklu_2420.2 YPL151C, Contig c2420 3924-5249                            57   5e-09
CAGL0L00781g 95506..97527 similar to sp|P39014 Saccharomyces cer...    58   6e-09
YLR129W (DIP2) [3539] chr12 (399658..402489) Component of U3 sno...    58   6e-09
Kwal_47.17465                                                          58   6e-09
YIL046W (MET30) [2621] chr9 (268650..270572) F-box protein that ...    57   6e-09
CAGL0G09845g 940598..942100 similar to sp|P20053 Saccharomyces c...    57   8e-09
KLLA0F11231g complement(1034708..1036012) similar to sp|Q12417 S...    57   9e-09
Scas_585.8                                                             57   1e-08
ACR199C [1246] [Homologous to ScYLR208W (SEC13) - SH] (698881..6...    56   1e-08
YGL137W (SEC27) [1850] chr7 (249872..249889,250090..252741) Coat...    57   1e-08
CAGL0L02629g complement(307323..309710) similar to sp|P07834 Sac...    56   2e-08
YNL006W (LST8) [4579] chr14 (620066..620977) Protein required fo...    55   2e-08
Kwal_26.8776                                                           55   3e-08
Scas_704.40                                                            55   3e-08
KLLA0D07546g complement(647984..649927) some similarities with s...    55   4e-08
ADL082C [1659] [Homologous to ScYIL046W (MET30) - SH] (538948..5...    55   5e-08
AGL234W [4078] [Homologous to ScYCR084C (TUP1) - SH] complement(...    54   7e-08
AFL118W [3077] [Homologous to ScYGL137W (SEC27) - SH] complement...    54   7e-08
Kwal_23.5769                                                           54   7e-08
KLLA0A04928g 439349..441934 similar to sp|P32479 Saccharomyces c...    54   8e-08
KLLA0B01958g join(170646..170663,170896..173550) similar to sp|P...    54   9e-08
YPR178W (PRP4) [5592] chr16 (892326..893723) U4/U6 snRNA-associa...    54   9e-08
KLLA0E12287g join(1086778..1087329,1087730..1088158) similar to ...    53   1e-07
Scas_702.16                                                            54   1e-07
CAGL0H08932g join(871668..871685,872089..874779) highly similar ...    53   2e-07
Scas_707.22                                                            53   2e-07
Scas_695.15                                                            52   2e-07
AGL024W [4287] [Homologous to ScYFL009W (CDC4) - SH; ScYER066W -...    53   2e-07
KLLA0C16643g complement(1457590..1458498) highly similar to sp|Q...    52   3e-07
Scas_603.5                                                             52   4e-07
Scas_673.11                                                            52   4e-07
YKL213C (DOA1) [3062] chr11 complement(31961..34108) Protein req...    51   6e-07
KLLA0F27511g 2546533..2548404 similar to sp|P39014 Saccharomyces...    51   9e-07
CAGL0B00748g 65727..68165 similar to sp|P25569 Saccharomyces cer...    51   9e-07
Scas_720.83d                                                           51   1e-06
CAGL0H03729g 342948..343859 highly similar to sp|P41318 Saccharo...    50   1e-06
Sklu_2160.3 YGL137W, Contig c2160 2536-4818 reverse complement         50   2e-06
KLLA0E04741g 428278..429657 similar to sp|P20053 Saccharomyces c...    50   2e-06
AAR057W [243] [Homologous to ScYCR057C (PWP2) - SH] complement(4...    50   2e-06
Kwal_23.6240                                                           49   3e-06
Kwal_26.7570                                                           48   3e-06
YCR057C (PWP2) [586] chr3 complement(220452..223223) Essential p...    49   4e-06
CAGL0L03201g complement(366795..368534) some similarities with s...    49   5e-06
Kwal_56.24163                                                          49   5e-06
YPL183C (YPL183C) [5265] chr16 complement(199494..202535) Protei...    49   5e-06
AFL014C [3179] [Homologous to ScYGL116W (CDC20) - SH] (409496..4...    48   6e-06
AER114W [2619] [Homologous to ScYLR429W (CRN1) - SH] complement(...    48   7e-06
CAGL0G04345g 408842..410977 similar to sp|P47025 Saccharomyces c...    48   8e-06
KLLA0D04840g 413362..414273 highly similar to sp|P41318 Saccharo...    47   9e-06
CAGL0M02277g complement(271836..273119) highly similar to sp|Q12...    47   1e-05
Kwal_27.12239                                                          47   1e-05
KLLA0E21263g 1892524..1893813 similar to sp|P40968 Saccharomyces...    47   2e-05
YLR429W (CRN1) [3804] chr12 (990773..992728) Coronin, actin-bind...    47   2e-05
CAGL0K09284g 914937..917672 highly similar to sp|P25635 Saccharo...    47   2e-05
Scas_558.3                                                             47   2e-05
Scas_465.4                                                             47   2e-05
KLLA0E18986g 1680775..1683747 similar to sgd|S0006104 Saccharomy...    47   2e-05
Sklu_2114.2 YDR128W, Contig c2114 598-4020 reverse complement          46   3e-05
Scas_680.11                                                            45   4e-05
KLLA0E24508g complement(2175775..2176758) similar to sp|P38123 S...    45   5e-05
ACR017W [1065] [Homologous to ScYEL056W (HAT2) - SH] complement(...    45   6e-05
CAGL0K00957g 94828..97209 similar to sp|P42935 Saccharomyces cer...    45   7e-05
YIR012W (SQT1) [2677] chr9 (378483..379778) Protein that may be ...    45   7e-05
Scas_719.52                                                            45   9e-05
AER448W [2948] [Homologous to ScYKL213C (DOA1) - SH] complement(...    45   9e-05
AER280C [2782] [Homologous to ScYML102W (CAC2) - SH] (1148956..1...    44   1e-04
YBR175W (SWD3) [360] chr2 (582365..583312) Component of SET1 and...    44   1e-04
Kwal_27.10385                                                          44   1e-04
KLLA0E03982g 371642..372760 similar to sp|P39108 Saccharomyces c...    44   1e-04
ACL116W [933] [Homologous to ScYGR200C (ELP2) - SH] complement(1...    44   1e-04
Scas_721.115*                                                          44   1e-04
YMR102C (YMR102C) [4060] chr13 complement(469847..472351) Protei...    44   2e-04
AGR207C [4518] [Homologous to ScYBR175W (SWD3) - SH] (1146710..1...    43   2e-04
Scas_571.4                                                             44   2e-04
Scas_592.4*                                                            43   2e-04
KLLA0F17237g 1577197..1578768 similar to sp|Q04225 Saccharomyces...    43   2e-04
Scas_692.25                                                            43   2e-04
KLLA0D02530g complement(212703..214826) gi|5679595|emb|CAB51777....    43   3e-04
Scas_720.45                                                            43   3e-04
CAGL0K00275g complement(25300..27447) similar to sp|P36037 Sacch...    43   3e-04
CAGL0J04818g 455846..457810 highly similar to sp|Q06440 Saccharo...    42   4e-04
Kwal_33.15591                                                          42   4e-04
Kwal_0.212                                                             42   4e-04
KLLA0C08976g 784536..787271 highly similar to sgd|S0000653 Sacch...    42   5e-04
Scas_721.7                                                             42   5e-04
Scas_718.6*                                                            42   6e-04
Scas_658.1                                                             42   6e-04
Sklu_2442.2 YNL006W, Contig c2442 3831-4742                            42   6e-04
KLLA0C07425g complement(647673..649007) highly similar to sp|Q12...    42   7e-04
Kwal_47.17827                                                          42   7e-04
AAL009C [178] [Homologous to ScYNL006W (LST8) - SH] (325785..326...    41   8e-04
CAGL0J03344g complement(322226..323857) highly similar to sp|P40...    42   8e-04
AER337W [2838] [Homologous to ScYOR272W (YTM1) - SH] complement(...    41   8e-04
YDR364C (CDC40) [1190] chr4 complement(1202831..1204198) Protein...    41   8e-04
CAGL0G00704g 65805..67127 similar to sp|P39706 Saccharomyces cer...    41   9e-04
CAGL0C01441g complement(156930..159947) similar to tr|Q08924 Sac...    42   0.001
AEL314W [2191] [Homologous to ScYJL112W (MDV1) - SH; ScYKR036C (...    41   0.001
YGR200C (ELP2) [2150] chr7 complement(899907..902273) 90 kDa sub...    41   0.001
CAGL0L09647g 1032740..1034029 highly similar to sp|P35184 Saccha...    40   0.001
KLLA0F10791g complement(991642..993279) similar to sp|P26309 Sac...    41   0.001
Sklu_2092.4 YMR131C, Contig c2092 3964-5526                            40   0.001
KLLA0E11143g 983669..985150 similar to sp|Q04199 Saccharomyces c...    40   0.002
CAGL0A00605g complement(67281..69203) similar to sp|P53197 Sacch...    40   0.002
ACR097W [1144] [Homologous to ScYOR212W (STE4) - SH] complement(...    40   0.002
YER082C (UTP7) [1514] chr5 complement(324268..325932) Component ...    40   0.002
Sklu_1963.2 YBR175W, Contig c1963 4075-5019 reverse complement         40   0.002
Scas_693.36                                                            40   0.002
AFL056C [3137] [Homologous to ScYPL183C - SH] (329216..332146) [...    40   0.002
KLLA0E07942g 717476..718648 similar to sp|P20484 Saccharomyces c...    40   0.003
Kwal_26.8975                                                           40   0.003
ACL034W [1015] [Homologous to ScYER082C (KRE31) - SH] complement...    40   0.003
YER066W (YER066W) [1497] chr5 (290240..290797) Protein containin...    39   0.003
Scas_642.1                                                             40   0.004
Kwal_55.21450                                                          39   0.004
Kwal_56.23685                                                          39   0.004
CAGL0D02090g join(214357..214893,215564..215860) highly similar ...    39   0.004
AER439W [2939] [Homologous to ScYGL213C (SKI8) - SH] complement(...    39   0.004
Sklu_2172.6 YLR129W, Contig c2172 11261-12048 reverse complement       39   0.005
Sklu_2364.4 YGL003C, Contig c2364 7265-8932 reverse complement         39   0.005
CAGL0L06952g complement(780793..781836) highly similar to sp|P40...    39   0.005
Kwal_26.8628                                                           39   0.005
CAGL0F06853g 671942..673108 highly similar to sp|P20484 Saccharo...    39   0.006
ADR242C [1983] [Homologous to ScYMR131C (RRB1) - SH] (1126443..1...    39   0.007
Kwal_33.15475                                                          39   0.007
KLLA0B14410g 1264616..1266736 similar to sp|P36037 Saccharomyces...    39   0.007
Scas_692.29                                                            38   0.008
Scas_442.2*                                                            39   0.008
ADR264C [2005] [Homologous to ScYMR146C (TIF34) - SH] (1158218.....    38   0.010
Sklu_2167.5 YGL213C, Contig c2167 8275-9186                            37   0.011
Sklu_1048.1 YIR012W, Contig c1048 895-2196                             38   0.011
KLLA0F10615g 978492..979604 similar to sp|P38328 Saccharomyces c...    38   0.011
Kwal_47.17555                                                          38   0.012
YDL195W (SEC31) [678] chr4 (107209..111030) Component (p150) of ...    38   0.012
YKL021C (MAK11) [3234] chr11 complement(396987..398393) Protein ...    38   0.013
Kwal_27.12667                                                          38   0.013
Scas_712.34                                                            37   0.013
Kwal_14.1710                                                           38   0.014
AER255C [2757] [Homologous to ScYDR364C (CDC40) - SH] (1107932.....    37   0.014
Sklu_2291.4 YPL183C, Contig c2291 6003-8996 reverse complement         38   0.014
CAGL0L10890g 1163084..1164457 highly similar to sp|Q12024 Saccha...    37   0.015
ADR176W [1917] [Homologous to ScYOR269W (PAC1) - SH] complement(...    37   0.015
Kwal_26.7655                                                           37   0.016
CAGL0J03564g 338044..341133 similar to sp|P25365 Saccharomyces c...    37   0.016
Scas_700.27*                                                           37   0.017
Kwal_47.17567                                                          37   0.017
Sklu_1513.2 YGL190C, Contig c1513 930-2276                             37   0.017
ADR090W [1831] [Homologous to ScYDL195W (SEC31) - SH] complement...    37   0.020
AFR199C [3391] [Homologous to ScYMR116C (ASC1) - SH] (799876..80...    37   0.021
Sklu_2318.1 YKL213C, Contig c2318 605-2740 reverse complement          37   0.022
CAGL0B01529g 137174..138283 highly similar to sp|P39108 Saccharo...    37   0.023
Scas_710.33                                                            37   0.025
ABR101C [693] [Homologous to ScYMR049C (ERB1) - SH] (567357..569...    37   0.029
CAGL0J06512g complement(620516..622153) similar to sp|Q04199 Sac...    37   0.029
AGL190W [4122] [Homologous to ScYDR142C (PEX7) - SH] complement(...    36   0.032
AFL006C [3187] [Homologous to ScYAR003W (SWD1) - SH] (425925..42...    36   0.032
CAGL0M06193g 643917..644867 similar to sp|P38123 Saccharomyces c...    36   0.035
CAGL0C02937g 290289..291692 similar to sp|P39946 Saccharomyces c...    36   0.038
Kwal_27.12586                                                          36   0.038
Scas_706.24                                                            36   0.038
Sklu_2438.4 YER082C, Contig c2438 8089-9810 reverse complement         36   0.040
KLLA0F22000g complement(2044973..2047354) similar to sp|P42935 S...    36   0.041
KLLA0A08822g 772565..774313 similar to sp|P53197 Saccharomyces c...    36   0.045
CAGL0J03806g 361174..362436 similar to sp|Q12363 Saccharomyces c...    36   0.046
KLLA0E11297g complement(994770..996308) similar to sp|P38262 Sac...    36   0.048
YMR116C (ASC1) [4073] chr13 complement(499455..499877,500151..50...    35   0.051
Sklu_2431.8 YBR195C, Contig c2431 12732-14009 reverse complement       35   0.053
YMR093W (UTP15) [4051] chr13 (454014..455555) Protein component ...    35   0.054
Scas_693.22                                                            36   0.056
Scas_605.18                                                            35   0.057
CAGL0L02761g complement(320826..322085) similar to sp|P18851 Sac...    35   0.066
Scas_652.7                                                             35   0.067
Scas_701.45                                                            35   0.067
Kwal_14.884                                                            35   0.070
Scas_627.9                                                             35   0.070
KLLA0F21406g complement(1996260..1998377) similar to sp|P47025 S...    35   0.070
CAGL0A00561g complement(63710..64948) similar to sp|P53196 Sacch...    35   0.070
AGR242C [4553] [Homologous to ScYIR012W (SQT1) - SH] (1203152..1...    35   0.076
CAGL0K07095g 698028..699143 highly similar to sp|P38328 Saccharo...    35   0.076
Scas_649.10                                                            35   0.076
Kwal_33.14971                                                          35   0.076
AFL022W [3171] [Homologous to ScYBR234C (ARC40) - SH] complement...    35   0.084
AEL250C [2256] [Homologous to ScYBR195C (MSI1) - SH] (168010..16...    35   0.085
Sklu_2133.4 YBR234C, Contig c2133 6409-7530                            35   0.085
CAGL0L04950g complement(562491..564908) highly similar to sp|Q04...    35   0.088
Scas_512.3                                                             35   0.090
YDR128W (YDR128W) [975] chr4 (709543..712989) Protein containing...    35   0.091
CAGL0M05291g complement(566250..567509) similar to sp|P13712 Sac...    35   0.092
YMR049C (ERB1) [4011] chr13 complement(368093..370516) Protein w...    35   0.094
Scas_685.11                                                            35   0.095
Sklu_1926.5 YBR103W, Contig c1926 4197-5726 reverse complement         35   0.098
Sklu_2364.5 YAR003W, Contig c2364 9220-10515 reverse complement        35   0.10 
Kwal_26.7736                                                           35   0.11 
CAGL0J03960g complement(373177..374484) similar to sp|Q12206 Sac...    35   0.11 
Kwal_27.11126                                                          35   0.12 
YBR234C (ARC40) [413] chr2 complement(685395..686549) Component ...    34   0.13 
ABL024W [568] [Homologous to ScYMR102C - SH; ScYKL121W - SH] com...    34   0.14 
Sklu_1645.2 YGL116W, Contig c1645 887-2650 reverse complement          34   0.14 
ADL186C [1555] [Homologous to ScYOL138C - SH] (369322..373407) [...    35   0.14 
Scas_684.7                                                             34   0.15 
Kwal_55.20441                                                          34   0.17 
Kwal_56.23895                                                          34   0.18 
CAGL0K12188g 1191188..1192795 similar to sp|P38262 Saccharomyces...    34   0.19 
Scas_660.8                                                             34   0.19 
Scas_659.9                                                             34   0.19 
ABL044C [548] [Homologous to ScYMR093W - SH] (312378..313934) [1...    34   0.20 
KLLA0A08866g 776960..778231 weakly similar to sp|P53196 Saccharo...    34   0.20 
Sklu_2317.3 YDR142C, Contig c2317 5804-6910                            33   0.20 
KLLA0F26653g 2461876..2464251 similar to sp|Q04660 Saccharomyces...    34   0.21 
KLLA0F13772g 1276532..1278094 highly similar to sp|Q04305 Saccha...    34   0.21 
KLLA0B11077g complement(970761..972464) similar to sgd|S0006341 ...    34   0.22 
YDR142C (PEX7) [987] chr4 complement(740467..741594) Peroxisomal...    33   0.23 
Kwal_23.5962                                                           33   0.23 
Kwal_23.6290                                                           34   0.24 
KLLA0C07513g complement(656060..657379) similar to sp|P39946 Sac...    33   0.24 
YML102W (CAC2) [3869] chr13 (68294..69700) Chromatin assembly co...    33   0.24 
CAGL0K03861g complement(359448..360989) highly similar to sp|Q04...    33   0.25 
Sklu_2435.13 YPR137W, Contig c2435 18346-20073                         33   0.26 
AAR102C [288] [Homologous to ScYPR137W (RRP9) - SH] (526057..527...    33   0.28 
Kwal_47.17572                                                          33   0.28 
KLLA0C09262g 805512..807188 similar to sp|P40055 Saccharomyces c...    33   0.29 
YMR146C (TIF34) [4102] chr13 complement(557480..558523) Translat...    33   0.30 
CAGL0B03575g complement(357525..358784) similar to sp|P39984 Sac...    33   0.30 
CAGL0L06182g 700464..701951 highly similar to sp|Q00362 Saccharo...    33   0.31 
Sklu_2406.11 YOR212W, Contig c2406 16632-17912 reverse complement      33   0.31 
Scas_701.22                                                            33   0.31 
CAGL0A02772g complement(289274..290599) similar to sp|P40968 Sac...    33   0.31 
YOR212W (STE4) [5005] chr15 (742910..744181) Beta subunit of the...    33   0.32 
YOR272W (YTM1) [5058] chr15 (832810..834192) Microtubule-associa...    33   0.32 
Scas_670.21                                                            33   0.33 
Sklu_675.1 YMR146C, Contig c675 761-1687                               33   0.33 
AFL007C [3186] [Homologous to ScYGL003C (CDH1) - SH] (424004..42...    33   0.34 
KLLA0A01650g complement(146030..147235) similar to sp|Q02793 Sac...    33   0.34 
YOR269W (PAC1) [5055] chr15 (826382..827866) Protein required in...    33   0.35 
ADL322C [1419] [Homologous to ScYBR103W (SIF2) - SH] (128830..13...    33   0.36 
YLL011W (SOF1) [3408] chr12 (127522..128991) Protein component o...    33   0.44 
YMR131C (RRB1) [4088] chr13 complement(533162..534697) Protein i...    33   0.49 
YOR230W (WTM1) [5021] chr15 (770800..772113) Transcriptional mod...    32   0.54 
Kwal_55.21144                                                          32   0.56 
Scas_640.17                                                            32   0.59 
KLLA0F19734g 1826828..1830229 similar to sgd|S0002535 Saccharomy...    32   0.59 
Kwal_33.13515                                                          32   0.62 
Kwal_14.1675                                                           32   0.63 
Sklu_1880.3 YDR364C, Contig c1880 4293-5708                            32   0.64 
CAGL0J01265g complement(118375..119928) highly similar to sp|Q04...    32   0.65 
Kwal_26.8700                                                           32   0.66 
YAR003W (SWD1) [68] chr1 (155009..156289) Component of SET1 and ...    32   0.68 
KLLA0A08800g 770989..772308 similar to sp|P39706 Saccharomyces c...    32   0.73 
Kwal_26.8953                                                           32   0.74 
Scas_705.2                                                             32   0.81 
Sklu_2364.2 YGL004C, Contig c2364 1650-2885 reverse complement         32   0.93 
Sklu_2233.2 YMR049C, Contig c2233 5630-8059 reverse complement         32   0.95 
KLLA0D15873g 1334131..1335426 similar to sp|P35184 Saccharomyces...    32   1.0  
CAGL0I07073g complement(681102..682283) similar to sp|Q02793 Sac...    32   1.0  
YGL003C (CDH1) [1969] chr7 complement(492476..494176) Protein of...    32   1.1  
Kwal_47.19083                                                          31   1.1  
CAGL0J07854g complement(765463..766761) similar to sp|P53851 Sac...    31   1.2  
YBR103W (SIF2) [292] chr2 (447666..449273) Protein involved in t...    31   1.2  
YPR137W (RRP9) [5555] chr16 (802353..804074) Protein component o...    31   1.2  
Kwal_34.15818                                                          31   1.2  
CAGL0F07337g complement(714870..716735) similar to sp|P26309 Sac...    31   1.3  
CAGL0G03399g complement(325879..326988) highly similar to sp|P40...    31   1.5  
KLLA0D06787g 586289..587599 gi|4809177|gb|AAD30127.1|AF136180_1 ...    31   1.6  
Kwal_33.15136                                                          31   1.7  
Sklu_2113.2 YCL039W, Contig c2113 2538-4865                            31   1.9  
Scas_544.4                                                             31   2.0  
Kwal_33.13534                                                          30   2.1  
YJL112W (MDV1) [2803] chr10 (205222..207366) Protein involved in...    30   2.4  
YGL004C (RPN14) [1968] chr7 complement(490705..491958) Protein c...    30   2.9  
Sklu_1927.1 YOR026W, Contig c1927 98-1135 reverse complement           30   3.2  
Scas_542.5                                                             30   3.3  
KLLA0F07403g 697593..698636 similar to sp|P40217 Saccharomyces c...    30   3.3  
ADL054W [1687] [Homologous to ScYER124C (DSE1) - SH] complement(...    30   3.4  
Kwal_56.24478                                                          30   3.6  
KLLA0F13750g complement(1274110..1275972) similar to sp|P46680 S...    30   3.6  
Scas_397.2                                                             30   3.8  
Kwal_56.24399                                                          30   3.9  
KLLA0F15598g 1439610..1441046 highly similar to sp|P33750 Saccha...    29   5.0  
Scas_661.19                                                            29   5.3  
Sklu_2323.5 YPL210C, Contig c2323 8455-10320                           29   5.9  
AAL157C [30] [Homologous to ScYLL011W (SOF1) - SH] (70077..71516...    29   5.9  
YLR148W (PEP3) [3557] chr12 (434642..437398) Vacuolar peripheral...    29   6.0  
Scas_719.7*                                                            29   6.3  
YBR281C (YBR281C) [459] chr2 complement(764928..767564) Member o...    29   6.4  
Sklu_2423.1 YLR409C, Contig c2423 869-3703                             29   6.5  
YJL069C (UTP18) [2843] chr10 complement(310838..312622) Protein ...    29   6.6  
AGR367C [4678] [Homologous to ScYDR324C - SH] (1408366..1410681)...    29   6.8  
KLLA0E20779g complement(1841092..1842207) similar to sp|P40066 S...    29   6.9  
ACR166W [1213] [Homologous to ScYKL021C (MAK11) - SH] complement...    29   7.3  
AFL157C [3038] [Homologous to ScYPL247C - SH] (140404..141720) [...    29   7.6  
Scas_670.22                                                            28   8.9  
Scas_469.3                                                             28   9.7  

>Kwal_55.21559
          Length = 351

 Score =  647 bits (1668), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/347 (95%), Positives = 332/347 (95%)

Query: 1   MMMIKHNLYTFSHKHTRLQRMSLELLKSLKLHTDKLWSIDCSKGLMATSSSDRKIKLVNL 60
           MMMIKHNLYTFSHKHTRLQRMSLELLKSLKLHTDKLWSIDCSKGLMATSSSDRKIKLVNL
Sbjct: 1   MMMIKHNLYTFSHKHTRLQRMSLELLKSLKLHTDKLWSIDCSKGLMATSSSDRKIKLVNL 60

Query: 61  KNMDFQLVEELDDSTHKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETE 120
           KNMDFQLVEELDDSTHKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETE
Sbjct: 61  KNMDFQLVEELDDSTHKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETE 120

Query: 121 LLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKH 180
           LLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKH
Sbjct: 121 LLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKH 180

Query: 181 VVWHSEMHLLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCS 240
           VVWHSEMHLLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCS
Sbjct: 181 VVWHSEMHLLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCS 240

Query: 241 DDSTVRVWNYVEEEENGEDVWAQEAILPNVHSRAVYSVSWSLDGYIASVGSDGLLXXXXX 300
           DDSTVRVWNYVEEEENGEDVWAQEAILPNVHSRAVYSVSWSLDGYIASVGSDGLL     
Sbjct: 241 DDSTVRVWNYVEEEENGEDVWAQEAILPNVHSRAVYSVSWSLDGYIASVGSDGLLVVYKE 300

Query: 301 XXXXXXXXXXQQHEAHGIYEINVVKWATVDDSVLLLTGGDDGCANIW 347
                     QQHEAHGIYEINVVKWATVDDSVLLLTGGDDGCANIW
Sbjct: 301 VKKGEWEVVVQQHEAHGIYEINVVKWATVDDSVLLLTGGDDGCANIW 347

>ACR091W [1138] [Homologous to ScYDR267C - SH]
           complement(520609..521595) [987 bp, 328 aa]
          Length = 328

 Score =  422 bits (1086), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 209/327 (63%), Positives = 260/327 (79%), Gaps = 7/327 (2%)

Query: 22  SLELLKSLKLHTDKLWSIDCSKGLMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVR 81
           +L L++SLKLH D+ WS+D SKGL+AT S+DRKIKLV+++N  F+LVEELDD+ HKK+VR
Sbjct: 3   NLHLVRSLKLHGDRCWSVDISKGLLATGSADRKIKLVDVRN--FKLVEELDDTAHKKAVR 60

Query: 82  SVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSG 141
           SV++RPH ++LAAGSFD+T+SIWG+++D    D   ETELLA+IEGHENEVK+V+WSH G
Sbjct: 61  SVAWRPHCNVLAAGSFDTTVSIWGRDDD----DYSGETELLAVIEGHENEVKSVAWSHDG 116

Query: 142 YYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRL 201
            YLA+CSRDKSVWIWEADEL EE+EC SVLQEH+QDVKH+VWH+   LLASSSYDDT+R+
Sbjct: 117 AYLATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRI 176

Query: 202 WKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNYVEEEENGEDV- 260
           W E  DDWECAAVL+GH GTVWCSDFE++E+ +RL S SDD+TVR+W  + ++ +  D  
Sbjct: 177 WAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCLTDDADVFDKE 236

Query: 261 WAQEAILPNVHSRAVYSVSWSLDGYIASVGSDGLLXXXXXXXXXXXXXXXQQHEAHGIYE 320
           W QE +LP VH+RAVYSVSWS DG IASVGSDG+L               +   AH +YE
Sbjct: 237 WIQETVLPAVHTRAVYSVSWSADGLIASVGSDGVLAVYKEVQAGRWEVVARVDCAHTVYE 296

Query: 321 INVVKWATVDDSVLLLTGGDDGCANIW 347
           INVVKW  +D  VLL+TGGDDGC N+W
Sbjct: 297 INVVKWLALDGRVLLVTGGDDGCVNVW 323

>YDR267C (YDR267C) [1100] chr4 complement(1002502..1003494) Protein
           containing seven WD domains (WD-40 repeat), which may
           mediate protein-protein interactions, has moderate
           similarity to WD40 protein Ciao1 (human CIAO1), which
           binds and inhibits Wilms tumor suppressor protein (human
           WT1) transactivation activity [993 bp, 330 aa]
          Length = 330

 Score =  407 bits (1046), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 199/326 (61%), Positives = 251/326 (76%), Gaps = 4/326 (1%)

Query: 22  SLELLKSLKLHTDKLWSIDCSKGLMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVR 81
           S+ L+KSLKL+ +K+WS D S+G++AT S+DRKIKLV++K  DF L++ LD++ HKK++R
Sbjct: 3   SINLIKSLKLYKEKIWSFDFSQGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIR 62

Query: 82  SVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSG 141
           SV++RPH+S+LAAGSFDST+SIW KEE AD      E +LLAIIEGHENEVK V+WS+ G
Sbjct: 63  SVAWRPHTSLLAAGSFDSTVSIWAKEESADRT---FEMDLLAIIEGHENEVKGVAWSNDG 119

Query: 142 YYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRL 201
           YYLA+CSRDKSVWIWE DE GEEYEC+SVLQEH+QDVKHV+WH    LLASSSYDDT+R+
Sbjct: 120 YYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRI 179

Query: 202 WKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNYVEEEENGEDVW 261
           WK+  DDWEC AVLNGH+GTVW SDF+K+E   RL S SDDSTVRVW Y+ ++E+ +  W
Sbjct: 180 WKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYMGDDEDDQQEW 239

Query: 262 AQEAILPNVHSRAVYSVSWSLDGYIASVGSDGLLXXXXXXXXXXXXXXXQQHEAHGIYEI 321
             EAILP+VH R VY+V+W  +G IASVG+DG+L               ++   HG+YEI
Sbjct: 240 VCEAILPDVHKRQVYNVAWGFNGLIASVGADGVL-AVYEEVDGEWKVFAKRALCHGVYEI 298

Query: 322 NVVKWATVDDSVLLLTGGDDGCANIW 347
           NVVKW  ++   +L TGGDDG  N W
Sbjct: 299 NVVKWLELNGKTILATGGDDGIVNFW 324

>KLLA0E21879g complement(1944865..1945866) similar to sgd|S0002675
           Saccharomyces cerevisiae YDR267c, start by similarity
          Length = 333

 Score =  399 bits (1026), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 203/329 (61%), Positives = 251/329 (76%), Gaps = 6/329 (1%)

Query: 22  SLELLKSLKLHTDKLWSIDCSKG-LMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSV 80
            L+LLKSL LH DK WS+D + G +MAT S+DRKIKLV++++  FQ++EELDD+ HKK+V
Sbjct: 3   GLKLLKSLALHDDKCWSVDVNNGGIMATGSTDRKIKLVDIRS--FQIIEELDDTAHKKTV 60

Query: 81  RSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHS 140
           RSV++RPHS+ILAAGSFDST+SIWGK++D    ++  ETELLAIIEGHENE+K V+WSH 
Sbjct: 61  RSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHD 120

Query: 141 GYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIR 200
           G  LA+CSRDKSVWIWEADE+GEE+EC+SVLQEH+QDVKHV+WH  + LLASSSYDDT+R
Sbjct: 121 GELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVR 180

Query: 201 LWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNYVEEEENGEDV 260
           +WK+  DDWEC AVLNGH+GTVW SDFEKS S++RL S SDD TVR+W   ++    E  
Sbjct: 181 IWKDCDDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQE 240

Query: 261 WAQEAILPNVHSRAVYSVSWSLDGYIASVGSDGLLXXXXXXXXXXXXXXXQQHEAHGIYE 320
           W QE+ILP  H+RAVYSV+WS  GYIAS GSDG L                +   HG+YE
Sbjct: 241 WIQESILPKAHTRAVYSVNWSPKGYIASTGSDGRLVIYKESEDGWIVECIHEL-THGVYE 299

Query: 321 INVVKWATV--DDSVLLLTGGDDGCANIW 347
            N+VKW      D +LL+T GDDG  N+W
Sbjct: 300 TNMVKWVEYGSKDVILLITAGDDGHVNVW 328

 Score = 55.1 bits (131), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 71/250 (28%), Positives = 117/250 (46%), Gaps = 32/250 (12%)

Query: 21  MSLELLKSLKLHTDKL----WSIDCSKGLMATSSSDRKIKLVNLKNM--DFQLVEELDDS 74
           +  ELL  ++ H +++    WS D    L+AT S D+ + +     M  +F+ +  L + 
Sbjct: 97  LETELLAIIEGHENEIKCVAWSHDGE--LLATCSRDKSVWIWEADEMGEEFECISVLQE- 153

Query: 75  THKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKA 134
            H + V+ V +     +LA+ S+D T+ IW      D  DD+   E  A++ GHE  V +
Sbjct: 154 -HSQDVKHVIWHQSLPLLASSSYDDTVRIW-----KDCDDDW---ECCAVLNGHEGTVWS 204

Query: 135 VSW--SHSGYYLASCSRDKSVWIWEADELGEEYECL----SVL-QEHAQDVKHVVWHSEM 187
             +  S+S   L S S D +V IW  ++   EYE      S+L + H + V  V W S  
Sbjct: 205 SDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNW-SPK 263

Query: 188 HLLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEK-----SESSLRLASCSDD 242
             +AS+  D  + ++KE  D W    +     G V+ ++  K     S+  + L +  DD
Sbjct: 264 GYIASTGSDGRLVIYKESEDGWIVECIHELTHG-VYETNMVKWVEYGSKDVILLITAGDD 322

Query: 243 STVRVWNYVE 252
             V VW + E
Sbjct: 323 GHVNVWKFDE 332

>Scas_615.11
          Length = 349

 Score =  396 bits (1017), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 203/345 (58%), Positives = 257/345 (74%), Gaps = 18/345 (5%)

Query: 21  MSLELLKSLKLHTDKLWSIDCSKGLMATSSSDRKIKLVNLKNM---DFQLVEELDDSTHK 77
           M ++L KSLKL  DKLWS+D S GL+AT S+DRKIK++N+ N       L++ LDD+ HK
Sbjct: 1   MGIKLAKSLKLQNDKLWSLDYSHGLLATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVHK 60

Query: 78  KSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQD---------DFPETELLAIIEGH 128
           K++R V++RPHS++LAAGSFDST+SIW +E+D + ++         +  E +LLAIIEGH
Sbjct: 61  KAIRCVAWRPHSNLLAAGSFDSTVSIWTREDDLEEEEDDDEGEGTTNSLEMDLLAIIEGH 120

Query: 129 ENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMH 188
           ENEVK ++WSH G  L+SCSRDKSVWIWE D+ GEEYEC+SVLQEH+QDVKHVVWH E+ 
Sbjct: 121 ENEVKGIAWSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELP 180

Query: 189 LLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSES--SLRLASCSDDSTVR 246
           LLASSSYDDTIRLWK+  DDWECAAVLNGH+GTVWCSDFEK ++  S+RL S SDDSTVR
Sbjct: 181 LLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVR 240

Query: 247 VWNYVEEEENGEDVWAQEAILPNVHSRAVYSVSWSLDGYIASVGSDGLLXXXXXXXXXXX 306
           VW Y++++E+G+  W  EAILP VH R +YSVSWS +G IAS GSDG L           
Sbjct: 241 VWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSWSTNGLIASTGSDGTLAVYKEVSNGDD 300

Query: 307 ----XXXXQQHEAHGIYEINVVKWATVDDSVLLLTGGDDGCANIW 347
                   +Q   HG+YE N+VKW  ++ +++L TGGDDGC N+W
Sbjct: 301 EHDWEVIAKQELCHGVYEANIVKWIDINGNMMLATGGDDGCVNLW 345

 Score = 55.5 bits (132), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 68/255 (26%), Positives = 123/255 (48%), Gaps = 37/255 (14%)

Query: 21  MSLELLKSLKLHTDKL----WSIDCSKGLMATSSSDRKIKL--VNLKNMDFQLVEELDDS 74
           + ++LL  ++ H +++    WS D    L+++ S D+ + +   +    +++ +  L + 
Sbjct: 109 LEMDLLAIIEGHENEVKGIAWSHD--GALLSSCSRDKSVWIWETDQDGEEYECISVLQE- 165

Query: 75  THKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKA 134
            H + V+ V + P   +LA+ S+D TI +W      D  DD+   E  A++ GHE  V  
Sbjct: 166 -HSQDVKHVVWHPELPLLASSSYDDTIRLW-----KDYDDDW---ECAAVLNGHEGTVWC 216

Query: 135 VSWSHS----GYYLASCSRDKSVWIW---EADELGE-EYECLSVLQE-HAQDVKHVVWHS 185
             +          L S S D +V +W   + DE G+ E+ C ++L + H + +  V W S
Sbjct: 217 SDFEKGKNGESIRLCSGSDDSTVRVWRYIDDDEDGQQEWICEAILPKVHDRQIYSVSW-S 275

Query: 186 EMHLLASSSYDDTIRLWKE-----DADDWECAAVLNGHKGTVWCSDFEK---SESSLRLA 237
              L+AS+  D T+ ++KE     D  DWE  A      G V+ ++  K      ++ LA
Sbjct: 276 TNGLIASTGSDGTLAVYKEVSNGDDEHDWEVIAKQELCHG-VYEANIVKWIDINGNMMLA 334

Query: 238 SCSDDSTVRVWNYVE 252
           +  DD  V +WN+ +
Sbjct: 335 TGGDDGCVNLWNWTD 349

>CAGL0M08646g 861488..862501 similar to tr|Q05583 Saccharomyces
           cerevisiae YDR267c, start by similarity
          Length = 337

 Score =  385 bits (988), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 194/333 (58%), Positives = 239/333 (71%), Gaps = 6/333 (1%)

Query: 21  MSLELLKSLKLHTDKLWSIDCS--KGLMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKK 78
           M L+L KSLKLH DK+WSID    +GL+AT S+DR IK++ LKN    L++ LDD+ HKK
Sbjct: 1   MPLQLAKSLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKK 60

Query: 79  SVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWS 138
           +VRSV++RPHS +LAAGSFDSTISIW + +    +    E ELLAIIEGHENEVK +SWS
Sbjct: 61  AVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWS 120

Query: 139 HSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDT 198
             G  LA+CSRDKSVWIWE DE GEEYEC+SVLQEH+QDVKHVVWH++ +LLASSSYDDT
Sbjct: 121 QDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDT 180

Query: 199 IRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNYVEEEENGE 258
           +R+WK+  DDWECAAVL GH+GT+WCSDF K E  +RL S SDDSTVRVW Y+ ++E+ +
Sbjct: 181 VRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQ 240

Query: 259 DVWAQEAILPNVHSRAVYSVSWSLDGYIASVGSDGLLXXXXXXXXXXXXX----XXQQHE 314
             W  E+ LPN H   +Y V+WS  G IASVG+DG+L                       
Sbjct: 241 QEWVCESTLPNAHRSQIYGVAWSPSGRIASVGADGVLAVYKEKQNDSEVSEWEISATYKA 300

Query: 315 AHGIYEINVVKWATVDDSVLLLTGGDDGCANIW 347
           AH +YEIN VKW  +D   +L+T GDDG  N+W
Sbjct: 301 AHTVYEINTVKWVNIDGKEMLITAGDDGRVNLW 333

>Sklu_1710.1 YDR267C, Contig c1710 17-739
          Length = 240

 Score =  327 bits (837), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 165/230 (71%), Positives = 188/230 (81%)

Query: 118 ETELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQD 177
           ETELLAI+EGHENEVK+VSWSHSGYYLA+CSRDKSVWIWEADE GEE+EC+SVLQEH+QD
Sbjct: 8   ETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQD 67

Query: 178 VKHVVWHSEMHLLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLA 237
           VKHVVWHS + LLASSSYDDTIR+WK+  DDW+CAAVLNGH+GTVWCSDFEKSESSLRL 
Sbjct: 68  VKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLC 127

Query: 238 SCSDDSTVRVWNYVEEEENGEDVWAQEAILPNVHSRAVYSVSWSLDGYIASVGSDGLLXX 297
           S SDD+TVR+W Y+E+ E+ E VWA +++LP+ HSRAVYSVSWS  G IAS GSDGLL  
Sbjct: 128 SGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSWSPTGLIASTGSDGLLAI 187

Query: 298 XXXXXXXXXXXXXQQHEAHGIYEINVVKWATVDDSVLLLTGGDDGCANIW 347
                        Q   AHG+YE NVVKW  +D   LL+TGGDDGC NIW
Sbjct: 188 YQEKEEGKWEIIAQHELAHGVYETNVVKWTQIDGETLLVTGGDDGCVNIW 237

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 60/206 (29%), Positives = 99/206 (48%), Gaps = 23/206 (11%)

Query: 20  RMSLELLKSLKLHTDKLWSIDCSKG--LMATSSSDRKIKL--VNLKNMDFQLVEELDDST 75
            M  ELL  ++ H +++ S+  S     +AT S D+ + +   +    +F+ +  L +  
Sbjct: 6   EMETELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQE-- 63

Query: 76  HKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAV 135
           H + V+ V +    S+LA+ S+D TI IW      D  DD+   +  A++ GHE  V   
Sbjct: 64  HSQDVKHVVWHSVLSLLASSSYDDTIRIW-----KDFDDDW---QCAAVLNGHEGTVWCS 115

Query: 136 SW--SHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQE-----HAQDVKHVVWHSEMH 188
            +  S S   L S S D +V IW+  E  E+ E +  LQ      H++ V  V W S   
Sbjct: 116 DFEKSESSLRLCSGSDDTTVRIWKYIEDNEDDEQVWALQSVLPSAHSRAVYSVSW-SPTG 174

Query: 189 LLASSSYDDTIRLWKEDAD-DWECAA 213
           L+AS+  D  + +++E  +  WE  A
Sbjct: 175 LIASTGSDGLLAIYQEKEEGKWEIIA 200

>CAGL0I03718g complement(317565..321170) highly similar to sp|P53622
           Saccharomyces cerevisiae YDL145c RET1 Coatomer alpha
           subunit, start by similarity
          Length = 1201

 Score = 77.8 bits (190), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 56/175 (32%), Positives = 81/175 (46%), Gaps = 22/175 (12%)

Query: 78  KSVRS--VSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAV 135
           KS R+  ++F P         F STI +W          D+    LL   EGHE  V+AV
Sbjct: 10  KSTRAKGIAFHPSRPWALVALFSSTIQLW----------DYRMGTLLHRFEGHEGPVRAV 59

Query: 136 SWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSY 195
            +  +     S   D S+ +W      E   CL  L  H   V+ V +HSE+  + S+S 
Sbjct: 60  DFHPTQPIFVSAGDDASIKVWSL----ETNRCLYTLTGHLDYVRTVFFHSELPWVISASD 115

Query: 196 DDTIRLWK-EDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWN 249
           D T+R+W  ++  +  C   L GH   V C+ F ++E    + S S D TVRVW+
Sbjct: 116 DQTVRIWNWQNRKELAC---LTGHNHFVMCAQFHQTED--LVVSASLDETVRVWD 165

 Score = 49.3 bits (116), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 57/127 (44%), Gaps = 14/127 (11%)

Query: 76  HKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAV 135
           H+  VR+V F P   I  +   D++I +W  E +            L  + GH + V+ V
Sbjct: 52  HEGPVRAVDFHPTQPIFVSAGDDASIKVWSLETN----------RCLYTLTGHLDYVRTV 101

Query: 136 SWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSY 195
            +     ++ S S D++V IW      E    L+ L  H   V    +H    L+ S+S 
Sbjct: 102 FFHSELPWVISASDDQTVRIWNWQNRKE----LACLTGHNHFVMCAQFHQTEDLVVSASL 157

Query: 196 DDTIRLW 202
           D+T+R+W
Sbjct: 158 DETVRVW 164

 Score = 42.7 bits (99), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 42/201 (20%), Positives = 79/201 (39%), Gaps = 40/201 (19%)

Query: 76  HKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAV 135
           H   VR+V F      + + S D T+ IW  +   +          LA + GH + V   
Sbjct: 94  HLDYVRTVFFHSELPWVISASDDQTVRIWNWQNRKE----------LACLTGHNHFVMCA 143

Query: 136 SWSHSGYYLASCSRDKSVWIWEADELGEEYECLSV------------------------- 170
            +  +   + S S D++V +W+   L +++    V                         
Sbjct: 144 QFHQTEDLVVSASLDETVRVWDISGLRKKHSAPGVTSYEDSLASQQNLLDGAFGDCKVKF 203

Query: 171 -LQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDADD-WECAAVLNGHKGTVWCSDFE 228
            L+ H + V    +H  + L+ +   D  ++LW+  ++  WE      GH   V C  F 
Sbjct: 204 ILEGHTRGVNWASFHPTLPLIVTGGDDRQVKLWRMSSNKAWEVDTC-RGHTNNVDCVVFH 262

Query: 229 KSESSLRLASCSDDSTVRVWN 249
             ++   + S ++D T+R+W+
Sbjct: 263 PDQN--LILSVAEDKTLRIWD 281

 Score = 38.9 bits (89), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 34/137 (24%), Positives = 58/137 (42%), Gaps = 10/137 (7%)

Query: 120 ELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVK 179
           +LL   E      K +++  S  +        ++ +W+   +G     L   + H   V+
Sbjct: 2   KLLTKFESKSTRAKGIAFHPSRPWALVALFSSTIQLWDY-RMGT---LLHRFEGHEGPVR 57

Query: 180 HVVWHSEMHLLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLR-LAS 238
            V +H    +  S+  D +I++W  + +   C   L GH   V    F    S L  + S
Sbjct: 58  AVDFHPTQPIFVSAGDDASIKVWSLETN--RCLYTLTGHLDYVRTVFFH---SELPWVIS 112

Query: 239 CSDDSTVRVWNYVEEEE 255
            SDD TVR+WN+   +E
Sbjct: 113 ASDDQTVRIWNWQNRKE 129

 Score = 35.4 bits (80), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 49/247 (19%), Positives = 100/247 (40%), Gaps = 41/247 (16%)

Query: 23  LELLKSLKLHTDKLWSIDCSKGLMATSSSDRKIKLVNLKNMDFQLVEELDDST-HKKSVR 81
           L+ ++++  H++  W I        ++S D+ +++ N +N      +EL   T H   V 
Sbjct: 95  LDYVRTVFFHSELPWVI--------SASDDQTVRIWNWQNR-----KELACLTGHNHFVM 141

Query: 82  SVSFRPHSSILAAGSFDSTISIW---------------GKEEDADPQDD-----FPETEL 121
              F     ++ + S D T+ +W                 E+    Q +     F + ++
Sbjct: 142 CAQFHQTEDLVVSASLDETVRVWDISGLRKKHSAPGVTSYEDSLASQQNLLDGAFGDCKV 201

Query: 122 LAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHV 181
             I+EGH   V   S+  +   + +   D+ V +W      + +E +   + H  +V  V
Sbjct: 202 KFILEGHTRGVNWASFHPTLPLIVTGGDDRQVKLWRMSS-NKAWE-VDTCRGHTNNVDCV 259

Query: 182 VWHSEMHLLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSD 241
           V+H + +L+ S + D T+R+W  D D               W     +S  ++ L   + 
Sbjct: 260 VFHPDQNLILSVAEDKTLRIW--DLDKRTPVKQFKRENDRFWLI---RSHPNMSLFGAAH 314

Query: 242 DSTVRVW 248
           DS + ++
Sbjct: 315 DSGIMIF 321

>CAGL0J10340g complement(1008637..1009653) highly similar to
           sp|P53011 Saccharomyces cerevisiae YGL100w SEH1 nuclear
           pore protein, start by similarity
          Length = 338

 Score = 72.4 bits (176), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 45/172 (26%), Positives = 89/172 (51%), Gaps = 13/172 (7%)

Query: 127 GHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSE 186
           GHE+ V  V++   G  +A+CS D+ + +++ D+    +E     + H   +  + W S 
Sbjct: 7   GHEDIVHDVAYDFYGRTMATCSSDQHIKVFKLDKDATRWEVNDSWRAHDSSIVSLDWASP 66

Query: 187 MH--LLASSSYDDTIRLWKEDADDWECAA-------VLNGHKGTVWCSDFEKSESSLRLA 237
            +  ++AS+SYD TI++W+ED +  EC+         LN  KG+++C  F  S   LR+A
Sbjct: 67  EYGRIIASASYDKTIKIWEEDPNQEECSGRRWTRLCTLNDSKGSLYCVKFAPSHLGLRIA 126

Query: 238 SCSDDSTVRVWNYVEEEE-NGEDVWAQEAILPNVHS---RAVYSVSWSLDGY 285
           S  +D  +R+++ ++        + A+  +LP   +   ++ + +SW    +
Sbjct: 127 SIGNDGIMRMYDALDPSNLRSWTMTAEVKVLPVAPANNLQSAFGLSWCFTRF 178

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 37/61 (60%), Gaps = 2/61 (3%)

Query: 118 ETELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQD 177
           E ELL+  + H+ EV +VSW+ +G  L+S   D  V +W++     EY+C+S++    QD
Sbjct: 280 EVELLSEHDDHKGEVWSVSWNLTGTILSSTGEDGKVRLWKS-TYSNEYKCMSIITS-KQD 337

Query: 178 V 178
           +
Sbjct: 338 I 338

 Score = 30.4 bits (67), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 41/73 (56%), Gaps = 8/73 (10%)

Query: 46  MATSSSDRKIKLVNLKNMDFQLVEELDDS--THKKSVRSVSFRP--HSSILAAGSFDSTI 101
           MAT SSD+ IK+  L     +   E++DS   H  S+ S+ +    +  I+A+ S+D TI
Sbjct: 24  MATCSSDQHIKVFKLDKDATRW--EVNDSWRAHDSSIVSLDWASPEYGRIIASASYDKTI 81

Query: 102 SIWGKEEDADPQD 114
            IW  EED + ++
Sbjct: 82  KIW--EEDPNQEE 92

 Score = 30.0 bits (66), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 164 EYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWKED-ADDWECAAVL 215
           E E LS   +H  +V  V W+    +L+S+  D  +RLWK   +++++C +++
Sbjct: 280 EVELLSEHDDHKGEVWSVSWNLTGTILSSTGEDGKVRLWKSTYSNEYKCMSII 332

>Kwal_23.5351
          Length = 474

 Score = 71.6 bits (174), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 63/215 (29%), Positives = 97/215 (45%), Gaps = 24/215 (11%)

Query: 78  KSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEG-HENEVKAVS 136
           + V  V+  P  + LAAGS++  + I        PQ      E++  ++G H++++  V+
Sbjct: 183 RPVSQVARSPDGASLAAGSWNGDVKIL------HPQ----SLEVVRSLDGAHDDKIGGVA 232

Query: 137 WSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYD 196
           WS     LA+   D  V IW             VL+ H   V  V +H     +AS+S+D
Sbjct: 233 WSSDSQLLATGGADNLVKIWNPQAQSHSEASRVVLRGHEARVSKVKFHPSDRFVASASFD 292

Query: 197 DTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNYVEEEEN 256
            T RLW  D +      +  GH   V+C DF+  + SL L S   DS   VW+       
Sbjct: 293 MTWRLW--DVERETELQLQEGHAKEVYCLDFQ-CDGSL-LCSAGLDSVGHVWDM----RT 344

Query: 257 GEDVWAQEAILPNVHSRAVYSVSWSLDGYIASVGS 291
           G  +   E      H++ +Y VSWS +G+  + GS
Sbjct: 345 GRSLMVLEG-----HAKPIYGVSWSPNGHHVATGS 374

 Score = 70.1 bits (170), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 69/236 (29%), Positives = 102/236 (43%), Gaps = 24/236 (10%)

Query: 18  LQRMSLELLKSL-KLHTDKL----WSIDCSKGLMATSSSDRKIKLVNLKNMDFQLVEELD 72
           L   SLE+++SL   H DK+    WS D    L+AT  +D  +K+ N +         + 
Sbjct: 209 LHPQSLEVVRSLDGAHDDKIGGVAWSSDSQ--LLATGGADNLVKIWNPQAQSHSEASRVV 266

Query: 73  DSTHKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEV 132
              H+  V  V F P    +A+ SFD T  +W  E          ETE L + EGH  EV
Sbjct: 267 LRGHEARVSKVKFHPSDRFVASASFDMTWRLWDVER---------ETE-LQLQEGHAKEV 316

Query: 133 KAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLAS 192
             + +   G  L S   D    +W+          L VL+ HA+ +  V W    H +A+
Sbjct: 317 YCLDFQCDGSLLCSAGLDSVGHVWDM----RTGRSLMVLEGHAKPIYGVSWSPNGHHVAT 372

Query: 193 SSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVW 248
            S D T+++W  D       + +  H   V   +FEK   +  L S S D T+ V+
Sbjct: 373 GSGDGTVQVW--DIRKANKPSSILAHNSIVSEVNFEKENGNF-LVSSSYDRTIGVF 425

>Scas_679.28
          Length = 815

 Score = 71.2 bits (173), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 42/156 (26%), Positives = 71/156 (45%), Gaps = 16/156 (10%)

Query: 68  VEELDDSTHKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEG 127
           V E     H+K + +++  P+ SI A  S+D T  IW          D    EL A +  
Sbjct: 482 VSEYTRRAHEKDINALAISPNDSIFATASYDKTCKIW----------DLENGELTATLSN 531

Query: 128 HENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEM 187
           H+  +  V++      +A+CS DK++ IW  D     +  +  L+ H   V+  ++ ++ 
Sbjct: 532 HKRGLWDVAFCQYDKLIATCSGDKTIKIWSLD----TFSVMKTLEGHTNAVQRCMFINKQ 587

Query: 188 HLLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVW 223
             L SS  D  I++W  D    +C   L+GH   +W
Sbjct: 588 LQLVSSGADGLIKIW--DCSTGDCLKTLDGHDNRIW 621

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 70/307 (22%), Positives = 134/307 (43%), Gaps = 50/307 (16%)

Query: 18  LQRMSLE---LLKSLKLHTDKLWSIDCSKGL----MATSSSDRKIKLVNLKNMDFQLVEE 70
           LQ +SLE   ++K  K H ++L+ I     L    M    SD+ ++LV++K+    L+ E
Sbjct: 266 LQFISLEKATMIKKTKKHIEELFIIGVLPILENDKMYLVMSDQTLELVDIKS---NLLNE 322

Query: 71  LDD--------STHKKSVRSVSF-RPHSSILAAGSFDSTISIWGKEEDADPQDDFPETEL 121
             D        + +  ++  + F  P+   LA  +   T+ I      +  Q++ P    
Sbjct: 323 SSDIIEIESCIAGNNGTIADMKFVGPNHDKLALATNSPTLRII--PVPSSEQEELPIN-- 378

Query: 122 LAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDV--- 178
           + + EGHE+ + ++  +  G ++A+ S+D +  +W+ + +  +++       H+  V   
Sbjct: 379 VEMYEGHEDLLNSLDTTDDGLWMATASKDHTAIVWKYNSIINKFQPYVKFIGHSATVTAV 438

Query: 179 --KHVVWHSEMHLLASSSYDDTIRLWK----EDADDWECAAV------LNGHKGTVWCSD 226
              +V+       L ++S D TI+ WK        + +C  V         H+  +    
Sbjct: 439 GLPNVMLRGYPEFLLTASNDLTIKKWKIPKPSTTVEEDCQIVKVSEYTRRAHEKDINALA 498

Query: 227 FEKSESSLRLASCSDDSTVRVWNYVEEEENGEDVWAQEAILPNVHSRAVYSVSW-SLDGY 285
              ++S    A+ S D T ++W+     ENGE      A L N H R ++ V++   D  
Sbjct: 499 ISPNDSI--FATASYDKTCKIWDL----ENGE----LTATLSN-HKRGLWDVAFCQYDKL 547

Query: 286 IASVGSD 292
           IA+   D
Sbjct: 548 IATCSGD 554

>AEL269C [2236] [Homologous to ScYPR178W (PRP4) - SH]
           (134760..136127) [1368 bp, 455 aa]
          Length = 455

 Score = 70.9 bits (172), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 51/188 (27%), Positives = 89/188 (47%), Gaps = 22/188 (11%)

Query: 61  KNMDFQLVEELDDSTHKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETE 120
           + ++ QL E      H K+V +++F+   ++LA+   D+  +IW          D    E
Sbjct: 287 RKVELQLQE-----GHSKAVYTIAFQSDGALLASAGLDAVCAIW----------DLRSGE 331

Query: 121 LLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKH 180
            +  +EGH   +  V WS +GY LA+   D +V +W+   +G E   L+  Q  A DVK 
Sbjct: 332 PIMKLEGHAGAISGVDWSPNGYQLATAGADGTVRVWDIRNVGTESALLA-HQVAALDVK- 389

Query: 181 VVWHSEMHLLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCS 240
               +    L S  +D  + ++  +AD+W+  A L GH   V+  D  +  S+  + S  
Sbjct: 390 -FKKNNGTFLVSCGHDRLVNIF--NADNWQKLASLEGHTDRVFTVDITEDGST--IYSGG 444

Query: 241 DDSTVRVW 248
            D +++ W
Sbjct: 445 KDRSLKQW 452

 Score = 55.8 bits (133), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 57/225 (25%), Positives = 97/225 (43%), Gaps = 30/225 (13%)

Query: 73  DSTHKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEV 132
           D+ H+  +  + + P  + L +G  D+ + +W    ++     F E      + GH   V
Sbjct: 211 DAAHEGKIGGLDWHPDGNHLLSGGGDNLVKLWDMTSNS-----FEE------LRGHAGRV 259

Query: 133 KAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLAS 192
             V    SG   AS S D +  +W+ +   E    L + + H++ V  + + S+  LLAS
Sbjct: 260 SRVKVHPSGRLAASASFDLTWILWDLERKVE----LQLQEGHSKAVYTIAFQSDGALLAS 315

Query: 193 SSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNYVE 252
           +  D    +W  D    E    L GH G +   D+  S +  +LA+   D TVRVW+   
Sbjct: 316 AGLDAVCAIW--DLRSGEPIMKLEGHAGAISGVDW--SPNGYQLATAGADGTVRVWDI-- 369

Query: 253 EEENGEDVWAQEAILPNVHSRAVYSVSWSLDG--YIASVGSDGLL 295
                 +V  + A+L   H  A   V +  +   ++ S G D L+
Sbjct: 370 -----RNVGTESALL--AHQVAALDVKFKKNNGTFLVSCGHDRLV 407

 Score = 53.5 bits (127), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 79/172 (45%), Gaps = 19/172 (11%)

Query: 123 AIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVV 182
           +I   HE ++  + W   G +L S   D  V +W  D     +E    L+ HA  V  V 
Sbjct: 209 SIDAAHEGKIGGLDWHPDGNHLLSGGGDNLVKLW--DMTSNSFE---ELRGHAGRVSRVK 263

Query: 183 WHSEMHLLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDD 242
            H    L AS+S+D T  LW  D +      +  GH   V+   F+ S+ +L LAS   D
Sbjct: 264 VHPSGRLAASASFDLTWILW--DLERKVELQLQEGHSKAVYTIAFQ-SDGAL-LASAGLD 319

Query: 243 STVRVWNYVEEEENGEDVWAQEAILPNVHSRAVYSVSWSLDGY-IASVGSDG 293
           +   +W+      +GE +   E      H+ A+  V WS +GY +A+ G+DG
Sbjct: 320 AVCAIWDL----RSGEPIMKLEG-----HAGAISGVDWSPNGYQLATAGADG 362

>Kwal_56.24526
          Length = 1210

 Score = 71.2 bits (173), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 52/175 (29%), Positives = 80/175 (45%), Gaps = 22/175 (12%)

Query: 78  KSVRS--VSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAV 135
           KS R+  ++F P    +    F S+I +W          D+    LL   E HE  V+ +
Sbjct: 10  KSTRAKGLAFHPSRPWVLVALFSSSIQLW----------DYRMGTLLHKFEDHEGPVRGI 59

Query: 136 SWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSY 195
            +  +     S   D ++ +W  D      +CL  L  H   V+ V +H E+  + S+S 
Sbjct: 60  DFHPTQPLFVSAGDDYTIKVWSLDT----KKCLFTLNGHLDYVRTVFFHRELPWIISASD 115

Query: 196 DDTIRLWK-EDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWN 249
           D TIR+W  ++  +  C   L GH   V C+DF  +E    + S S D TVRVW+
Sbjct: 116 DQTIRIWNWQNRKEIAC---LTGHNHFVMCADFHPTED--LVVSASLDETVRVWD 165

 Score = 44.7 bits (104), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 34/136 (25%), Positives = 60/136 (44%), Gaps = 8/136 (5%)

Query: 120 ELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVK 179
           ++L   E      K +++  S  ++       S+ +W+   +G     L   ++H   V+
Sbjct: 2   KMLTKFESKSTRAKGLAFHPSRPWVLVALFSSSIQLWDY-RMGT---LLHKFEDHEGPVR 57

Query: 180 HVVWHSEMHLLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASC 239
            + +H    L  S+  D TI++W  D    +C   LNGH   V    F +      + S 
Sbjct: 58  GIDFHPTQPLFVSAGDDYTIKVWSLDTK--KCLFTLNGHLDYVRTVFFHRELP--WIISA 113

Query: 240 SDDSTVRVWNYVEEEE 255
           SDD T+R+WN+   +E
Sbjct: 114 SDDQTIRIWNWQNRKE 129

 Score = 44.7 bits (104), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 56/127 (44%), Gaps = 14/127 (11%)

Query: 76  HKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAV 135
           H+  VR + F P   +  +   D TI +W  +            + L  + GH + V+ V
Sbjct: 52  HEGPVRGIDFHPTQPLFVSAGDDYTIKVWSLDTK----------KCLFTLNGHLDYVRTV 101

Query: 136 SWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSY 195
            +     ++ S S D+++ IW      +E  CL+    H   V    +H    L+ S+S 
Sbjct: 102 FFHRELPWIISASDDQTIRIWNWQN-RKEIACLT---GHNHFVMCADFHPTEDLVVSASL 157

Query: 196 DDTIRLW 202
           D+T+R+W
Sbjct: 158 DETVRVW 164

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 57/256 (22%), Positives = 99/256 (38%), Gaps = 50/256 (19%)

Query: 25  LLKSLKLHTDKLWSID--CSKGLMATSSSDRKIKL--VNLKNMDFQLVEELDDSTHKKSV 80
           LL   + H   +  ID   ++ L  ++  D  IK+  ++ K   F L   LD       V
Sbjct: 45  LLHKFEDHEGPVRGIDFHPTQPLFVSAGDDYTIKVWSLDTKKCLFTLNGHLD------YV 98

Query: 81  RSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHS 140
           R+V F      + + S D TI IW  +   +          +A + GH + V    +  +
Sbjct: 99  RTVFFHRELPWIISASDDQTIRIWNWQNRKE----------IACLTGHNHFVMCADFHPT 148

Query: 141 GYYLASCSRDKSVWIWEADELGEEYECLS--------------------------VLQEH 174
              + S S D++V +W+   L + +   S                          +L+ H
Sbjct: 149 EDLVVSASLDETVRVWDISGLRKRHSAPSTYTLEDQIAAQQNLLDGGFGDCVVKFILEGH 208

Query: 175 AQDVKHVVWHSEMHLLASSSYDDTIRLWKEDADD-WECAAVLNGHKGTVWCSDFEKSESS 233
           ++ V    +H  + L+ S   D  ++LW+  +   WE      GH   V    F   ++ 
Sbjct: 209 SRGVNWASFHPTLPLIVSGGDDRQVKLWRMSSTKAWEVDTC-RGHTNNVDSVIFHPHQN- 266

Query: 234 LRLASCSDDSTVRVWN 249
             + S  +D TVRVW+
Sbjct: 267 -LIISVGEDKTVRVWD 281

 Score = 29.3 bits (64), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 41/183 (22%), Positives = 72/183 (39%), Gaps = 28/183 (15%)

Query: 76  HKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAV 135
           H + V   SF P   ++ +G  D  + +W        + D           GH N V +V
Sbjct: 208 HSRGVNWASFHPTLPLIVSGGDDRQVKLWRMSSTKAWEVD--------TCRGHTNNVDSV 259

Query: 136 SWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKH--VVWHSEMHLLASS 193
            +      + S   DK+V +W+ D+         V Q   ++ +   V  H  ++L   +
Sbjct: 260 IFHPHQNLIISVGEDKTVRVWDLDKR------TPVKQFKRENDRFWLVRAHPNINLFG-A 312

Query: 194 SYDDTIRLWKEDADDWECAAV-------LNGHKGTVWCSDFEKSESSLRLASCSDDSTVR 246
           ++D  I ++K D +   C+ +       +N  K  V   D+ K  +SL   S  +    R
Sbjct: 313 AHDSGIMVFKLDRER-PCSVINQNQLIFVNKEK-QVQSFDYNKKIASLPYVSLKNIG--R 368

Query: 247 VWN 249
            WN
Sbjct: 369 AWN 371

>ADR077C [1818] [Homologous to ScYDL145C (COP1) - SH]
           (843171..846785) [3615 bp, 1204 aa]
          Length = 1204

 Score = 70.9 bits (172), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 49/170 (28%), Positives = 78/170 (45%), Gaps = 20/170 (11%)

Query: 81  RSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHS 140
           ++++F P    +    F STI +W          D+    LL   E HE  V+ V +  +
Sbjct: 15  KAIAFHPSRPWVLVALFSSTIQLW----------DYRMGVLLHRFEEHEGPVRGVDFHPT 64

Query: 141 GYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIR 200
                S   D S+ +W        ++CL  L  H   V+ V +H+E+  + S+S D TIR
Sbjct: 65  QPLFVSAGDDYSIKVWSL----STHKCLFTLNGHLDYVRTVFFHTELPWIISASDDQTIR 120

Query: 201 LWK-EDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWN 249
           +W  ++  +  C   L GH   V C+ F  +E    + S S D TVR+W+
Sbjct: 121 IWNWQNRREIAC---LTGHNHFVMCAQFHPTED--LVVSASLDETVRIWD 165

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 31/127 (24%), Positives = 54/127 (42%), Gaps = 14/127 (11%)

Query: 76  HKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAV 135
           H+  VR V F P   +  +   D +I +W               + L  + GH + V+ V
Sbjct: 52  HEGPVRGVDFHPTQPLFVSAGDDYSIKVWS----------LSTHKCLFTLNGHLDYVRTV 101

Query: 136 SWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSY 195
            +     ++ S S D+++ IW      E    ++ L  H   V    +H    L+ S+S 
Sbjct: 102 FFHTELPWIISASDDQTIRIWNWQNRRE----IACLTGHNHFVMCAQFHPTEDLVVSASL 157

Query: 196 DDTIRLW 202
           D+T+R+W
Sbjct: 158 DETVRIW 164

 Score = 42.7 bits (99), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 49/205 (23%), Positives = 80/205 (39%), Gaps = 38/205 (18%)

Query: 23  LELLKSLKLHTDKLWSIDCSKGLMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRS 82
           L+ ++++  HT+  W I        ++S D+ I++ N +N      E    + H   V  
Sbjct: 95  LDYVRTVFFHTELPWII--------SASDDQTIRIWNWQNRR----EIACLTGHNHFVMC 142

Query: 83  VSFRPHSSILAAGSFDSTISIWG-----KEEDADPQDDFPETELLA-------------- 123
             F P   ++ + S D T+ IW      K   A     F E  +                
Sbjct: 143 AQFHPTEDLVVSASLDETVRIWDISGLRKRHSAPGSQSFEEQMITQQNLFDGGFGDCVVK 202

Query: 124 -IIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELG--EEYECLSVLQEHAQDVKH 180
            I+EGH   V   S+  +   + S S D+ V +W        E   C    + H  +V  
Sbjct: 203 FILEGHTRGVNWASFHPTLPLIVSGSDDRQVKLWRMSSTKAWEVDTC----RGHTNNVDS 258

Query: 181 VVWHSEMHLLASSSYDDTIRLWKED 205
           V++H   +L+ S   D TIR+W  D
Sbjct: 259 VIFHPFQNLIISVGEDSTIRVWDLD 283

 Score = 42.4 bits (98), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 35/137 (25%), Positives = 60/137 (43%), Gaps = 10/137 (7%)

Query: 120 ELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVK 179
           ++L   E      KA+++  S  ++       ++ +W+   +G     L   +EH   V+
Sbjct: 2   KMLTKFESKSTRAKAIAFHPSRPWVLVALFSSTIQLWDY-RMGV---LLHRFEEHEGPVR 57

Query: 180 HVVWHSEMHLLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLR-LAS 238
            V +H    L  S+  D +I++W       +C   LNGH   V    F    + L  + S
Sbjct: 58  GVDFHPTQPLFVSAGDDYSIKVW--SLSTHKCLFTLNGHLDYVRTVFFH---TELPWIIS 112

Query: 239 CSDDSTVRVWNYVEEEE 255
            SDD T+R+WN+    E
Sbjct: 113 ASDDQTIRIWNWQNRRE 129

 Score = 42.0 bits (97), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 46/201 (22%), Positives = 80/201 (39%), Gaps = 40/201 (19%)

Query: 76  HKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAV 135
           H   VR+V F      + + S D TI IW  +   +          +A + GH + V   
Sbjct: 94  HLDYVRTVFFHTELPWIISASDDQTIRIWNWQNRRE----------IACLTGHNHFVMCA 143

Query: 136 SWSHSGYYLASCSRDKSVWIWEADELGEEY------------------------ECLS-- 169
            +  +   + S S D++V IW+   L + +                        +C+   
Sbjct: 144 QFHPTEDLVVSASLDETVRIWDISGLRKRHSAPGSQSFEEQMITQQNLFDGGFGDCVVKF 203

Query: 170 VLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDADD-WECAAVLNGHKGTVWCSDFE 228
           +L+ H + V    +H  + L+ S S D  ++LW+  +   WE      GH   V    F 
Sbjct: 204 ILEGHTRGVNWASFHPTLPLIVSGSDDRQVKLWRMSSTKAWEVDTC-RGHTNNVDSVIFH 262

Query: 229 KSESSLRLASCSDDSTVRVWN 249
             ++   + S  +DST+RVW+
Sbjct: 263 PFQN--LIISVGEDSTIRVWD 281

 Score = 31.2 bits (69), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 35/171 (20%), Positives = 64/171 (37%), Gaps = 18/171 (10%)

Query: 76  HKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAV 135
           H + V   SF P   ++ +GS D  + +W        + D           GH N V +V
Sbjct: 208 HTRGVNWASFHPTLPLIVSGSDDRQVKLWRMSSTKAWEVD--------TCRGHTNNVDSV 259

Query: 136 SWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSY 195
            +      + S   D ++ +W+ D    +   +   +        +  H  ++L   +++
Sbjct: 260 IFHPFQNLIISVGEDSTIRVWDLD----KRTPVKQFKREQDRFWSIRAHPNVNLFG-AAH 314

Query: 196 DDTIRLWKEDADDWECAAVLN-----GHKGTVWCSDFEKSESSLRLASCSD 241
           D  I ++K D +    A   N       +  V   D+EK  SSL   S  +
Sbjct: 315 DSGIMVFKLDRERPPVAVNQNQLYFVNKEKQVQMFDYEKKVSSLPFVSLKN 365

>KLLA0E23529g 2088516..2090996 similar to sp|P38129 Saccharomyces
           cerevisiae YBR198c TAF90 TFIID and SAGA subunit, start
           by similarity
          Length = 826

 Score = 70.1 bits (170), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 73/270 (27%), Positives = 108/270 (40%), Gaps = 29/270 (10%)

Query: 83  VSFRPHSSILAAGSFDSTISIWGKEEDADP-QDDFP----ETELLAIIEGHENEVKAVSW 137
           V F   + + AAG  DSTI +W    D  P Q   P    +    A + GH   V +V++
Sbjct: 504 VEFSDDARLTAAGFQDSTIKVW--YLDGSPLQSILPSKAKDQSNSATLVGHSGPVYSVAF 561

Query: 138 SHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDD 197
           S    YL S S DK+V +W  D     + CL   + H   V +V +    H   ++S+D 
Sbjct: 562 SPDNRYLLSASEDKTVRLWSLD----TFTCLVCYKGHNHPVWYVKFSPLGHYFITASHDQ 617

Query: 198 TIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNYVEEEENG 257
           T RLW    D      + +GH   V CS F    +   + + S D T R+W+     + G
Sbjct: 618 TARLW--SCDHIYPLRIFSGHLNDVDCSTFH--PNGCYVFTGSSDKTCRMWDI----QTG 669

Query: 258 EDVWAQEAILPNVHSRAVYSVSWSLDGYIASVGSDGLLXXXXXXXXXXXXXXXQQHEAHG 317
           + V          H+  V ++  S DG   + GS+                  + H  + 
Sbjct: 670 DSVRLFLG-----HTSPVTALEVSPDGRWLTTGSEDGTIIVWDIGTGKRIKQMKGHGKNP 724

Query: 318 IYEINVVKWATVDDSVLLLTGGDDGCANIW 347
           IY I   K         L+TGG D    +W
Sbjct: 725 IYSITFNKEGNC-----LVTGGADQSVRVW 749

 Score = 34.7 bits (78), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 36/164 (21%), Positives = 71/164 (43%), Gaps = 23/164 (14%)

Query: 9   YTFSHKHTRLQRM-SLELLKSLKLHTDKLWSIDCSKG-----LMATSSSDRKIKLVNLKN 62
           Y  +  H +  R+ S + +  L++ +  L  +DCS        + T SSD+  ++ +++ 
Sbjct: 609 YFITASHDQTARLWSCDHIYPLRIFSGHLNDVDCSTFHPNGCYVFTGSSDKTCRMWDIQT 668

Query: 63  MD-FQLVEELDDSTHKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETEL 121
            D  +L        H   V ++   P    L  GS D TI +W          D    + 
Sbjct: 669 GDSVRLF-----LGHTSPVTALEVSPDGRWLTTGSEDGTIIVW----------DIGTGKR 713

Query: 122 LAIIEGH-ENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEE 164
           +  ++GH +N + +++++  G  L +   D+SV +W+      E
Sbjct: 714 IKQMKGHGKNPIYSITFNKEGNCLVTGGADQSVRVWDIKRFTNE 757

>KLLA0F04884g complement(478044..481682) similar to sp|P53622
           Saccharomyces cerevisiae YDL145c RET1 coatomer complex
           alpha chain of secretory pathway vesicles, start by
           similarity
          Length = 1212

 Score = 69.7 bits (169), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 53/175 (30%), Positives = 78/175 (44%), Gaps = 22/175 (12%)

Query: 78  KSVRS--VSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAV 135
           KS R+  ++F P    +    F STI +W          D+    LL   E HE  V+ +
Sbjct: 10  KSTRAKGIAFHPSRPWVLVALFSSTIQLW----------DYRMGVLLHRFEDHEGPVRGI 59

Query: 136 SWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSY 195
            +  +     S   D ++ +W      E  +CL  L  H   V+ V +H E+  + SSS 
Sbjct: 60  DFHPTQPLFVSAGDDYTIKVWSL----ESNKCLFTLDGHLDYVRTVFFHHELPWIISSSD 115

Query: 196 DDTIRLWK-EDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWN 249
           D TIR+W  ++  +  C   L GH   V C+ F   E    + S S D TVRVW+
Sbjct: 116 DQTIRIWNWQNRKEIAC---LTGHNHFVMCAQFHPVED--LVVSASLDETVRVWD 165

 Score = 42.0 bits (97), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 54/248 (21%), Positives = 97/248 (39%), Gaps = 43/248 (17%)

Query: 23  LELLKSLKLHTDKLWSIDCSKGLMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRS 82
           L+ ++++  H +  W I        +SS D+ I++ N +N      E    + H   V  
Sbjct: 95  LDYVRTVFFHHELPWII--------SSSDDQTIRIWNWQNRK----EIACLTGHNHFVMC 142

Query: 83  VSFRPHSSILAAGSFDSTISIW---------------GKEEDADPQDD-----FPETELL 122
             F P   ++ + S D T+ +W                 EE    Q +     F +  + 
Sbjct: 143 AQFHPVEDLVVSASLDETVRVWDISGLRKRHSAPGTQSFEEQMRQQQNLLDGGFGDCVVK 202

Query: 123 AIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWE--ADELGEEYECLSVLQEHAQDVKH 180
            I+EGH   V   S+  +   + S S D+ V +W   A +  E   C    + H  +V  
Sbjct: 203 FILEGHTRGVNWASFHPTLPLIVSGSDDRQVKLWRMSATKAWEVDTC----RGHTNNVDS 258

Query: 181 VVWHSEMHLLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCS 240
           V++H + +L+ S   D T+R+W  D D               W     ++  +L L   +
Sbjct: 259 VIFHPQQNLIISVGEDKTVRVW--DLDKRTPIKQFKRENDRFWLV---RAHPNLNLFGAA 313

Query: 241 DDSTVRVW 248
            DS + ++
Sbjct: 314 HDSGIMIF 321

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 48/233 (20%), Positives = 82/233 (35%), Gaps = 62/233 (26%)

Query: 76  HKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDA-----DPQDDFPETEL--------- 121
           H+  VR + F P   +  +   D TI +W  E +      D   D+  T           
Sbjct: 52  HEGPVRGIDFHPTQPLFVSAGDDYTIKVWSLESNKCLFTLDGHLDYVRTVFFHHELPWII 111

Query: 122 ------------------LAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGE 163
                             +A + GH + V    +      + S S D++V +W+   L +
Sbjct: 112 SSSDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHPVEDLVVSASLDETVRVWDISGLRK 171

Query: 164 EY------------------------ECLS--VLQEHAQDVKHVVWHSEMHLLASSSYDD 197
            +                        +C+   +L+ H + V    +H  + L+ S S D 
Sbjct: 172 RHSAPGTQSFEEQMRQQQNLLDGGFGDCVVKFILEGHTRGVNWASFHPTLPLIVSGSDDR 231

Query: 198 TIRLWKEDADD-WECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWN 249
            ++LW+  A   WE      GH   V    F   ++   + S  +D TVRVW+
Sbjct: 232 QVKLWRMSATKAWEVDTC-RGHTNNVDSVIFHPQQN--LIISVGEDKTVRVWD 281

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 31/136 (22%), Positives = 61/136 (44%), Gaps = 8/136 (5%)

Query: 120 ELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVK 179
           ++L   E      K +++  S  ++       ++ +W+   +G     L   ++H   V+
Sbjct: 2   KMLTKFESKSTRAKGIAFHPSRPWVLVALFSSTIQLWDY-RMGV---LLHRFEDHEGPVR 57

Query: 180 HVVWHSEMHLLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASC 239
            + +H    L  S+  D TI++W  +++  +C   L+GH   V    F        + S 
Sbjct: 58  GIDFHPTQPLFVSAGDDYTIKVWSLESN--KCLFTLDGHLDYVRTVFFHHELP--WIISS 113

Query: 240 SDDSTVRVWNYVEEEE 255
           SDD T+R+WN+   +E
Sbjct: 114 SDDQTIRIWNWQNRKE 129

>YLR222C (UTP13) [3622] chr12 complement(579320..581773) Component
           of U3 snoRNP (also called small subunit processome),
           which is required for 18S rRNA biogenesis,
           overproduction causes chromosome instability and
           increased mitotic recombination, contains WD (WD-40)
           repeats [2454 bp, 817 aa]
          Length = 817

 Score = 68.9 bits (167), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 55/192 (28%), Positives = 85/192 (44%), Gaps = 25/192 (13%)

Query: 42  SKG---LMATSSSDRKIK----LVNLKNMDFQLVE--ELDDSTHKKSVRSVSFRPHSSIL 92
           SKG    + T+S+D  IK         +MD Q+++  E     H+K + ++S  P+ SI 
Sbjct: 447 SKGYPEFLLTASNDLTIKKWIIPKPTASMDVQIIKVSEYTRHAHEKDINALSVSPNDSIF 506

Query: 93  AAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLASCSRDKS 152
           A  S+D T  IW  E            EL A +  H+  +  VS+      LA+ S DK+
Sbjct: 507 ATASYDKTCKIWNLENG----------ELEATLANHKRGLWDVSFCQYDKLLATSSGDKT 556

Query: 153 VWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDADDWECA 212
           V IW  D     +  +  L+ H   V+   + ++   L S   D  I++W  D    EC 
Sbjct: 557 VKIWSLD----TFSVMKTLEGHTNAVQRCSFINKQKQLISCGADGLIKIW--DCSSGECL 610

Query: 213 AVLNGHKGTVWC 224
             L+GH   +W 
Sbjct: 611 KTLDGHNNRLWA 622

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 50/207 (24%), Positives = 92/207 (44%), Gaps = 26/207 (12%)

Query: 87  PHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLAS 146
           P  + LA  +   ++ I    + + P+   P    + I EGHE+ + ++  +  G ++A+
Sbjct: 348 PELNKLALATNSPSLRIIPVPDLSGPEASLPLD--VEIYEGHEDLLNSLDATEDGLWIAT 405

Query: 147 CSRDKSVWIWEADELGEEYECLSVLQEHAQDV-----KHVVWHSEMHLLASSSYDDTIRL 201
            S+D +  +W  +E   +++  +    H+  V      ++V       L ++S D TI+ 
Sbjct: 406 ASKDNTAIVWRYNENSCKFDIYAKYIGHSAAVTAVGLPNIVSKGYPEFLLTASNDLTIKK 465

Query: 202 W---KEDAD-DWECAAV----LNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNYVEE 253
           W   K  A  D +   V     + H+  +       ++S    A+ S D T ++WN    
Sbjct: 466 WIIPKPTASMDVQIIKVSEYTRHAHEKDINALSVSPNDSI--FATASYDKTCKIWNL--- 520

Query: 254 EENGEDVWAQEAILPNVHSRAVYSVSW 280
            ENGE     EA L N H R ++ VS+
Sbjct: 521 -ENGE----LEATLAN-HKRGLWDVSF 541

>Scas_652.16
          Length = 345

 Score = 67.8 bits (164), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 43/167 (25%), Positives = 82/167 (49%), Gaps = 13/167 (7%)

Query: 127 GHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSE 186
           GHE+ +  V +   G ++A+CS D+ + +++ D+   E+E     + H   +  V W S 
Sbjct: 10  GHEDLIHDVVYDFYGRHVATCSSDQHIKVFKLDKETSEWELSDSWKAHDSSIVSVDWASP 69

Query: 187 MH--LLASSSYDDTIRLWKEDADD-------WECAAVLNGHKGTVWCSDFEKSESSLRLA 237
            +  ++ S+SYD T++LW+ED D        W     LN  KG+++   F      L+LA
Sbjct: 70  EYGRIIVSASYDKTVKLWEEDPDQPEGSGRRWTKLCTLNDSKGSLYTVKFAPPHLGLKLA 129

Query: 238 SCSDDSTVRVWNYVEEEENGEDVWAQE----AILPNVHSRAVYSVSW 280
              +D+T+R++  +E  +        E     + P  H ++ + ++W
Sbjct: 130 CIGNDATLRIYEALEPSDLRSWTLTSEVKVLPVPPANHLQSDFCIAW 176

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 82/304 (26%), Positives = 130/304 (42%), Gaps = 64/304 (21%)

Query: 46  MATSSSDRKIKLVNLKNMDFQLVE-ELDDS--THKKSVRSVSF--RPHSSILAAGSFDST 100
           +AT SSD+ IK+  L   D +  E EL DS   H  S+ SV +    +  I+ + S+D T
Sbjct: 27  VATCSSDQHIKVFKL---DKETSEWELSDSWKAHDSSIVSVDWASPEYGRIIVSASYDKT 83

Query: 101 ISIWGKEEDAD-PQDDFPETELLAIIEGHENEVKAVSWS--HSGYYLASCSRDKSVWIWE 157
           + +W  EED D P+        L  +   +  +  V ++  H G  LA    D ++ I+E
Sbjct: 84  VKLW--EEDPDQPEGSGRRWTKLCTLNDSKGSLYTVKFAPPHLGLKLACIGNDATLRIYE 141

Query: 158 ADE--------LGEEYECLSVLQ-EHAQDVKHVVW----HSEMHLLASSSYDDTIRLWKE 204
           A E        L  E + L V    H Q    + W     S   L+ S+    +I    +
Sbjct: 142 ALEPSDLRSWTLTSEVKVLPVPPANHLQSDFCIAWCPSRFSPEKLVVSTLDQASIYQRGK 201

Query: 205 DADDWECAAVLNGHKGTVWCSDFEKSESSLR----LASCSDDSTVRVWNYVE-------- 252
           D   +   A LNGHKG +   D   + S  R    +A+   D  +R++  VE        
Sbjct: 202 DGKLY-IVAKLNGHKGLI--RDISWAPSIGRWYHLIATGCKDGKLRIFRLVEKLSDNSSK 258

Query: 253 ---------EEENGEDVW--AQEAILPNV-----------HSRAVYSVSWSLDGYI-ASV 289
                    E+ + ED+    ++++L +            H+  ++SVSW+L G I +S 
Sbjct: 259 DAINDSYDDEDVDMEDIAENKEKSLLGSSVSVELLSEHDDHNAEIWSVSWNLTGTILSSA 318

Query: 290 GSDG 293
           G DG
Sbjct: 319 GDDG 322

 Score = 37.4 bits (85), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 65/142 (45%), Gaps = 40/142 (28%)

Query: 45  LMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSVSFRPHSSILAAGSFDSTISIW 104
           L+AT   D K+++       F+LVE+L D++ K ++               S+D      
Sbjct: 233 LIATGCKDGKLRI-------FRLVEKLSDNSSKDAIND-------------SYD------ 266

Query: 105 GKEEDADPQD-----------DFPETELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSV 153
             +ED D +D                ELL+  + H  E+ +VSW+ +G  L+S   D  V
Sbjct: 267 --DEDVDMEDIAENKEKSLLGSSVSVELLSEHDDHNAEIWSVSWNLTGTILSSAGDDGKV 324

Query: 154 WIWEADELGEEYECLSVLQEHA 175
            +W++     E++C+SV+  ++
Sbjct: 325 RLWKS-TYSNEFKCMSVITSNS 345

>YDL145C (COP1) [723] chr4 complement(194572..198177) Coatomer
           (COPI) complex alpha chain (alpha-COP) of secretory
           pathway vesicles required for retrograde Golgi to
           endoplasmic reticulum transport, member of WD (WD-40)
           repeat family [3606 bp, 1201 aa]
          Length = 1201

 Score = 68.6 bits (166), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 49/175 (28%), Positives = 79/175 (45%), Gaps = 22/175 (12%)

Query: 78  KSVRS--VSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAV 135
           KS R+  ++F P    +    F STI +W          D+    LL   E HE  V+ +
Sbjct: 10  KSTRAKGIAFHPSRPWVLVALFSSTIQLW----------DYRMGTLLHRFEDHEGPVRGL 59

Query: 136 SWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSY 195
            +  +     S   D ++ +W  D      +CL  L  H   V+ V +H E+  + S+S 
Sbjct: 60  DFHPTQPIFVSAGDDYTIKVWSLDT----NKCLYTLTGHLDYVRTVFFHRELPWIISASD 115

Query: 196 DDTIRLWK-EDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWN 249
           D TIR+W  ++  +  C   L GH   V C+ F  ++    + S S D T+R+W+
Sbjct: 116 DQTIRIWNWQNRKEIAC---LTGHNHFVMCAQFHPTDD--LIVSASLDETIRIWD 165

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 56/127 (44%), Gaps = 14/127 (11%)

Query: 76  HKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAV 135
           H+  VR + F P   I  +   D TI +W  + +          + L  + GH + V+ V
Sbjct: 52  HEGPVRGLDFHPTQPIFVSAGDDYTIKVWSLDTN----------KCLYTLTGHLDYVRTV 101

Query: 136 SWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSY 195
            +     ++ S S D+++ IW      E    ++ L  H   V    +H    L+ S+S 
Sbjct: 102 FFHRELPWIISASDDQTIRIWNWQNRKE----IACLTGHNHFVMCAQFHPTDDLIVSASL 157

Query: 196 DDTIRLW 202
           D+TIR+W
Sbjct: 158 DETIRIW 164

 Score = 42.4 bits (98), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 50/213 (23%), Positives = 79/213 (37%), Gaps = 43/213 (20%)

Query: 32  HTDKLWSIDCSKGLMATSSSDRKIKLVNLKNMDFQLVEELDDST---------------- 75
           +T K+WS+D +K L   +     ++ V        ++   DD T                
Sbjct: 75  YTIKVWSLDTNKCLYTLTGHLDYVRTVFFHRELPWIISASDDQTIRIWNWQNRKEIACLT 134

Query: 76  -HKKSVRSVSFRPHSSILAAGSFDSTISIW---------------GKEEDADPQDDFPET 119
            H   V    F P   ++ + S D TI IW                 EE    Q +  + 
Sbjct: 135 GHNHFVMCAQFHPTDDLIVSASLDETIRIWDISGLRKRHSAPGTSSFEEQMSAQQNLLDG 194

Query: 120 EL-----LAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWE--ADELGEEYECLSVLQ 172
            L       I+EGH   V   S+  +   + S S D+ V +W   A +  E   C    +
Sbjct: 195 SLGDCVVKFILEGHTRGVNWASFHPTLPLIVSGSDDRQVKLWRMSATKAWEVDTC----R 250

Query: 173 EHAQDVKHVVWHSEMHLLASSSYDDTIRLWKED 205
            H  +V  V++H   +L+ S   D T+R+W  D
Sbjct: 251 GHTNNVDSVIFHPHQNLIISVGEDKTLRVWDLD 283

 Score = 41.6 bits (96), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 31/136 (22%), Positives = 60/136 (44%), Gaps = 8/136 (5%)

Query: 120 ELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVK 179
           ++L   E      K +++  S  ++       ++ +W+   +G     L   ++H   V+
Sbjct: 2   KMLTKFESKSTRAKGIAFHPSRPWVLVALFSSTIQLWDY-RMGT---LLHRFEDHEGPVR 57

Query: 180 HVVWHSEMHLLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASC 239
            + +H    +  S+  D TI++W  D +  +C   L GH   V    F +      + S 
Sbjct: 58  GLDFHPTQPIFVSAGDDYTIKVWSLDTN--KCLYTLTGHLDYVRTVFFHRELP--WIISA 113

Query: 240 SDDSTVRVWNYVEEEE 255
           SDD T+R+WN+   +E
Sbjct: 114 SDDQTIRIWNWQNRKE 129

 Score = 29.6 bits (65), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 37/172 (21%), Positives = 71/172 (41%), Gaps = 26/172 (15%)

Query: 76  HKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAV 135
           H + V   SF P   ++ +GS D  + +W        + D           GH N V +V
Sbjct: 208 HTRGVNWASFHPTLPLIVSGSDDRQVKLWRMSATKAWEVD--------TCRGHTNNVDSV 259

Query: 136 SWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKH--VVWHSEMHLLASS 193
            +      + S   DK++ +W+ D+         V Q   ++ +   +  H  ++L   +
Sbjct: 260 IFHPHQNLIISVGEDKTLRVWDLDKR------TPVKQFKRENDRFWLIAAHPHINLFG-A 312

Query: 194 SYDDTIRLWKEDADDWECAAV-------LNGHKGTVWCSDFEKSESSLRLAS 238
           ++D  I ++K D +   C+ +       +N  K  +   +F+K  +SL  AS
Sbjct: 313 AHDSGIMVFKLDRER-PCSFIHQNQLFFVNAEK-QIQSFNFQKRVASLPYAS 362

>AEL246C [2260] [Homologous to ScYBR198C (TAF90) - SH]
           (172849..175296) [2448 bp, 815 aa]
          Length = 815

 Score = 68.6 bits (166), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 72/269 (26%), Positives = 111/269 (41%), Gaps = 27/269 (10%)

Query: 83  VSFRPHSSILAAGSFDSTISIWGKE----EDADPQDDFPETELLAIIEGHENEVKAVSWS 138
           + F   S ++AAG  DS I +W  +    E   P      +  + +I GH   V +VS+S
Sbjct: 493 LRFSDDSRLVAAGFQDSYIKLWSLDGTPLESQLPSKAKDASNTVTLI-GHSGPVYSVSFS 551

Query: 139 HSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDT 198
               YL S S DK+V +W  D     Y CL   + H   V  V +    H  A+ S+D T
Sbjct: 552 PDNRYLVSASEDKTVRLWSLD----TYTCLVSYKGHNHPVWDVKFSPLGHYFATGSHDQT 607

Query: 199 IRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNYVEEEENGE 258
            RLW    D      +  GH   V C  F  + +   + + S D T R+W+     + G+
Sbjct: 608 ARLW--SCDHIYPLRIFAGHLNDVDCVTFHPNGT--YVLTGSSDKTCRMWDI----QTGD 659

Query: 259 DVWAQEAILPNVHSRAVYSVSWSLDGYIASVGSDGLLXXXXXXXXXXXXXXXQQHEAHGI 318
            V      L   H+ +V SV+ S DG   + GS+  +               + H    +
Sbjct: 660 SVR-----LFLGHTASVVSVAVSPDGRWLTTGSEDGVIIVWDIGTGKRIKQMRGHGKSAV 714

Query: 319 YEINVVKWATVDDSVLLLTGGDDGCANIW 347
           Y ++  K   +     L++GG D    +W
Sbjct: 715 YSLSFNKEGNI-----LVSGGADQSVRVW 738

 Score = 33.1 bits (74), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 42/169 (24%), Positives = 73/169 (43%), Gaps = 25/169 (14%)

Query: 4   IKHNLYTFSHKHTRLQRM-SLELLKSLKLHTDKLWSIDC-----SKGLMATSSSDRKIKL 57
           + H   T SH  T   R+ S + +  L++    L  +DC     +   + T SSD+  ++
Sbjct: 595 LGHYFATGSHDQT--ARLWSCDHIYPLRIFAGHLNDVDCVTFHPNGTYVLTGSSDKTCRM 652

Query: 58  VNLKNMD-FQLVEELDDSTHKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDF 116
            +++  D  +L        H  SV SV+  P    L  GS D  I +W          D 
Sbjct: 653 WDIQTGDSVRLF-----LGHTASVVSVAVSPDGRWLTTGSEDGVIIVW----------DI 697

Query: 117 PETELLAIIEGH-ENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEE 164
              + +  + GH ++ V ++S++  G  L S   D+SV +W+  +   E
Sbjct: 698 GTGKRIKQMRGHGKSAVYSLSFNKEGNILVSGGADQSVRVWDLKKFTNE 746

>Scas_624.11
          Length = 1205

 Score = 68.6 bits (166), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 50/175 (28%), Positives = 80/175 (45%), Gaps = 22/175 (12%)

Query: 78  KSVRS--VSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAV 135
           KS R+  ++F P    +    F STI +W          D+    LL   E HE  V++V
Sbjct: 10  KSTRAKGIAFHPSRPWVLVALFSSTIQLW----------DYRMGTLLHRFEDHEGPVRSV 59

Query: 136 SWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSY 195
            +  +     S   D ++ +W      E  +CL  L  H   ++ V +H E+  + S+S 
Sbjct: 60  DFHPTQPIFVSGGDDYTIKVWSL----ETNKCLYTLNGHLDYIRTVFFHKELPWIISASD 115

Query: 196 DDTIRLWK-EDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWN 249
           D TIR+W  ++  +  C   L GH   V C+ F  ++    + S S D T+RVW+
Sbjct: 116 DQTIRIWNWQNRKEIAC---LTGHNHFVMCAQFHPTDD--LVVSASLDETIRVWD 165

 Score = 54.7 bits (130), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 55/204 (26%), Positives = 83/204 (40%), Gaps = 46/204 (22%)

Query: 76  HKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAV 135
           H+  VRSV F P   I  +G  D TI +W  E +          + L  + GH + ++ V
Sbjct: 52  HEGPVRSVDFHPTQPIFVSGGDDYTIKVWSLETN----------KCLYTLNGHLDYIRTV 101

Query: 136 SWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSY 195
            +     ++ S S D+++ IW      E    ++ L  H   V    +H    L+ S+S 
Sbjct: 102 FFHKELPWIISASDDQTIRIWNWQNRKE----IACLTGHNHFVMCAQFHPTDDLVVSASL 157

Query: 196 DDTIRLW-------KEDA------DDWECAA---------------VLNGH-KGTVWCSD 226
           D+TIR+W       K  A      DD   A                +L GH +G  W S 
Sbjct: 158 DETIRVWDISGLRKKHSAPGTSTFDDQMAAQQNLLDGGFGDCVVKFILEGHTRGVNWAS- 216

Query: 227 FEKSESSLRLASCSDDSTVRVWNY 250
           F  +     + S SDD  V++W Y
Sbjct: 217 FHPTLP--MIVSGSDDRQVKLWKY 238

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/136 (23%), Positives = 60/136 (44%), Gaps = 8/136 (5%)

Query: 120 ELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVK 179
           ++L   E      K +++  S  ++       ++ +W+   +G     L   ++H   V+
Sbjct: 2   KMLTKFESKSTRAKGIAFHPSRPWVLVALFSSTIQLWDY-RMGT---LLHRFEDHEGPVR 57

Query: 180 HVVWHSEMHLLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASC 239
            V +H    +  S   D TI++W  + +  +C   LNGH   +    F K      + S 
Sbjct: 58  SVDFHPTQPIFVSGGDDYTIKVWSLETN--KCLYTLNGHLDYIRTVFFHKELP--WIISA 113

Query: 240 SDDSTVRVWNYVEEEE 255
           SDD T+R+WN+   +E
Sbjct: 114 SDDQTIRIWNWQNRKE 129

 Score = 37.0 bits (84), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 37/170 (21%), Positives = 71/170 (41%), Gaps = 22/170 (12%)

Query: 76  HKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAV 135
           H + V   SF P   ++ +GS D  + +W        + D           GH N V  V
Sbjct: 208 HTRGVNWASFHPTLPMIVSGSDDRQVKLWKYNSTKAWEVD--------TCRGHTNNVDCV 259

Query: 136 SWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKH--VVWHSEMHLLASS 193
            +  +  ++ S   DK++ IW+ D+       + V Q   ++ +   +  H  ++L   +
Sbjct: 260 IFHPTQKFILSVGEDKTLRIWDLDKR------IPVKQFKRENDRFWLIASHPNINLFG-A 312

Query: 194 SYDDTIRLWKEDADD-----WECAAVLNGHKGTVWCSDFEKSESSLRLAS 238
           ++D  I ++K D +      ++   +    +  V   DF+K  +SL  AS
Sbjct: 313 AHDAGIMVFKLDRERPCNVIYQNQLIFVNKEKHVQMFDFQKKVASLPFAS 362

>KLLA0D16390g 1378884..1381694 similar to sp|Q12220 Saccharomyces
           cerevisiae YLR129w DIP2 DOM34P-interacting protein,
           start by similarity
          Length = 936

 Score = 68.2 bits (165), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 60/249 (24%), Positives = 103/249 (41%), Gaps = 42/249 (16%)

Query: 25  LLKSLKLHTDKLWSIDCSKG--LMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKK---- 78
           LL + + HT  +WS+D +     + T S+D+  K       DF++VE+L   T  K    
Sbjct: 456 LLSTTEAHTAAIWSLDLTSNGKRLVTGSADKSCKF-----WDFEVVEQLVPGTKDKYIPQ 510

Query: 79  -------------SVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAII 125
                         + +V        LA    D+T+ ++           F   +    +
Sbjct: 511 LKLVHDTTLELTDDILAVKISSEDRYLAVSLLDNTVKVFF----------FDSLKFYLSL 560

Query: 126 EGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHS 185
            GH+  V ++ +S     L + S DK++ IW  D  G+   C   +  H   +  V + +
Sbjct: 561 YGHKLPVLSIDFSVDSKMLITSSADKNIKIWGVD-FGD---CHKSIFAHQDSIMSVRFEA 616

Query: 186 EMHLLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTV 245
           + H   S   D  ++ W  D D ++C   LNGH+  VWC     S     + S S D ++
Sbjct: 617 DTHNFFSCGKDGAVKRW--DGDKFDCIQKLNGHQSEVWC--IAVSPDGRTVVSTSHDHSI 672

Query: 246 RVWNYVEEE 254
           RVW   +++
Sbjct: 673 RVWQETDDQ 681

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 71/181 (39%), Gaps = 19/181 (10%)

Query: 80  VRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSH 139
           V ++ F   + +L  G  D  I +W          D     +L    GH++ V  +    
Sbjct: 76  VTAMCFHKETELLCVGYEDGVIKVW----------DLLSKSVLMQFNGHKSGVTVLRLDS 125

Query: 140 SGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTI 199
            G  L S S+D  + IW  D +GE    L  L+ H   +  +     M  L S + D  I
Sbjct: 126 EGTRLVSGSKDSDLIIW--DLVGE--VGLMKLRSHKDAITGIWIDHNMDWLISVAKDGLI 181

Query: 200 RLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNYVEEEENGED 259
           ++W   A   +C      H G  W    ++      + + S DS  ++W    E+ NGE 
Sbjct: 182 KVWDLKAGG-QCVETHMAHTGQCWSMAIDEE----VIITTSMDSQAKIWELDLEKSNGEK 236

Query: 260 V 260
           +
Sbjct: 237 I 237

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 67/281 (23%), Positives = 122/281 (43%), Gaps = 47/281 (16%)

Query: 29  LKLHTDKLWSIDCSK-GLMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSVS--F 85
           L+ H   + S+D S  G + +++S+ ++K+ NL              T KK +R+ S  +
Sbjct: 379 LQGHRTDIRSMDISDDGKLLSTASNGELKVWNL--------------TTKKCIRTFSCGY 424

Query: 86  RPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLA 145
              S +L  G     + + G  +      D   + LL+  E H   + ++  + +G  L 
Sbjct: 425 ALCSQMLPGG----LLVVVGTRQGELQLFDLASSTLLSTTEAHTAAIWSLDLTSNGKRLV 480

Query: 146 SCSRDKSVWIWEADEL-----GEEYECLSVLQ-------EHAQDVKHVVWHSEMHLLASS 193
           + S DKS   W+ + +     G + + +  L+       E   D+  V   SE   LA S
Sbjct: 481 TGSADKSCKFWDFEVVEQLVPGTKDKYIPQLKLVHDTTLELTDDILAVKISSEDRYLAVS 540

Query: 194 SYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNYVEE 253
             D+T++++  D+  +  +  L GHK  V   DF  S  S  L + S D  +++W  V+ 
Sbjct: 541 LLDNTVKVFFFDSLKFYLS--LYGHKLPVLSIDF--SVDSKMLITSSADKNIKIWG-VDF 595

Query: 254 EENGEDVWAQEAILPNVHSRAVYSVSWSLDGY-IASVGSDG 293
            +  + ++A        H  ++ SV +  D +   S G DG
Sbjct: 596 GDCHKSIFA--------HQDSIMSVRFEADTHNFFSCGKDG 628

>CAGL0C00737g complement(75028..77478) similar to tr|Q05946
           Saccharomyces cerevisiae YLR222c, hypothetical start
          Length = 816

 Score = 68.2 bits (165), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 48/180 (26%), Positives = 79/180 (43%), Gaps = 18/180 (10%)

Query: 76  HKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAV 135
           H+K + ++S  P+ SI A  S+D T  +W  +            E +A +  H+  +  V
Sbjct: 494 HEKDINAISMAPNDSIFATASYDKTCKLWNVDTG----------EPVATLANHKRGLWDV 543

Query: 136 SWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSY 195
           S+  S  ++A+CS DK+V IW      E +  L  L+ H   V+   + ++   L S+  
Sbjct: 544 SFCESEKWIATCSGDKTVKIWSL----ESFTVLKTLEGHTNAVQRCSFMNKQKQLVSAGA 599

Query: 196 DDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNYVEEEE 255
           D  I++W  D    +C   L+GH   +W       E    + S   DS  + W    E E
Sbjct: 600 DGLIKVW--DIASGDCIKNLDGHSNRIWA--LSVLEDGDLIISADADSVFQFWKDCTEAE 655

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 56/233 (24%), Positives = 96/233 (41%), Gaps = 32/233 (13%)

Query: 45  LMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSVSFRPHSSILAAGSFDSTISIW 104
           + AT+S D+  KL N+     + V  L  + HK+ +  VSF      +A  S D T+ IW
Sbjct: 509 IFATASYDKTCKLWNVDTG--EPVATL--ANHKRGLWDVSFCESEKWIATCSGDKTVKIW 564

Query: 105 GKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEE 164
             E             +L  +EGH N V+  S+ +    L S   D  + +W+       
Sbjct: 565 SLE----------SFTVLKTLEGHTNAVQRCSFMNKQKQLVSAGADGLIKVWDI----AS 610

Query: 165 YECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDADDWECAAVLNGHKGTV-- 222
            +C+  L  H+  +  +    +  L+ S+  D   + WK D  + E    L  +K  V  
Sbjct: 611 GDCIKNLDGHSNRIWALSVLEDGDLIISADADSVFQFWK-DCTEAEIQGALEENKVRVEQ 669

Query: 223 ---WCSDFEKSE-SSLRLASCSDDSTVRVWNYVE-------EEENGEDVWAQE 264
                +     E S+  L +   D  +R++N +        E+ NG+ ++ QE
Sbjct: 670 EQSLTNYMNNGEWSNAFLLALQLDHPMRLFNVLRSSMGSQPEQANGKVIFNQE 722

 Score = 41.6 bits (96), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 48/187 (25%), Positives = 85/187 (45%), Gaps = 27/187 (14%)

Query: 109 DADPQD-DFP-ETELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYE 166
           DAD QD D P E  L    EGH + + +++ +  G +LA+ S+DK+  +W  +   + + 
Sbjct: 371 DADTQDTDLPIEVNLY---EGHSDLLNSLACTEDGQWLATASKDKTAILWHWNNTSKRFY 427

Query: 167 CLSVLQEHAQDVKHVVWHSEMH-----LLASSSYDDTIRLWKEDADDWECAAVLNGHKGT 221
             +    HA  V  V   + M       + ++S D T++ W+      +   V    K +
Sbjct: 428 IYATFVGHAASVSAVCLPNVMEKNYPKYIITASNDLTVKKWEIPPMKNDLNEVPFIVKSS 487

Query: 222 VWCS-DFEKSESSLRL-------ASCSDDSTVRVWNYVEEEENGEDVWAQEAILPNVHSR 273
           ++     EK  +++ +       A+ S D T ++WN     + GE V    A L N H R
Sbjct: 488 IYTRHAHEKDINAISMAPNDSIFATASYDKTCKLWNV----DTGEPV----ATLAN-HKR 538

Query: 274 AVYSVSW 280
            ++ VS+
Sbjct: 539 GLWDVSF 545

>YGL100W (SEH1) [1883] chr7 (313235..314284) Protein found in
           complex with nuclear pore proteins, member of WD (WD-40)
           repeat family [1050 bp, 349 aa]
          Length = 349

 Score = 67.0 bits (162), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 85/167 (50%), Gaps = 13/167 (7%)

Query: 127 GHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSE 186
           GH++ V  V +   G ++A+CS D+ + +++ D+    +E     + H   +  + W S 
Sbjct: 7   GHDDLVHDVVYDFYGRHVATCSSDQHIKVFKLDKDTSNWELSDSWRAHDSSIVAIDWASP 66

Query: 187 MH--LLASSSYDDTIRLWKEDADDWECAA-------VLNGHKGTVWCSDFEKSESSLRLA 237
            +  ++AS+SYD T++LW+ED D  EC+         LN  KG+++   F  +   L+LA
Sbjct: 67  EYGRIIASASYDKTVKLWEEDPDQEECSGRRWNKLCTLNDSKGSLYSVKFAPAHLGLKLA 126

Query: 238 SCSDDSTVRVWNYVEEEENGEDVWAQE----AILPNVHSRAVYSVSW 280
              +D  +R+++ +E  +        E    +I P  H ++ + +SW
Sbjct: 127 CLGNDGILRLYDALEPSDLRSWTLTSEMKVLSIPPANHLQSDFCLSW 173

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 68/130 (52%), Gaps = 17/130 (13%)

Query: 45  LMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSVSFRPHSSIL---AAGSFDSTI 101
           L+AT   D +I++       F++ E+L     ++S+ + +   +S+ +   A G  DS  
Sbjct: 230 LIATGCKDGRIRI-------FKITEKLSPLASEESLTNSNMFDNSADVDMDAQGRSDSNT 282

Query: 102 SIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADEL 161
                EE A+ Q +  + ELL+  + H  EV +VSW+ +G  L+S   D  V +W+A   
Sbjct: 283 -----EEKAELQSNL-QVELLSEHDDHNGEVWSVSWNLTGTILSSAGDDGKVRLWKA-TY 335

Query: 162 GEEYECLSVL 171
             E++C+SV+
Sbjct: 336 SNEFKCMSVI 345

 Score = 29.6 bits (65), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 36/151 (23%), Positives = 63/151 (41%), Gaps = 19/151 (12%)

Query: 76  HKKSVRSVSFRPH----SSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENE 131
           HK  +RS+S+ P       ++A G  D  I I            F  TE L+ +   E+ 
Sbjct: 211 HKSLIRSISWAPSIGRWYQLIATGCKDGRIRI------------FKITEKLSPLASEESL 258

Query: 132 VKAVSWSHSGYYLASCSRDKSVWIWEADELGE--EYECLSVLQEHAQDVKHVVWHSEMHL 189
             +  + +S                E  EL    + E LS   +H  +V  V W+    +
Sbjct: 259 TNSNMFDNSADVDMDAQGRSDSNTEEKAELQSNLQVELLSEHDDHNGEVWSVSWNLTGTI 318

Query: 190 LASSSYDDTIRLWKED-ADDWECAAVLNGHK 219
           L+S+  D  +RLWK   +++++C +V+   +
Sbjct: 319 LSSAGDDGKVRLWKATYSNEFKCMSVITAQQ 349

>YCR072C (YCR072C) [597] chr3 complement(240800..242347) Protein of
           unknown function, member of WD (WD-40) repeat family
           [1548 bp, 515 aa]
          Length = 515

 Score = 67.8 bits (164), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 74/255 (29%), Positives = 120/255 (47%), Gaps = 40/255 (15%)

Query: 9   YTFSHKHTRLQRMSLELLKSLKLHTDKLWSIDCSKGLMATSSSDRKIKLVNLKNMDFQLV 68
           YTFS   T   + + + +K++ + TD L+S     G    +S++ +I L+      F++ 
Sbjct: 77  YTFSC--TIQGKKASDPVKTIDI-TDNLYSSLIKPGY---NSTEDQITLLYTPRAVFKVK 130

Query: 69  EELDDST----HKKSVRSVSFRPH-SSILAAGSFDSTISIWGKEEDADPQDDFPETELLA 123
                S+    H  ++   +F PH SS +  G+ D+T  IW    D D Q        + 
Sbjct: 131 PVTRSSSAIAGHGSTILCSAFAPHTSSRMVTGAGDNTARIW----DCDTQTP------MH 180

Query: 124 IIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLS-VLQEHAQDVKHVV 182
            ++GH N V  VSWS  G  +A+ S D ++ +W+     +  +CL   L+ H++ +  + 
Sbjct: 181 TLKGHYNWVLCVSWSPDGEVIATGSMDNTIRLWDP----KSGQCLGDALRGHSKWITSLS 236

Query: 183 WHSEMHL--------LASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSL 234
           W   +HL        LASSS D TI++W  D     C   ++GH  +V C  +       
Sbjct: 237 WE-PIHLVKPGSKPRLASSSKDGTIKIW--DTVSRVCQYTMSGHTNSVSCVKWGGQG--- 290

Query: 235 RLASCSDDSTVRVWN 249
            L S S D TVRVW+
Sbjct: 291 LLYSGSHDRTVRVWD 305

 Score = 66.2 bits (160), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 46/160 (28%), Positives = 75/160 (46%), Gaps = 17/160 (10%)

Query: 91  ILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLASCSRD 150
           ++   S D T+ +W   +   P         +A + GH+  V  V++S  G Y+ S S D
Sbjct: 373 MMVTASDDYTMFLWNPLKSTKP---------IARMTGHQKLVNHVAFSPDGRYIVSASFD 423

Query: 151 KSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDADDWE 210
            S+ +W+    G + + +S  + H   V  V W S+  LL S S D T+++W  D    +
Sbjct: 424 NSIKLWD----GRDGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVW--DVRTRK 477

Query: 211 CAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNY 250
            +  L GHK  V+  D+  S    R+ S   D  VR+W +
Sbjct: 478 LSVDLPGHKDEVYTVDW--SVDGKRVCSGGKDKMVRLWTH 515

 Score = 58.5 bits (140), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 70/267 (26%), Positives = 120/267 (44%), Gaps = 45/267 (16%)

Query: 38  SIDCSK----GLMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSVSFRPHSSILA 93
           S+ C K    GL+ + S DR +++ ++ N   + +  L    H  +  S+S       L 
Sbjct: 280 SVSCVKWGGQGLLYSGSHDRTVRVWDI-NSQGRCINILKSHAHWVNHLSLST---DYALR 335

Query: 94  AGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSV 153
            G+FD T    GK+         PE      +E +E   K     +S   + + S D ++
Sbjct: 336 IGAFDHT----GKKPST------PEEAQKKALENYEKICKKNG--NSEEMMVTASDDYTM 383

Query: 154 WIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDADDWECAA 213
           ++W   +     + ++ +  H + V HV +  +   + S+S+D++I+LW  D  D +  +
Sbjct: 384 FLWNPLK---STKPIARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLW--DGRDGKFIS 438

Query: 214 VLNGHKGTV----WCSDFEKSESSLRLASCSDDSTVRVWNYVEEEENGEDVWAQEAILPN 269
              GH  +V    W SD         L SCS D+T++VW+ V   +   D       LP 
Sbjct: 439 TFRGHVASVYQVAWSSDCR------LLVSCSKDTTLKVWD-VRTRKLSVD-------LPG 484

Query: 270 VHSRAVYSVSWSLDG-YIASVGSDGLL 295
            H   VY+V WS+DG  + S G D ++
Sbjct: 485 -HKDEVYTVDWSVDGKRVCSGGKDKMV 510

 Score = 56.2 bits (134), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 44/162 (27%), Positives = 71/162 (43%), Gaps = 19/162 (11%)

Query: 42  SKGLMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSVSFRPHSSILAAGSFDSTI 101
           S+ +M T+S D  + L N       +      + H+K V  V+F P    + + SFD++I
Sbjct: 370 SEEMMVTASDDYTMFLWNPLKSTKPIARM---TGHQKLVNHVAFSPDGRYIVSASFDNSI 426

Query: 102 SIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADEL 161
            +W          D  + + ++   GH   V  V+WS     L SCS+D ++ +W+    
Sbjct: 427 KLW----------DGRDGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDV--- 473

Query: 162 GEEYECLSV-LQEHAQDVKHVVWHSEMHLLASSSYDDTIRLW 202
                 LSV L  H  +V  V W  +   + S   D  +RLW
Sbjct: 474 --RTRKLSVDLPGHKDEVYTVDWSVDGKRVCSGGKDKMVRLW 513

 Score = 50.8 bits (120), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 66/146 (45%), Gaps = 17/146 (11%)

Query: 117 PETELLAIIEGHENEVKAVSWS-HSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHA 175
           P T   + I GH + +   +++ H+   + + + D +  IW+ D        +  L+ H 
Sbjct: 131 PVTRSSSAIAGHGSTILCSAFAPHTSSRMVTGAGDNTARIWDCDT----QTPMHTLKGHY 186

Query: 176 QDVKHVVWHSEMHLLASSSYDDTIRLWKEDADDWECAA-VLNGHKGTVWCSDFE------ 228
             V  V W  +  ++A+ S D+TIRLW  D    +C    L GH  + W +         
Sbjct: 187 NWVLCVSWSPDGEVIATGSMDNTIRLW--DPKSGQCLGDALRGH--SKWITSLSWEPIHL 242

Query: 229 -KSESSLRLASCSDDSTVRVWNYVEE 253
            K  S  RLAS S D T+++W+ V  
Sbjct: 243 VKPGSKPRLASSSKDGTIKIWDTVSR 268

>CAGL0J03476g 331933..333486 highly similar to sp|P25382
           Saccharomyces cerevisiae YCR072c, start by similarity
          Length = 517

 Score = 67.0 bits (162), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 63/195 (32%), Positives = 92/195 (47%), Gaps = 37/195 (18%)

Query: 76  HKKSVRSVSFRPH-SSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKA 134
           H  ++   +F PH SS +  G  D+T  IW    D D Q   P+  L     GH N V  
Sbjct: 144 HGATILCSAFAPHTSSRVVTGGGDNTARIW----DCDTQT--PKVTL----NGHRNWVLC 193

Query: 135 VSWSHSGYYLASCSRDKSVWIWEAD---ELGEEYECLSVLQEHAQDVKHVVWHSEMHL-- 189
           VSWS  G  +A+ S D ++ +W+A+    LG+       L+ H++ +  + W   +HL  
Sbjct: 194 VSWSADGEVIATGSMDNTIRLWDAESGKPLGD------ALRGHSKWITSLTWE-PIHLVE 246

Query: 190 ------LASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDS 243
                 LAS+S D TIR+W  D+    C   L GH  +V C  +        L S S D 
Sbjct: 247 PGSKPRLASASKDGTIRIW--DSSRRVCLMTLGGHTNSVSCVKWGGEGI---LYSGSHDK 301

Query: 244 TVRVWNYVEEEENGE 258
           TVR W+    ++NG+
Sbjct: 302 TVRAWDM---KQNGK 313

 Score = 66.6 bits (161), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 46/163 (28%), Positives = 76/163 (46%), Gaps = 17/163 (10%)

Query: 88  HSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLASC 147
           H  ++   S D T+ +W   +   P         ++ + GH+  V  V++S  G Y+ S 
Sbjct: 372 HEELMVTASDDFTMFLWNPLKGTKP---------ISRMTGHQKLVNHVAFSPDGKYIVSA 422

Query: 148 SRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDAD 207
           S D S+ +W+    G+E   LS  + H   V  V W S+  LL S S D T+++W  D  
Sbjct: 423 SFDNSIKLWD----GKEGTFLSTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVW--DVK 476

Query: 208 DWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNY 250
             + +  L GH+  V+  D+  S    R+ S   D  +R+W +
Sbjct: 477 TRKLSVDLPGHQDEVYTVDW--SVDGKRVCSGGKDKMMRLWTH 517

 Score = 58.9 bits (141), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 47/160 (29%), Positives = 71/160 (44%), Gaps = 21/160 (13%)

Query: 45  LMATSSSDRKIKLVNLKNMDFQLVEELDDST-HKKSVRSVSFRPHSSILAAGSFDSTISI 103
           LM T+S D  + L N      +  + +   T H+K V  V+F P    + + SFD++I +
Sbjct: 375 LMVTASDDFTMFLWN----PLKGTKPISRMTGHQKLVNHVAFSPDGKYIVSASFDNSIKL 430

Query: 104 WGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGE 163
           W          D  E   L+   GH   V  V+WS     L SCS+D ++ +W+      
Sbjct: 431 W----------DGKEGTFLSTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDV----- 475

Query: 164 EYECLSV-LQEHAQDVKHVVWHSEMHLLASSSYDDTIRLW 202
           +   LSV L  H  +V  V W  +   + S   D  +RLW
Sbjct: 476 KTRKLSVDLPGHQDEVYTVDWSVDGKRVCSGGKDKMMRLW 515

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 77/157 (49%), Gaps = 25/157 (15%)

Query: 144 LASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWK 203
           + + S D ++++W   +     + +S +  H + V HV +  +   + S+S+D++I+LW 
Sbjct: 376 MVTASDDFTMFLWNPLK---GTKPISRMTGHQKLVNHVAFSPDGKYIVSASFDNSIKLW- 431

Query: 204 EDADDWECAAVLNGHKGTV----WCSDFEKSESSLRLASCSDDSTVRVWNYVEEEENGED 259
            D  +    +   GH  +V    W SD         L SCS D+T++VW+ V+  +   D
Sbjct: 432 -DGKEGTFLSTFRGHVASVYQVAWSSDCR------LLVSCSKDTTLKVWD-VKTRKLSVD 483

Query: 260 VWAQEAILPNVHSRAVYSVSWSLDG-YIASVGSDGLL 295
                  LP  H   VY+V WS+DG  + S G D ++
Sbjct: 484 -------LPG-HQDEVYTVDWSVDGKRVCSGGKDKMM 512

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 38/80 (47%), Gaps = 10/80 (12%)

Query: 212 AAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNYVEEEENGEDVWAQEAILPNVH 271
           ++ + GH  T+ CS F    SS R+ +   D+T R+W+         D    +  L N H
Sbjct: 138 SSAIAGHGATILCSAFAPHTSS-RVVTGGGDNTARIWDC--------DTQTPKVTL-NGH 187

Query: 272 SRAVYSVSWSLDGYIASVGS 291
              V  VSWS DG + + GS
Sbjct: 188 RNWVLCVSWSADGEVIATGS 207

>AGL196C [4116] [Homologous to ScYLR129W (DIP2) - SH]
           (328838..331645) [2808 bp, 935 aa]
          Length = 935

 Score = 67.4 bits (163), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 61/242 (25%), Positives = 100/242 (41%), Gaps = 42/242 (17%)

Query: 32  HTDKLWSIDCSK--GLMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRS------- 82
           HT  +WS+D +     + T+S+D+ +K       DF++ +EL   T  K V         
Sbjct: 466 HTAAIWSLDLTSDGKRLVTASADKTVKF-----WDFKVEQELVAGTLDKFVPKMKLIHDT 520

Query: 83  ----------VSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEV 132
                     V   P    LA    D+T+ ++               +    + GH+  V
Sbjct: 521 TLDLGEDLWCVKISPEDRFLAVSLLDNTVKVFF----------LDSMKFFLSLYGHKLPV 570

Query: 133 KAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLAS 192
            ++  SH    + + S DK++ IW  D  G+   C   L  H   + +V +  E H   S
Sbjct: 571 LSMDISHDSKLIITSSADKNIKIWGLD-FGD---CHKSLFAHQDSIMNVKFLPESHNFFS 626

Query: 193 SSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNYVE 252
            S D T++ W  D + ++C   L GH+G VW      S     + S S D ++RVW   E
Sbjct: 627 CSKDGTVKYW--DGNSFDCIQKLYGHQGEVWA--LAVSSDGQAVVSVSHDRSIRVWEETE 682

Query: 253 EE 254
           ++
Sbjct: 683 DQ 684

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 50/200 (25%), Positives = 80/200 (40%), Gaps = 23/200 (11%)

Query: 60  LKNMDFQLVEELDDSTHKKSVRSVSFRPH--SSILAAGSFDSTISIWGKEEDADPQDDFP 117
           LK M   L     D+  +K   +   + H  + ILA G  D TI IW          D  
Sbjct: 56  LKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIW----------DMQ 105

Query: 118 ETELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQD 177
              +L +   H + +  + +  +G  L S SRD ++ +W  D + E   C   L+ H +D
Sbjct: 106 TQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILW--DLVAETGLC--KLRSH-KD 160

Query: 178 VKHVVWHSEMHLLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLA 237
               +W      L S S D  I+LW  D    +C      H G  W    + +     + 
Sbjct: 161 AITGIWCENDDWLISVSKDGLIKLW--DMKVHQCVETHMAHTGECWSLAVKDN----MVI 214

Query: 238 SCSDDSTVRVWNYVEEEENG 257
           + + +S +++W    E  NG
Sbjct: 215 TANAESEIKLWELDLERPNG 234

 Score = 45.4 bits (106), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 42/141 (29%), Positives = 66/141 (46%), Gaps = 16/141 (11%)

Query: 22  SLELLKSLKLHTDKLWSIDCS--KGLMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKS 79
           S++   SL  H   + S+D S    L+ TSS+D+ IK+  L   DF    +     H+ S
Sbjct: 556 SMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGL---DFGDCHK-SLFAHQDS 611

Query: 80  VRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSH 139
           + +V F P S    + S D T+  W          D    + +  + GH+ EV A++ S 
Sbjct: 612 IMNVKFLPESHNFFSCSKDGTVKYW----------DGNSFDCIQKLYGHQGEVWALAVSS 661

Query: 140 SGYYLASCSRDKSVWIWEADE 160
            G  + S S D+S+ +WE  E
Sbjct: 662 DGQAVVSVSHDRSIRVWEETE 682

 Score = 31.2 bits (69), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 34/142 (23%), Positives = 61/142 (42%), Gaps = 16/142 (11%)

Query: 119 TELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWE--------ADELGEEYECLSV 170
           T L  I E H   + ++  +  G  L + S DK+V  W+        A  L +    + +
Sbjct: 457 TMLENIEEAHTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKL 516

Query: 171 LQEHAQDVKHVVW----HSEMHLLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSD 226
           + +   D+   +W      E   LA S  D+T++++  D+  +  +  L GHK  V   D
Sbjct: 517 IHDTTLDLGEDLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLS--LYGHKLPVLSMD 574

Query: 227 FEKSESSLRLASCSDDSTVRVW 248
              S  S  + + S D  +++W
Sbjct: 575 I--SHDSKLIITSSADKNIKIW 594

>Kwal_55.22067
          Length = 451

 Score = 66.6 bits (161), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 56/213 (26%), Positives = 100/213 (46%), Gaps = 23/213 (10%)

Query: 37  WSIDCSKGLMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSVSFRPHSSILAAGS 96
           W+ +  + ++AT S +    L N    +F+ + +  DS    +V  + +      L +G 
Sbjct: 91  WTPEGRRLVVATYSGE--FSLWNGSTFNFESIMQAHDS----AVAVMKYSHAGDWLISGD 144

Query: 97  FDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIW 156
            D TI IW        Q +F   ++L   E H   ++ +S+S +     +CS D  + IW
Sbjct: 145 SDGTIKIW--------QPNFNMVKVLD--EAHTQCIRGISFSGTDSKFVTCSDDNILKIW 194

Query: 157 EADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDADDWECAAVLN 216
                 +E    S L  H  DV+   WH  M L+AS S D+ ++LW   A   +C + + 
Sbjct: 195 NFSNGQQE----STLSGHHWDVRSCDWHPTMGLIASGSKDNLVKLWDPRAG--QCISTIL 248

Query: 217 GHKGTVWCSDFEKSESSLRLASCSDDSTVRVWN 249
           G K T+  + F+ ++ ++ LA  S D + R+++
Sbjct: 249 GCKHTIISTKFQPTKGNM-LAVISKDKSCRIFD 280

 Score = 42.0 bits (97), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 72/166 (43%), Gaps = 20/166 (12%)

Query: 132 VKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLA 191
           + A+ W+  G  L   +      +W     G  +   S++Q H   V  + +      L 
Sbjct: 86  IPALEWTPEGRRLVVATYSGEFSLWN----GSTFNFESIMQAHDSAVAVMKYSHAGDWLI 141

Query: 192 SSSYDDTIRLWKEDADDWECAAVLN-GHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNY 250
           S   D TI++W+ +   +    VL+  H   +    F  ++S  +  +CSDD+ +++WN+
Sbjct: 142 SGDSDGTIKIWQPN---FNMVKVLDEAHTQCIRGISFSGTDS--KFVTCSDDNILKIWNF 196

Query: 251 VEEEENGEDVWAQEAILPNVHSRAVYSVSW-SLDGYIASVGSDGLL 295
                NG+    QE+ L + H   V S  W    G IAS   D L+
Sbjct: 197 ----SNGQ----QESTL-SGHHWDVRSCDWHPTMGLIASGSKDNLV 233

 Score = 37.0 bits (84), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 58/261 (22%), Positives = 99/261 (37%), Gaps = 74/261 (28%)

Query: 46  MATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSVSFRPHSSILAAGSFDSTISIWG 105
             T S D  +K+ N  N      +E   S H   VRS  + P   ++A+GS D+ + +W 
Sbjct: 182 FVTCSDDNILKIWNFSNGQ----QESTLSGHHWDVRSCDWHPTMGLIASGSKDNLVKLW- 236

Query: 106 KEEDADPQDDFPETELLAIIEGHENEVKAVSWSHS-GYYLASCSRDKSVWIWEADELGEE 164
                DP+      + ++ I G ++ + +  +  + G  LA  S+DKS  I++  +  +E
Sbjct: 237 -----DPR----AGQCISTILGCKHTIISTKFQPTKGNMLAVISKDKSCRIFDIRQNMKE 287

Query: 165 ---------YECLS----------------------VLQE---------------HAQDV 178
                    Y  L+                      +LQE               H + +
Sbjct: 288 LAVYRDESDYMSLTWHPINESMFTVGCYDGSMKHFDLLQEPQDSSSGCFHNIPYAHDKCI 347

Query: 179 KHVVWHSEMHLLASSSYDDTIRLWKE----DADDWECAAVLNGHKGTVWCSDF------- 227
             + ++   H+LAS+S D TIR W      D + ++     N  K   W           
Sbjct: 348 TSLAYNPVGHILASASKDRTIRFWTRARPYDPNSFD-DPTYNNKKVNAWYFGINNNINAI 406

Query: 228 -EKSESSLRLASCSDDSTVRV 247
             K+E  + L   S+DST  +
Sbjct: 407 RPKTEDGIALPPASNDSTASI 427

 Score = 28.9 bits (63), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 25/117 (21%), Positives = 60/117 (51%), Gaps = 9/117 (7%)

Query: 42  SKG-LMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSVSFRP-HSSILAAGSFDS 99
           +KG ++A  S D+  ++ +++    Q ++EL     +    S+++ P + S+   G +D 
Sbjct: 262 TKGNMLAVISKDKSCRIFDIR----QNMKELAVYRDESDYMSLTWHPINESMFTVGCYDG 317

Query: 100 TISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIW 156
           ++  +   ++  PQD         I   H+  + +++++  G+ LAS S+D+++  W
Sbjct: 318 SMKHFDLLQE--PQDS-SSGCFHNIPYAHDKCITSLAYNPVGHILASASKDRTIRFW 371

>Scas_721.32
          Length = 822

 Score = 66.6 bits (161), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 59/220 (26%), Positives = 96/220 (43%), Gaps = 35/220 (15%)

Query: 35  KLWSIDCSKGLMATSSSDRKIKLVNLKNMDFQLVEELDDST------HKKSVRSVSFRPH 88
           KLWS+D S            +K +  K+ D     +++D+T      H  +V S SF P 
Sbjct: 512 KLWSLDGSS-----------LKQIQEKSADSINTGDMNDNTSTTLIGHSGAVYSTSFSPD 560

Query: 89  SSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLASCS 148
           +  L +GS D T+ +W  +           T L++  +GH + V  V +S  G+Y A+ S
Sbjct: 561 NRYLLSGSEDKTVRLWSTDT---------YTSLVSY-KGHNHPVWDVQFSPLGHYFATAS 610

Query: 149 RDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDADD 208
            D++  +W  D +      L +   H  DV  V +H     + + S D T R+W  D   
Sbjct: 611 HDQTARLWSCDHI----YPLRIFAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMW--DIST 664

Query: 209 WECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVW 248
            +   +  GH   V C+    S     LA+ S+D  + +W
Sbjct: 665 GDSVRLFLGHTAPVLCTAV--SPDGRWLATGSEDGIINLW 702

 Score = 58.5 bits (140), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 72/281 (25%), Positives = 111/281 (39%), Gaps = 42/281 (14%)

Query: 82  SVSFRPHSSILAAGSFDSTISIWG---------KEEDADP-----QDDFPETELLAIIEG 127
           S+ F   S ++AAG  DS I +W          +E+ AD       +D   T L+    G
Sbjct: 492 SLQFSEDSRLVAAGFQDSYIKLWSLDGSSLKQIQEKSADSINTGDMNDNTSTTLI----G 547

Query: 128 HENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEM 187
           H   V + S+S    YL S S DK+V +W  D     Y  L   + H   V  V +    
Sbjct: 548 HSGAVYSTSFSPDNRYLLSGSEDKTVRLWSTD----TYTSLVSYKGHNHPVWDVQFSPLG 603

Query: 188 HLLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRV 247
           H  A++S+D T RLW    D      +  GH   V C  F    +   + + S D T R+
Sbjct: 604 HYFATASHDQTARLWS--CDHIYPLRIFAGHLSDVDCVSFH--PNGCYVFTGSSDKTCRM 659

Query: 248 WNYVEEEENGEDVWAQEAI-LPNVHSRAVYSVSWSLDGYIASVGSDGLLXXXXXXXXXXX 306
           W          D+   +++ L   H+  V   + S DG   + GS+  +           
Sbjct: 660 W----------DISTGDSVRLFLGHTAPVLCTAVSPDGRWLATGSEDGIINLWDIGTAKR 709

Query: 307 XXXXQQHEAHGIYEINVVKWATVDDSVLLLTGGDDGCANIW 347
               + H  + I+ ++  K   V     L++GG D    +W
Sbjct: 710 LKVMRGHGKNAIHSLSYCKEGNV-----LVSGGADHSVRVW 745

>Kwal_23.6324
          Length = 514

 Score = 66.2 bits (160), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 56/183 (30%), Positives = 88/183 (48%), Gaps = 28/183 (15%)

Query: 76  HKKSVRSVSFRPHSS-ILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKA 134
           H  ++   +F PH+S  +  GS D+T  IW      D   + P    +  ++GH N V  
Sbjct: 141 HGSTILCSAFAPHTSGRMVTGSGDNTARIW------DCNTNTP----MYTLKGHFNWVLC 190

Query: 135 VSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHL----- 189
           V+W   G  +A+ S D ++ +W++++ GE Y     L+ HA+ +  + W   MHL     
Sbjct: 191 VAWCPDGELIATGSMDNTIRLWDSNK-GESYG--EALRGHAKWITSLTWE-PMHLVKAGD 246

Query: 190 ---LASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVR 246
              LAS+S D TI++W  D     C   L+GH  +V C  +        L S S D T+R
Sbjct: 247 QPRLASASKDGTIKIW--DTTRRVCVLTLSGHTNSVSCVKWGGRGI---LYSGSHDKTIR 301

Query: 247 VWN 249
            W+
Sbjct: 302 AWD 304

 Score = 61.6 bits (148), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 43/160 (26%), Positives = 72/160 (45%), Gaps = 17/160 (10%)

Query: 91  ILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLASCSRD 150
           ++   S D T+ +W         D    ++ +  + GH+  V  V++S  G Y+ S S D
Sbjct: 372 LMVTASDDFTMYLW---------DPLKASKPITRMTGHQKLVNHVAFSPDGRYIVSASFD 422

Query: 151 KSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDADDWE 210
            S+ +W+    G     ++  + H   V  V W S+  LL S S D T+++W  D    +
Sbjct: 423 NSIKLWD----GRNGTFIATFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVW--DVRTKK 476

Query: 211 CAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNY 250
            +  L GH   V+  D+  S    R+ S   D  VR+W +
Sbjct: 477 LSVDLPGHNDEVYTVDW--SVDGKRVCSAGKDKMVRIWTH 514

 Score = 56.6 bits (135), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 79/157 (50%), Gaps = 25/157 (15%)

Query: 144 LASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWK 203
           + + S D ++++W+  +  +    ++ +  H + V HV +  +   + S+S+D++I+LW 
Sbjct: 373 MVTASDDFTMYLWDPLKASKP---ITRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLW- 428

Query: 204 EDADDWECAAVLNGHKGTV----WCSDFEKSESSLRLASCSDDSTVRVWNYVEEEENGED 259
            D  +    A   GH  +V    W SD         L SCS D+T++VW+ V  ++   D
Sbjct: 429 -DGRNGTFIATFRGHVASVYQVAWSSDCR------LLVSCSKDTTLKVWD-VRTKKLSVD 480

Query: 260 VWAQEAILPNVHSRAVYSVSWSLDG-YIASVGSDGLL 295
                  LP  H+  VY+V WS+DG  + S G D ++
Sbjct: 481 -------LPG-HNDEVYTVDWSVDGKRVCSAGKDKMV 509

 Score = 55.5 bits (132), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 37/128 (28%), Positives = 58/128 (45%), Gaps = 16/128 (12%)

Query: 76  HKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAV 135
           H+K V  V+F P    + + SFD++I +W          D      +A   GH   V  V
Sbjct: 400 HQKLVNHVAFSPDGRYIVSASFDNSIKLW----------DGRNGTFIATFRGHVASVYQV 449

Query: 136 SWSHSGYYLASCSRDKSVWIWEADELGEEYECLSV-LQEHAQDVKHVVWHSEMHLLASSS 194
           +WS     L SCS+D ++ +W+        + LSV L  H  +V  V W  +   + S+ 
Sbjct: 450 AWSSDCRLLVSCSKDTTLKVWDV-----RTKKLSVDLPGHNDEVYTVDWSVDGKRVCSAG 504

Query: 195 YDDTIRLW 202
            D  +R+W
Sbjct: 505 KDKMVRIW 512

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 67/263 (25%), Positives = 110/263 (41%), Gaps = 45/263 (17%)

Query: 41  CSKG-LMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSVSFRPHSSI-------L 92
           C  G L+AT S D  I+L +  N      E L    H K + S+++ P   +       L
Sbjct: 194 CPDGELIATGSMDNTIRLWD-SNKGESYGEALRG--HAKWITSLTWEPMHLVKAGDQPRL 250

Query: 93  AAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLASCSRDKS 152
           A+ S D TI IW          D      +  + GH N V  V W   G  L S S DK+
Sbjct: 251 ASASKDGTIKIW----------DTTRRVCVLTLSGHTNSVSCVKWGGRGI-LYSGSHDKT 299

Query: 153 VWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDADDWECA 212
           +  W+    G+   C+++L+ HA  + H+  +++ + L   ++D T    K  + +   A
Sbjct: 300 IRAWDMAAGGK---CINILKSHAHWINHLSLNTD-YALRVGAFDHTGE--KPSSPEEARA 353

Query: 213 AVLNGHKGTVWCSDFEKSESSLR--LASCSDDSTVRVWNYVEEEENGEDVWAQEAILPNV 270
             L  ++         K    L   + + SDD T+ +W+ ++         ++       
Sbjct: 354 KALKNYE------KIAKKNGQLEELMVTASDDFTMYLWDPLKA--------SKPITRMTG 399

Query: 271 HSRAVYSVSWSLDG-YIASVGSD 292
           H + V  V++S DG YI S   D
Sbjct: 400 HQKLVNHVAFSPDGRYIVSASFD 422

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 49/111 (44%), Gaps = 14/111 (12%)

Query: 46  MATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSVSFRPHSSILAAGSFDSTISIWG 105
           + ++S D  IKL + +N  F          H  SV  V++     +L + S D+T+ +W 
Sbjct: 416 IVSASFDNSIKLWDGRNGTFIATFR----GHVASVYQVAWSSDCRLLVSCSKDTTLKVW- 470

Query: 106 KEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIW 156
                    D    +L   + GH +EV  V WS  G  + S  +DK V IW
Sbjct: 471 ---------DVRTKKLSVDLPGHNDEVYTVDWSVDGKRVCSAGKDKMVRIW 512

 Score = 31.6 bits (70), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 37/80 (46%), Gaps = 10/80 (12%)

Query: 212 AAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNYVEEEENGEDVWAQEAILPNVH 271
           ++ + GH  T+ CS F    +S R+ + S D+T R+W+          ++  +      H
Sbjct: 135 SSAIAGHGSTILCSAFA-PHTSGRMVTGSGDNTARIWDC----NTNTPMYTLKG-----H 184

Query: 272 SRAVYSVSWSLDGYIASVGS 291
              V  V+W  DG + + GS
Sbjct: 185 FNWVLCVAWCPDGELIATGS 204

 Score = 30.8 bits (68), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 43/95 (45%), Gaps = 20/95 (21%)

Query: 190 LASSSYDDTIRLWKEDADDWECAAVLNGHKG----TVWCSDFEKSESSLRLASCSDDSTV 245
           + + S D+T R+W  D +       L GH        WC D E       +A+ S D+T+
Sbjct: 158 MVTGSGDNTARIW--DCNTNTPMYTLKGHFNWVLCVAWCPDGE------LIATGSMDNTI 209

Query: 246 RVWNYVEEEENGEDVWAQEAILPNVHSRAVYSVSW 280
           R+W+  + E  GE +          H++ + S++W
Sbjct: 210 RLWDSNKGESYGEALRG--------HAKWITSLTW 236

>AGR180W [4491] [Homologous to ScYLR222C - SH]
           complement(1090647..1093067) [2421 bp, 806 aa]
          Length = 806

 Score = 66.6 bits (161), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 53/225 (23%), Positives = 95/225 (42%), Gaps = 27/225 (12%)

Query: 45  LMATSSSDRKIKLVNLKNM-DFQLVE--------ELDDSTHKKSVRSVSFRPHSSILAAG 95
            + T+S+D  IK   + N  D + +E        E     H+K + ++S  P+ SI A  
Sbjct: 447 FLLTASNDLTIKRWKVPNPNDRKAIELPHIVKASEYTRRAHEKDINAISMSPNDSIFATA 506

Query: 96  SFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWI 155
           S+D T  IW  +            E+ A +  H+  +  V++    + LA+CS D+S+ +
Sbjct: 507 SYDKTCKIWNVDTG----------EVEATLANHKRGLWGVAFCEYDWLLATCSGDRSINL 556

Query: 156 WEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDADDWECAAVL 215
           W      E +  L  L+ H   V+ V + +    L S+  D  +++W  D    EC   L
Sbjct: 557 WSL----ESFTVLKTLEGHTNAVQRVSFINGNKQLVSTGADGLVKIW--DCSTGECVRTL 610

Query: 216 NGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNYVEEEENGEDV 260
           + H   +W      +     + +   D   + W    EEE+  ++
Sbjct: 611 DAHNNRIWA--LAVANDGQLIITADADGVFQFWEDNSEEEHERNI 653

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 50/209 (23%), Positives = 91/209 (43%), Gaps = 27/209 (12%)

Query: 87  PHSSILAAGSFDSTISIWGKEEDADPQDDFP-ETELLAIIEGHENEVKAVSWSHSGYYLA 145
           P  + LA  +   T+ I    + ++ ++    ETE+    EGH + + ++  +  G +LA
Sbjct: 342 PSLNRLALATNSPTLRIIPTPQASEDKEVMEIETEMY---EGHTDLLNSLDATSDGLWLA 398

Query: 146 SCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMH-----LLASSSYDDTIR 200
           + S+D SV +W  +E    +E  +    HA  V  +   + M+      L ++S D TI+
Sbjct: 399 TASKDHSVILWRYNEASSSFEPFTKFLGHAGPVTAIALPNVMNRNWPEFLLTASNDLTIK 458

Query: 201 LWK----EDADDWECAAVLNGHKGTVWCSDFEKSESSLR-----LASCSDDSTVRVWNYV 251
            WK     D    E   ++   + T    + + +  S+       A+ S D T ++WN  
Sbjct: 459 RWKVPNPNDRKAIELPHIVKASEYTRRAHEKDINAISMSPNDSIFATASYDKTCKIWNV- 517

Query: 252 EEEENGEDVWAQEAILPNVHSRAVYSVSW 280
                  D    EA L N H R ++ V++
Sbjct: 518 -------DTGEVEATLAN-HKRGLWGVAF 538

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 41/159 (25%), Positives = 70/159 (44%), Gaps = 21/159 (13%)

Query: 24  ELLKSLKLHTDKLWSIDCSKG--LMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVR 81
           E+  +L  H   LW +   +   L+AT S DR I L +L++  F +++ L+   H  +V+
Sbjct: 521 EVEATLANHKRGLWGVAFCEYDWLLATCSGDRSINLWSLES--FTVLKTLEG--HTNAVQ 576

Query: 82  SVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSG 141
            VSF   +  L +   D  + IW          D    E +  ++ H N + A++ ++ G
Sbjct: 577 RVSFINGNKQLVSTGADGLVKIW----------DCSTGECVRTLDAHNNRIWALAVANDG 626

Query: 142 YYLASCSRDKSVWIWEAD-----ELGEEYECLSVLQEHA 175
             + +   D     WE +     E   E E L V QE +
Sbjct: 627 QLIITADADGVFQFWEDNSEEEHERNIEQEKLRVEQEQS 665

>CAGL0M04081g complement(450572..451939) highly similar to sp|P42841
           Saccharomyces cerevisiae YNL317w PFS2 polyadenylation
           factor I, hypothetical start
          Length = 455

 Score = 65.9 bits (159), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 58/213 (27%), Positives = 100/213 (46%), Gaps = 23/213 (10%)

Query: 37  WSIDCSKGLMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSVSFRPHSSILAAGS 96
           WS +  + ++AT S +    L N  +  F+ + +     H  SV ++ +      + +G 
Sbjct: 90  WSPEGRRLIVATFSGE--FSLWNGSSFTFETIMQ----AHDTSVTTMKYSHAGDWMISGD 143

Query: 97  FDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIW 156
            D TI IW        Q +F   + L  I  H   ++ V++S++     +CS D  + IW
Sbjct: 144 ADGTIKIW--------QPNFNMVKELDRI--HTEGIRDVAFSNNDSKFVTCSDDNILKIW 193

Query: 157 EADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDADDWECAAVLN 216
                 +E     VL  H  DV+   WH E+ L+ S S D+ ++LW  D    +C + L 
Sbjct: 194 NFSNGQQE----RVLSGHHWDVRSCDWHPELGLIVSGSKDNLVKLW--DPRSGQCVSTLL 247

Query: 217 GHKGTVWCSDFEKSESSLRLASCSDDSTVRVWN 249
             K TV  + F+ ++ +L LA+ S D + RV++
Sbjct: 248 KFKHTVLKTRFQPTKGNL-LAAISKDKSCRVFD 279

 Score = 38.5 bits (88), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 70/165 (42%), Gaps = 18/165 (10%)

Query: 132 VKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLA 191
           + A+ WS  G  L   +      +W     G  +   +++Q H   V  + +      + 
Sbjct: 85  IPAIQWSPEGRRLIVATFSGEFSLWN----GSSFTFETIMQAHDTSVTTMKYSHAGDWMI 140

Query: 192 SSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNYV 251
           S   D TI++W+ + +  +    ++    T    D   S +  +  +CSDD+ +++WN+ 
Sbjct: 141 SGDADGTIKIWQPNFNMVKELDRIH----TEGIRDVAFSNNDSKFVTCSDDNILKIWNF- 195

Query: 252 EEEENGEDVWAQEAILPNVHSRAVYSVSWSLD-GYIASVGSDGLL 295
               NG+    QE +L + H   V S  W  + G I S   D L+
Sbjct: 196 ---SNGQ----QERVL-SGHHWDVRSCDWHPELGLIVSGSKDNLV 232

 Score = 32.7 bits (73), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 31/64 (48%), Gaps = 4/64 (6%)

Query: 76  HKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQ--DD--FPETELLAIIEGHENE 131
           H+K + ++++ P   ILA  + D TI  W +    DP   DD  +   ++     G  N+
Sbjct: 338 HEKCISAIAYNPVGHILATAAKDRTIRFWTRARPVDPNAFDDPTYNNKKMTGWFFGINND 397

Query: 132 VKAV 135
           + AV
Sbjct: 398 INAV 401

>Scas_720.95
          Length = 515

 Score = 65.9 bits (159), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 45/160 (28%), Positives = 75/160 (46%), Gaps = 17/160 (10%)

Query: 91  ILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLASCSRD 150
           ++   S D T+ +W   +   P         +A + GH+  V  V++S  G Y+ S S D
Sbjct: 373 LMVTASDDFTMFLWNPLKSNKP---------IARMTGHQKLVNHVAFSPDGRYIVSASFD 423

Query: 151 KSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDADDWE 210
            S+ +W+    G + + +S  + H   V  V W ++  LL S S D T+++W  D    +
Sbjct: 424 NSIKLWD----GRDGKFISTFRGHVASVYQVAWSADCRLLVSCSKDTTLKVW--DVRTRK 477

Query: 211 CAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNY 250
            +  L GHK  V+  D+  S    R+ S   D  VR+W +
Sbjct: 478 LSVDLPGHKDEVYTVDW--SVDGKRVCSGGKDKMVRIWTH 515

 Score = 60.5 bits (145), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 66/235 (28%), Positives = 108/235 (45%), Gaps = 30/235 (12%)

Query: 30  KLHTDKLWSIDCSKGLMAT------SSSDRKIKLVNLKNMDFQLVEELDDST----HKKS 79
           K  TD +  ID +  L ++       +++  I L+      F++      S+    H  +
Sbjct: 86  KKPTDPIQPIDITDNLYSSILKPGYRTTEDIITLIYTPRAVFKVKPVTRSSSAIAGHGST 145

Query: 80  VRSVSFRPH-SSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWS 138
           +   +F P+ SS +  G+ D+T  IW    D D Q   P+    A + GH N V  VS+ 
Sbjct: 146 ILCSAFAPNTSSRMVTGAGDNTARIW----DCDTQT--PK----ATLTGHFNWVLCVSYC 195

Query: 139 HSGYYLASCSRDKSVWIWEADE---LGEEYEC-LSVLQEHAQDVKHVVWHSEMHLLASSS 194
            +G  +A+ S D ++ +W++ +   LG+     L  +   A +  H+V   E   LAS+S
Sbjct: 196 PNGEVIATGSMDNTIRLWDSKDGKPLGDALRGHLKWITSLAWEPIHLVKPGESPRLASAS 255

Query: 195 YDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWN 249
            D TIR+W  D     C   ++GH  +V C  +        + S S D TVRVW+
Sbjct: 256 KDGTIRIW--DITRRVCLYTMSGHTNSVSCIKWSGQGI---IYSGSHDKTVRVWD 305

 Score = 57.4 bits (137), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 67/146 (45%), Gaps = 22/146 (15%)

Query: 80  VRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSW-- 137
           V  VS+ P+  ++A GS D+TI +W   +D  P  D         + GH   + +++W  
Sbjct: 189 VLCVSYCPNGEVIATGSMDNTIRLW-DSKDGKPLGD--------ALRGHLKWITSLAWEP 239

Query: 138 -----SHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLAS 192
                      LAS S+D ++ IW+         CL  +  H   V  + W S   ++ S
Sbjct: 240 IHLVKPGESPRLASASKDGTIRIWDI----TRRVCLYTMSGHTNSVSCIKW-SGQGIIYS 294

Query: 193 SSYDDTIRLWKEDADDWECAAVLNGH 218
            S+D T+R+W  +AD  +C  +L  H
Sbjct: 295 GSHDKTVRVWDMNADG-KCINILKSH 319

 Score = 57.0 bits (136), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 43/159 (27%), Positives = 70/159 (44%), Gaps = 19/159 (11%)

Query: 45  LMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSVSFRPHSSILAAGSFDSTISIW 104
           LM T+S D  + L N    +  +      + H+K V  V+F P    + + SFD++I +W
Sbjct: 373 LMVTASDDFTMFLWNPLKSNKPIARM---TGHQKLVNHVAFSPDGRYIVSASFDNSIKLW 429

Query: 105 GKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEE 164
                     D  + + ++   GH   V  V+WS     L SCS+D ++ +W+       
Sbjct: 430 ----------DGRDGKFISTFRGHVASVYQVAWSADCRLLVSCSKDTTLKVWDV-----R 474

Query: 165 YECLSV-LQEHAQDVKHVVWHSEMHLLASSSYDDTIRLW 202
              LSV L  H  +V  V W  +   + S   D  +R+W
Sbjct: 475 TRKLSVDLPGHKDEVYTVDWSVDGKRVCSGGKDKMVRIW 513

 Score = 54.3 bits (129), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 42/153 (27%), Positives = 76/153 (49%), Gaps = 17/153 (11%)

Query: 144 LASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWK 203
           + + S D ++++W   +  +    ++ +  H + V HV +  +   + S+S+D++I+LW 
Sbjct: 374 MVTASDDFTMFLWNPLKSNKP---IARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLW- 429

Query: 204 EDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNYVEEEENGEDVWAQ 263
            D  D +  +   GH  +V+      S     L SCS D+T++VW+ V   +   D    
Sbjct: 430 -DGRDGKFISTFRGHVASVY--QVAWSADCRLLVSCSKDTTLKVWD-VRTRKLSVD---- 481

Query: 264 EAILPNVHSRAVYSVSWSLDG-YIASVGSDGLL 295
              LP  H   VY+V WS+DG  + S G D ++
Sbjct: 482 ---LPG-HKDEVYTVDWSVDGKRVCSGGKDKMV 510

 Score = 33.5 bits (75), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 39/80 (48%), Gaps = 10/80 (12%)

Query: 212 AAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNYVEEEENGEDVWAQEAILPNVH 271
           ++ + GH  T+ CS F  + SS R+ + + D+T R+W+         D    +A L   H
Sbjct: 136 SSAIAGHGSTILCSAFAPNTSS-RMVTGAGDNTARIWDC--------DTQTPKATLTG-H 185

Query: 272 SRAVYSVSWSLDGYIASVGS 291
              V  VS+  +G + + GS
Sbjct: 186 FNWVLCVSYCPNGEVIATGS 205

>Scas_630.6
          Length = 621

 Score = 65.9 bits (159), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 48/179 (26%), Positives = 83/179 (46%), Gaps = 29/179 (16%)

Query: 80  VRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSH 139
           +RS+ F P    LA G+ D  I IW          +  E +++ +++GHE ++ ++ +  
Sbjct: 344 IRSICFSPDGEFLATGAEDKLIRIW----------NIKERKIVMVLKGHEQDIYSLDYFP 393

Query: 140 SGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTI 199
            G  L S S D+S+ IW+     +  +C   L          V  +E  L+A+ S D ++
Sbjct: 394 DGQKLVSGSGDRSIRIWDL----KTGQCSLTLSIEDGVTTVAVSPNEGKLIAAGSLDRSV 449

Query: 200 RLW---------KEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWN 249
           R+W         + D+D+       NGH+ +V+   F K      + S S D TV++WN
Sbjct: 450 RIWDSSTGFLVERLDSDNESG----NGHQDSVYSVAFTK--DGQHVVSGSLDRTVKLWN 502

 Score = 51.2 bits (121), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 51/171 (29%), Positives = 80/171 (46%), Gaps = 23/171 (13%)

Query: 45  LMATSSSDRKIKLVNLKNMDFQLVEELDD-----STHKKSVRSVSFRPHSSILAAGSFDS 99
           L+A  S DR +++ +  +  F LVE LD      + H+ SV SV+F      + +GS D 
Sbjct: 439 LIAAGSLDRSVRIWD-SSTGF-LVERLDSDNESGNGHQDSVYSVAFTKDGQHVVSGSLDR 496

Query: 100 TISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEAD 159
           T+ +W      D Q    + E+  I  GH++ V +V+ S+   Y+ S S+D+ V IW+ D
Sbjct: 497 TVKLWNL---GDTQSGTGKCEVTYI--GHKDFVLSVATSNDDKYIFSGSKDRGVIIWDKD 551

Query: 160 ELGEEYECLSVLQEHAQDVKHVVW-------HSEMHLLASSSYDDTIRLWK 203
                   + +LQ H + V  V              L A+ S D   R+WK
Sbjct: 552 ----SGNPILMLQGHRKSVISVATVNSNVDDGKNYKLFATGSGDCKARIWK 598

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 61/247 (24%), Positives = 109/247 (44%), Gaps = 43/247 (17%)

Query: 45  LMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSVSFRPHSSILAAGSFDSTISIW 104
            +AT + D+ I++ N+K     +V +     H++ + S+ + P    L +GS D +I IW
Sbjct: 355 FLATGAEDKLIRIWNIKERKIVMVLK----GHEQDIYSLDYFPDGQKLVSGSGDRSIRIW 410

Query: 105 GKEEDADPQDDFPETELLAIIEGHENEVKAVSWS-HSGYYLASCSRDKSVWIWEADELGE 163
                     D  +T   ++    E+ V  V+ S + G  +A+ S D+SV IW++   G 
Sbjct: 411 ----------DL-KTGQCSLTLSIEDGVTTVAVSPNEGKLIAAGSLDRSVRIWDS-STGF 458

Query: 164 EYECLSVLQE----HAQDVKHVVWHSEMHLLASSSYDDTIRLWK---EDADDWECAAVLN 216
             E L    E    H   V  V +  +   + S S D T++LW      +   +C     
Sbjct: 459 LVERLDSDNESGNGHQDSVYSVAFTKDGQHVVSGSLDRTVKLWNLGDTQSGTGKCEVTYI 518

Query: 217 GHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNYVEEEENGEDVWAQEAILPNV----HS 272
           GHK      DF      L +A+ +DD  +    +   ++ G  +W +++  P +    H 
Sbjct: 519 GHK------DF-----VLSVATSNDDKYI----FSGSKDRGVIIWDKDSGNPILMLQGHR 563

Query: 273 RAVYSVS 279
           ++V SV+
Sbjct: 564 KSVISVA 570

>YFL009W (CDC4) [1673] chr6 (116139..118478) F-box protein and
           component of the SCF-Cdc4p complex
           (Skp1p-Cdc53p-Cdc34p-Cdc4p) which targets Sic1p, Far1p,
           Cdc6p, Ctf13p and Gcn4p for ubiquitin-dependent
           degradation, has WD (WD-40) repeats [2340 bp, 779 aa]
          Length = 779

 Score = 65.9 bits (159), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 63/264 (23%), Positives = 117/264 (44%), Gaps = 45/264 (17%)

Query: 48  TSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSVSFRPHSSILAAGSFDSTISIWGKE 107
           T + D+ I++ +  N  F L      S H   V ++ +  H  IL +GS D T+ +W   
Sbjct: 397 TGADDKMIRVYDSINKKFLL----QLSGHDGGVWALKYA-HGGILVSGSTDRTVRVW--- 448

Query: 108 EDADPQDDFPETELLAIIEGHENEVKAVSWSH--SGYYLASCSRDKSVWIWE------AD 159
                  D  +     + +GH + V+ +      +  Y+ + SRD ++ +W+        
Sbjct: 449 -------DIKKGCCTHVFKGHNSTVRCLDIVEYKNIKYIVTGSRDNTLHVWKLPKESSVP 501

Query: 160 ELGEEYE-------------CLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDA 206
           + GEE++              + VL+ H   V+ V  H   +++ S SYD+T+ +W  D 
Sbjct: 502 DHGEEHDYPLVFHTPEENPYFVGVLRGHMASVRTVSGHG--NIVVSGSYDNTLIVW--DV 557

Query: 207 DDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNYVEEEENGEDVWAQEAI 266
              +C  +L+GH   ++ + ++      R  S S D+T+R+W+      NGE  +A  + 
Sbjct: 558 AQMKCLYILSGHTDRIYSTIYDHERK--RCISASMDTTIRIWDLENIWNNGECSYATNSA 615

Query: 267 LPNVHSRAVYSVSWSLDGYIASVG 290
            P      +    ++L G+ A VG
Sbjct: 616 SP---CAKILGAMYTLQGHTALVG 636

 Score = 47.8 bits (112), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 39/150 (26%), Positives = 67/150 (44%), Gaps = 32/150 (21%)

Query: 76  HKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAV 135
           H  SVR+VS   H +I+ +GS+D+T+ +W          D  + + L I+ GH + + + 
Sbjct: 529 HMASVRTVS--GHGNIVVSGSYDNTLIVW----------DVAQMKCLYILSGHTDRIYST 576

Query: 136 SWSHSGYYLASCSRDKSVWIWEADELGEEYEC----------------LSVLQEHAQDVK 179
            + H      S S D ++ IW+ + +    EC                +  LQ H   V 
Sbjct: 577 IYDHERKRCISASMDTTIRIWDLENIWNNGECSYATNSASPCAKILGAMYTLQGHTALVG 636

Query: 180 HVVWHSEMHLLASSSYDDTIRLWKEDADDW 209
            +    +   L S++ D +IR W  DA+D+
Sbjct: 637 LLRLSDK--FLVSAAADGSIRGW--DANDY 662

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/126 (23%), Positives = 60/126 (47%), Gaps = 8/126 (6%)

Query: 81  RSVSFRPH-SSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSH 139
           +  + R H +S++    F+    I G ++      D    + L  + GH+  V A+ ++H
Sbjct: 373 QRTTLRGHMTSVITCLQFEDNYVITGADDKMIRVYDSINKKFLLQLSGHDGGVWALKYAH 432

Query: 140 SGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVK--HVVWHSEMHLLASSSYDD 197
            G  L S S D++V +W+     ++  C  V + H   V+   +V +  +  + + S D+
Sbjct: 433 GG-ILVSGSTDRTVRVWDI----KKGCCTHVFKGHNSTVRCLDIVEYKNIKYIVTGSRDN 487

Query: 198 TIRLWK 203
           T+ +WK
Sbjct: 488 TLHVWK 493

>KLLA0F06754g complement(650475..651509) similar to sp|P53011
           Saccharomyces cerevisiae YGL100w SEH1 nuclear pore
           protein, start by similarity
          Length = 344

 Score = 65.1 bits (157), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 39/142 (27%), Positives = 71/142 (50%), Gaps = 9/142 (6%)

Query: 123 AIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVV 182
             + GH + V  +S+   G  +A+CS D+ + +++ D+   E+E     + H   +  + 
Sbjct: 3   PFLTGHSDLVHDISYDFYGRRVATCSSDQHIKVFKLDKETNEWELSESWKAHDSSIVSLD 62

Query: 183 WHSE--MHLLASSSYDDTIRLWKEDAD-------DWECAAVLNGHKGTVWCSDFEKSESS 233
           W +     ++AS SYD TI+LW+ED D        W+    LN   G ++   F  S   
Sbjct: 63  WAAPEFGRIIASVSYDKTIKLWEEDPDALELSGKRWQKLCTLNDATGPLFSVKFAPSHLG 122

Query: 234 LRLASCSDDSTVRVWNYVEEEE 255
           LRLA+  +D  +R+++ +E  +
Sbjct: 123 LRLAALGNDGKLRLYDALESSD 144

 Score = 37.0 bits (84), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 35/64 (54%), Gaps = 1/64 (1%)

Query: 109 DADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECL 168
           DAD        EL++    H+ EV +VSW+ +G  L+S   D  + +W+A     E+ C+
Sbjct: 279 DADGSVANLHVELISEHSDHQGEVWSVSWNLTGTILSSTGDDGKIRLWKA-SYSNEFRCM 337

Query: 169 SVLQ 172
           SV+Q
Sbjct: 338 SVVQ 341

>AER263C [2765] [Homologous to ScYCR072C - SH] (1118228..1119769)
           [1542 bp, 513 aa]
          Length = 513

 Score = 65.5 bits (158), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 57/185 (30%), Positives = 87/185 (47%), Gaps = 32/185 (17%)

Query: 76  HKKSVRSVSFRPH-SSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKA 134
           H  ++   +F PH SS +  G+ D+T  IW    D D Q        L  ++GH N V  
Sbjct: 140 HGATILCSAFAPHTSSRMVTGAGDNTARIW----DCDTQTP------LCTLKGHSNWVLC 189

Query: 135 VSWSHSGYYLASCSRDKSVWIWEADE---LGEEYECLSVLQEHAQ-------DVKHVVWH 184
           V+WS  G  +A+ S D ++ +W++++   LG+       L+ H +       +  H+V  
Sbjct: 190 VAWSADGEVIATGSMDATIRLWDSEKGQSLGD------ALRGHTKWITSLSWEPIHLVKP 243

Query: 185 SEMHLLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDST 244
            E   LAS+S D TI++W  D     C   L+GH  +V C  +        L S S D T
Sbjct: 244 GEKPRLASASKDGTIKIW--DTTRRVCIYTLSGHTSSVSCIKWGGRNV---LYSASHDRT 298

Query: 245 VRVWN 249
           VR W+
Sbjct: 299 VRCWD 303

 Score = 63.5 bits (153), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 44/160 (27%), Positives = 74/160 (46%), Gaps = 17/160 (10%)

Query: 91  ILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLASCSRD 150
           ++  GS D T+ +W   + + P         +  + GH+  V  V++S  G Y+ S S D
Sbjct: 371 LMVTGSDDFTMYLWNPLKGSKP---------ILRMTGHQKLVNHVAFSPDGRYIVSASFD 421

Query: 151 KSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDADDWE 210
            S+ +W+    G + + ++  + H   V  V W S+  LL S S D T+++W  D    +
Sbjct: 422 NSIKLWD----GRDGKFIATFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVW--DVKTRK 475

Query: 211 CAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNY 250
               L GH   V+  D+  S    R+ S   D  VR+W +
Sbjct: 476 LTVDLPGHNDEVYTVDW--SVDGKRVCSGGKDKMVRLWTH 513

 Score = 58.2 bits (139), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 45/159 (28%), Positives = 70/159 (44%), Gaps = 19/159 (11%)

Query: 45  LMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSVSFRPHSSILAAGSFDSTISIW 104
           LM T S D  + L N       +   L  + H+K V  V+F P    + + SFD++I +W
Sbjct: 371 LMVTGSDDFTMYLWNPLKGSKPI---LRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLW 427

Query: 105 GKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEE 164
                     D  + + +A   GH   V  V+WS     L SCS+D ++ +W+      +
Sbjct: 428 ----------DGRDGKFIATFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDV-----K 472

Query: 165 YECLSV-LQEHAQDVKHVVWHSEMHLLASSSYDDTIRLW 202
              L+V L  H  +V  V W  +   + S   D  +RLW
Sbjct: 473 TRKLTVDLPGHNDEVYTVDWSVDGKRVCSGGKDKMVRLW 511

 Score = 55.1 bits (131), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 59/209 (28%), Positives = 94/209 (44%), Gaps = 37/209 (17%)

Query: 92  LAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLASCSRDK 151
           L  G FD T +     EDA  +      E +A   G   E+           + + S D 
Sbjct: 332 LRMGPFDHTGTKPASPEDAQARA-LRNYEKVAKKNGTMEEL-----------MVTGSDDF 379

Query: 152 SVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDADDWEC 211
           ++++W  + L      L  +  H + V HV +  +   + S+S+D++I+LW  D  D + 
Sbjct: 380 TMYLW--NPLKGSKPILR-MTGHQKLVNHVAFSPDGRYIVSASFDNSIKLW--DGRDGKF 434

Query: 212 AAVLNGHKGTV----WCSDFEKSESSLRLASCSDDSTVRVWNYVEEEENGEDVWAQEAIL 267
            A   GH  +V    W SD         L SCS D+T++VW+ V+  +   D       L
Sbjct: 435 IATFRGHVASVYQVAWSSDCR------LLVSCSKDTTLKVWD-VKTRKLTVD-------L 480

Query: 268 PNVHSRAVYSVSWSLDG-YIASVGSDGLL 295
           P  H+  VY+V WS+DG  + S G D ++
Sbjct: 481 PG-HNDEVYTVDWSVDGKRVCSGGKDKMV 508

 Score = 45.4 bits (106), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 67/268 (25%), Positives = 111/268 (41%), Gaps = 50/268 (18%)

Query: 37  WSIDCSKGLMATSSSDRKIKLVNLKNMDFQLVEELDDS--THKKSVRSVSFRP------- 87
           WS D    ++AT S D  I+L      D +  + L D+   H K + S+S+ P       
Sbjct: 192 WSADGE--VIATGSMDATIRL-----WDSEKGQSLGDALRGHTKWITSLSWEPIHLVKPG 244

Query: 88  HSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLASC 147
               LA+ S D TI IW          D      +  + GH + V  + W      L S 
Sbjct: 245 EKPRLASASKDGTIKIW----------DTTRRVCIYTLSGHTSSVSCIKWGGRNV-LYSA 293

Query: 148 SRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDAD 207
           S D++V  W+    G+   C+++L+ HA  V H+   ++ + L    +D T        +
Sbjct: 294 SHDRTVRCWDMAAGGK---CINILKSHAHWVNHLSLSTD-YALRMGPFDHT-GTKPASPE 348

Query: 208 DWECAAVLNGHKGTVWCSDFEKSESSLR--LASCSDDSTVRVWNYVEEEENGEDVWAQEA 265
           D +  A+ N  K         K   ++   + + SDD T+ +WN ++         ++  
Sbjct: 349 DAQARALRNYEK-------VAKKNGTMEELMVTGSDDFTMYLWNPLKG--------SKPI 393

Query: 266 ILPNVHSRAVYSVSWSLDG-YIASVGSD 292
           +    H + V  V++S DG YI S   D
Sbjct: 394 LRMTGHQKLVNHVAFSPDGRYIVSASFD 421

 Score = 37.0 bits (84), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 38/80 (47%), Gaps = 10/80 (12%)

Query: 212 AAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNYVEEEENGEDVWAQEAILPNVH 271
           ++ + GH  T+ CS F    SS R+ + + D+T R+W+         D       L   H
Sbjct: 134 SSAIAGHGATILCSAFAPHTSS-RMVTGAGDNTARIWDC--------DTQTPLCTLKG-H 183

Query: 272 SRAVYSVSWSLDGYIASVGS 291
           S  V  V+WS DG + + GS
Sbjct: 184 SNWVLCVAWSADGEVIATGS 203

>KLLA0C08547g 749737..751284 highly similar to sp|P25382
           Saccharomyces cerevisiae YCR072c, start by similarity
          Length = 515

 Score = 65.1 bits (157), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 45/160 (28%), Positives = 74/160 (46%), Gaps = 17/160 (10%)

Query: 91  ILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLASCSRD 150
           ++   S D T+ +W   +   P         +  + GH+  V  V++S  G Y+ S S D
Sbjct: 373 LMVTASDDFTMYLWNPLKSTKP---------ITRMTGHQKLVNHVAFSPDGRYIVSASFD 423

Query: 151 KSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDADDWE 210
            S+ +W+    G + + LS  + H   V  V W S+  LL S S D T+++W  D    +
Sbjct: 424 NSIKLWD----GRDGKFLSTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVW--DVKTRK 477

Query: 211 CAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNY 250
            +  L GH+  V+  D+  S    R+ S   D  VR+W +
Sbjct: 478 LSVDLPGHQDEVYTVDW--SVDGKRVCSGGKDKMVRIWTH 515

 Score = 61.6 bits (148), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 53/182 (29%), Positives = 85/182 (46%), Gaps = 26/182 (14%)

Query: 76  HKKSVRSVSFRPH-SSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKA 134
           H  ++   +F P+ SS +  G+ D+T  IW    D D Q        +  ++GH N V  
Sbjct: 142 HGSTILCSAFAPNTSSRMVTGAGDNTACIW----DCDTQ------TRMCTLQGHHNWVLC 191

Query: 135 VSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQ-------DVKHVVWHSEM 187
            SWS  G  +A+ S D ++ +WE+ + G+ Y     L+ H++       +  H+V   + 
Sbjct: 192 CSWSPDGELIATGSMDNTIRLWESSK-GKPYG--DALRGHSKWITSLSWEPIHLVKPGDK 248

Query: 188 HLLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRV 247
             LA++S D TI++W  D     C   L GH  +V C  +        L S S D T+R 
Sbjct: 249 PRLATASKDGTIKIW--DTTRRVCLLTLCGHTSSVSCVKWGGKNV---LYSGSHDKTIRC 303

Query: 248 WN 249
           W+
Sbjct: 304 WD 305

 Score = 54.7 bits (130), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 78/157 (49%), Gaps = 25/157 (15%)

Query: 144 LASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWK 203
           + + S D ++++W   +     + ++ +  H + V HV +  +   + S+S+D++I+LW 
Sbjct: 374 MVTASDDFTMYLWNPLK---STKPITRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLW- 429

Query: 204 EDADDWECAAVLNGHKGTV----WCSDFEKSESSLRLASCSDDSTVRVWNYVEEEENGED 259
            D  D +  +   GH  +V    W SD         L SCS D+T++VW+ V+  +   D
Sbjct: 430 -DGRDGKFLSTFRGHVASVYQVAWSSDCR------LLVSCSKDTTLKVWD-VKTRKLSVD 481

Query: 260 VWAQEAILPNVHSRAVYSVSWSLDG-YIASVGSDGLL 295
                  LP  H   VY+V WS+DG  + S G D ++
Sbjct: 482 -------LPG-HQDEVYTVDWSVDGKRVCSGGKDKMV 510

 Score = 31.6 bits (70), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 37/80 (46%), Gaps = 10/80 (12%)

Query: 212 AAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNYVEEEENGEDVWAQEAILPNVH 271
           ++ + GH  T+ CS F  + SS R+ + + D+T  +W+         D   +   L   H
Sbjct: 136 SSAIAGHGSTILCSAFAPNTSS-RMVTGAGDNTACIWDC--------DTQTRMCTLQG-H 185

Query: 272 SRAVYSVSWSLDGYIASVGS 291
              V   SWS DG + + GS
Sbjct: 186 HNWVLCCSWSPDGELIATGS 205

>Sklu_2431.12 YBR198C, Contig c2431 17817-20066 reverse complement
          Length = 749

 Score = 65.5 bits (158), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 72/269 (26%), Positives = 108/269 (40%), Gaps = 31/269 (11%)

Query: 85  FRPHSSILAAGSFDSTISIWGKEEDADPQDD-FPETELLAI----IEGHENEVKAVSWSH 139
           F   +++ AAG  DS I +W    D  P D   P  +   I    + GH   V + S+S 
Sbjct: 429 FSDDATLAAAGFQDSYIKLW--SLDGTPLDSKLPSKQREKINNTTLIGHSGTVYSTSFSP 486

Query: 140 SGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTI 199
              YL S S DK+V +W  D     Y  L   + H   V  V +    H  A++S+D T 
Sbjct: 487 DNKYLLSASEDKTVRLWSMD----TYSSLVSYKGHNHPVWDVSFSPLGHYFATASHDQTA 542

Query: 200 RLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNYVEEEENGED 259
           RLW    D      +  GH   V C  F  + + +   S   D T R+W          D
Sbjct: 543 RLW--SCDHIYPLRIFAGHLNDVDCVSFHPNGTYVFTGST--DKTCRMW----------D 588

Query: 260 VWAQEAI-LPNVHSRAVYSVSWSLDGYIASVGSDGLLXXXXXXXXXXXXXXXQQHEAHGI 318
           +   +++ L   H+  V S + S DG   S GS+  +               + H  + +
Sbjct: 589 IGTGDSVRLFLGHTAPVISTAVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAV 648

Query: 319 YEINVVKWATVDDSVLLLTGGDDGCANIW 347
           Y ++  K  TV     L++GG D    +W
Sbjct: 649 YSLSYSKEGTV-----LVSGGADHSVRVW 672

 Score = 62.4 bits (150), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 60/229 (26%), Positives = 102/229 (44%), Gaps = 32/229 (13%)

Query: 69  EELDDST---HKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAII 125
           E+++++T   H  +V S SF P +  L + S D T+ +W  +  +           L   
Sbjct: 465 EKINNTTLIGHSGTVYSTSFSPDNKYLLSASEDKTVRLWSMDTYSS----------LVSY 514

Query: 126 EGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHS 185
           +GH + V  VS+S  G+Y A+ S D++  +W  D +      L +   H  DV  V +H 
Sbjct: 515 KGHNHPVWDVSFSPLGHYFATASHDQTARLWSCDHI----YPLRIFAGHLNDVDCVSFHP 570

Query: 186 EMHLLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTV 245
               + + S D T R+W  D    +   +  GH   V  +    S     L++ S+D  +
Sbjct: 571 NGTYVFTGSTDKTCRMW--DIGTGDSVRLFLGHTAPVISTAV--SPDGRWLSTGSEDGII 626

Query: 246 RVWNYVEEEENGEDVWAQEAILPNVHSR-AVYSVSWSLDGYI-ASVGSD 292
            VW+       G+ +          H + AVYS+S+S +G +  S G+D
Sbjct: 627 NVWDI----GTGKRLKQMRG-----HGKNAVYSLSYSKEGTVLVSGGAD 666

>Scas_631.17
          Length = 474

 Score = 64.7 bits (156), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 58/227 (25%), Positives = 106/227 (46%), Gaps = 27/227 (11%)

Query: 26  LKSLKLHTDKLWSID--CSKGLMATSSSDRKIKLVNLKN-MDFQLVEELDDSTHKKSVRS 82
           L +L+ HT ++ ++D   S   +A++S D   +L ++++  + Q  E      H K V S
Sbjct: 268 LTALQGHTGRVVNVDFHPSGRFVASASFDMTWRLWDIESETELQFQE-----GHGKEVYS 322

Query: 83  VSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGY 142
           +SF+   ++L +G  D+   +W          D    + +  ++GH   + +V WS  GY
Sbjct: 323 LSFQNDGALLCSGGLDNAAIVW----------DVRTGKSIMNLQGHAKPIYSVDWSPDGY 372

Query: 143 YLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWH-SEMHLLASSSYDDTIRL 201
           ++A+   D  + IW+  +  E    L+    H   V  V +  S  H L S  YD  IR+
Sbjct: 373 HIATGGGDGVINIWDIRKTTETTRLLA----HNNIVTGVRFQKSTGHCLVSCGYDKQIRI 428

Query: 202 WKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVW 248
           +   +D+W     L GH   +   D + SE +  + S   D ++++W
Sbjct: 429 YS--SDNWIQVKTLEGHTDKIL--DVDISEDAQLIVSSGWDRSLKLW 471

 Score = 63.2 bits (152), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 65/224 (29%), Positives = 105/224 (46%), Gaps = 35/224 (15%)

Query: 83  VSFRPHS--------SILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIE-GHENEVK 133
           VS RP S        ++ A GS+   I I           D    ++++ IE GH+ ++ 
Sbjct: 184 VSIRPISKVCLMSDNALCATGSWAGDIKIL----------DTKTLDVISGIENGHDGKIG 233

Query: 134 AVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASS 193
            ++W+ +  +L S + D  V I   D   +  + L+ LQ H   V +V +H     +AS+
Sbjct: 234 GLAWNSTNTHLVSGADDCLVKIHSFDPDVKIIKELTALQGHTGRVVNVDFHPSGRFVASA 293

Query: 194 SYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNYVEE 253
           S+D T RLW  D +         GH   V+   F+ ++ +L L S   D+   VW     
Sbjct: 294 SFDMTWRLW--DIESETELQFQEGHGKEVYSLSFQ-NDGAL-LCSGGLDNAAIVW----- 344

Query: 254 EENGEDVWAQEAILP-NVHSRAVYSVSWSLDGY-IASVGSDGLL 295
                DV   ++I+    H++ +YSV WS DGY IA+ G DG++
Sbjct: 345 -----DVRTGKSIMNLQGHAKPIYSVDWSPDGYHIATGGGDGVI 383

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 69/168 (41%), Gaps = 24/168 (14%)

Query: 180 HVVWHSEMHLLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASC 239
           H+V  ++  L+   S+D  +++ KE          L GH G V   DF  S     +AS 
Sbjct: 243 HLVSGADDCLVKIHSFDPDVKIIKE-------LTALQGHTGRVVNVDFHPS--GRFVASA 293

Query: 240 SDDSTVRVWNYVEEEENGEDVWAQEAILPNVHSRAVYSVSWSLDGYIASVGSDGLLXXXX 299
           S D T R+W+   E E    +  QE      H + VYS+S+  DG +   G         
Sbjct: 294 SFDMTWRLWDIESETE----LQFQEG-----HGKEVYSLSFQNDGALLCSGGLDNAAIVW 344

Query: 300 XXXXXXXXXXXQQHEAHGIYEINVVKWATVDDSVLLLTGGDDGCANIW 347
                      Q H A  IY ++   W+   D   + TGG DG  NIW
Sbjct: 345 DVRTGKSIMNLQGH-AKPIYSVD---WSP--DGYHIATGGGDGVINIW 386

>Kwal_56.24596
          Length = 294

 Score = 63.9 bits (154), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 73/263 (27%), Positives = 111/263 (42%), Gaps = 37/263 (14%)

Query: 46  MATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSV--SFRPHSSILAAGSFDSTISI 103
           +AT SSD+ IK+  ++    +LVE L    H+  V  V  +      ILA+ S+D  + I
Sbjct: 24  LATCSSDKTIKIFEVEGETHKLVETLHG--HEGPVWQVDWAHPKFGVILASCSYDGKVLI 81

Query: 104 WGKEEDADPQDDFPETELLAIIEGHENEVKAVSWS--HSGYYLASCSRDKSVWIWEADEL 161
           W +E     Q        +A+   H   V +V W+    G  L + S D  V + E  E 
Sbjct: 82  WKEENGRWTQ--------IAVHAVHSASVNSVQWAPHEYGPLLLAASSDGKVSVVEFKEN 133

Query: 162 GEEYECLSVLQEHAQDVKHVVWHS----------EMHLLASSSYDDTIRLWK--EDADDW 209
           G     L  +  H+  V    W S          +M    +   D+ +++WK   DA+ +
Sbjct: 134 GTTSPIL--VDAHSIGVNTASWASAALQGGAVSQQMRRFVTGGADNLVKVWKFNPDANTY 191

Query: 210 ECAAVLNGHKGTVWCSDFEKSESSL---RLASCSDDSTVRVWNYVEEEENGEDVWAQEAI 266
                L GH  T W  D   S S L    LAS S D T  +W     +EN +  W +  +
Sbjct: 192 LLEDTLEGH--TDWVRDVAWSPSVLLRSYLASVSQDRTCIIWT----QENNQGPWKKTLL 245

Query: 267 LPNVHSRAVYSVSWSLDGYIASV 289
             +  S  ++  SWSL G I ++
Sbjct: 246 KEDKFSDVLWRASWSLSGNILAL 268

 Score = 60.5 bits (145), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 51/163 (31%), Positives = 75/163 (46%), Gaps = 11/163 (6%)

Query: 121 LLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKH 180
           ++ I   H   +      + G  LA+CS DK++ I+E +  GE ++ +  L  H   V  
Sbjct: 1   MVTITNAHTELIHDAVLDYYGKRLATCSSDKTIKIFEVE--GETHKLVETLHGHEGPVWQ 58

Query: 181 VVW-HSEMH-LLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLAS 238
           V W H +   +LAS SYD  + +WKE+   W   AV   H  +V    +   E    L +
Sbjct: 59  VDWAHPKFGVILASCSYDGKVLIWKEENGRWTQIAVHAVHSASVNSVQWAPHEYGPLLLA 118

Query: 239 CSDDSTVRVWNYVEEEENGEDVWAQEAILPNVHSRAVYSVSWS 281
            S D  V V   VE +ENG        IL + HS  V + SW+
Sbjct: 119 ASSDGKVSV---VEFKENG----TTSPILVDAHSIGVNTASWA 154

 Score = 56.2 bits (134), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 50/169 (29%), Positives = 76/169 (44%), Gaps = 21/169 (12%)

Query: 190 LASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWN 249
           LA+ S D TI++++ + +  +    L+GH+G VW  D+   +  + LASCS D  V +W 
Sbjct: 24  LATCSSDKTIKIFEVEGETHKLVETLHGHEGPVWQVDWAHPKFGVILASCSYDGKVLIW- 82

Query: 250 YVEEEENGEDVWAQEAILPNVHSRAVYSVSWSLDGY---IASVGSDGLLXXXXXXXXXXX 306
              +EENG   W Q A+   VHS +V SV W+   Y   + +  SDG +           
Sbjct: 83  ---KEENGR--WTQIAVHA-VHSASVNSVQWAPHEYGPLLLAASSDGKVSVVEFKENGTT 136

Query: 307 XXXXQQHEAHGIYEINVVKWATV--------DDSVLLLTGGDDGCANIW 347
                  +AH I  +N   WA+               +TGG D    +W
Sbjct: 137 SPILV--DAHSI-GVNTASWASAALQGGAVSQQMRRFVTGGADNLVKVW 182

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 47/183 (25%), Positives = 80/183 (43%), Gaps = 21/183 (11%)

Query: 45  LMATSSSDRKIKLVNLKN--------MDFQLVEELDDSTHKKSVRSVSFRPHSSILAAGS 96
           L+  +SSD K+ +V  K         +D   +     S    +++  +          G 
Sbjct: 115 LLLAASSDGKVSVVEFKENGTTSPILVDAHSIGVNTASWASAALQGGAVSQQMRRFVTGG 174

Query: 97  FDSTISIWGKEEDADPQDDFPETELLA-IIEGHENEVKAVSWSHSGY---YLASCSRDKS 152
            D+ + +W    DA+       T LL   +EGH + V+ V+WS S     YLAS S+D++
Sbjct: 175 ADNLVKVWKFNPDAN-------TYLLEDTLEGHTDWVRDVAWSPSVLLRSYLASVSQDRT 227

Query: 153 VWIWEADELGEEYECLSVLQEHAQDVK-HVVWHSEMHLLASSSYDDTIRLWKEDAD-DWE 210
             IW  +     ++   + ++   DV     W    ++LA S  D+ + LWKE+ +  WE
Sbjct: 228 CIIWTQENNQGPWKKTLLKEDKFSDVLWRASWSLSGNILALSGGDNKVTLWKENLEGKWE 287

Query: 211 CAA 213
            A 
Sbjct: 288 PAG 290

>Sklu_2173.2 YCR072C, Contig c2173 2732-4279
          Length = 515

 Score = 63.9 bits (154), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 45/160 (28%), Positives = 73/160 (45%), Gaps = 17/160 (10%)

Query: 91  ILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLASCSRD 150
           ++   S D T+ +W   +   P         +  + GH+  V  V++S  G ++ S S D
Sbjct: 373 LMVTASDDFTMYLWNPLKSTKP---------ITRMTGHQKLVNHVAFSPDGRHIVSASFD 423

Query: 151 KSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDADDWE 210
            S+ +W     G + + +S  + H   V  V W S+  LL S S D T+++W  D    +
Sbjct: 424 NSIKLWN----GRDGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVW--DVKTKK 477

Query: 211 CAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNY 250
            A  L GHK  V+  D+  S    R+ S   D  VR+W +
Sbjct: 478 LAVDLPGHKDEVYTVDW--SVDGKRVCSGGKDKMVRLWTH 515

 Score = 63.9 bits (154), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 54/182 (29%), Positives = 86/182 (47%), Gaps = 26/182 (14%)

Query: 76  HKKSVRSVSFRPH-SSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKA 134
           H  ++   +F PH SS +  G+ D+T  IW    D + Q        ++ ++GH N V  
Sbjct: 142 HGSTILCSAFAPHTSSRMITGAGDNTARIW----DCNTQTP------MSTLKGHFNWVLC 191

Query: 135 VSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQ-------DVKHVVWHSEM 187
           VSWS  G  +A+ S D ++ +WE ++ G+       L+ H +       +  H+V   + 
Sbjct: 192 VSWSPDGELIATGSMDNTIRLWEGNK-GQPVG--DALRGHGKWITSLSWEPIHLVKPGQK 248

Query: 188 HLLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRV 247
             LAS+S D TI++W  D     C   L+GH  +V C  +        L S S D T+R 
Sbjct: 249 PRLASASKDGTIKIW--DTTRRVCLITLSGHTSSVSCIKWGGQGV---LYSGSHDKTIRA 303

Query: 248 WN 249
           W+
Sbjct: 304 WD 305

 Score = 55.1 bits (131), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 43/160 (26%), Positives = 72/160 (45%), Gaps = 21/160 (13%)

Query: 45  LMATSSSDRKIKLVNLKNMDFQLVEELDDST-HKKSVRSVSFRPHSSILAAGSFDSTISI 103
           LM T+S D  + L N      +  + +   T H+K V  V+F P    + + SFD++I +
Sbjct: 373 LMVTASDDFTMYLWN----PLKSTKPITRMTGHQKLVNHVAFSPDGRHIVSASFDNSIKL 428

Query: 104 WGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGE 163
           W   +           + ++   GH   V  V+WS     L SCS+D ++ +W+      
Sbjct: 429 WNGRDG----------KFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDV----- 473

Query: 164 EYECLSV-LQEHAQDVKHVVWHSEMHLLASSSYDDTIRLW 202
           + + L+V L  H  +V  V W  +   + S   D  +RLW
Sbjct: 474 KTKKLAVDLPGHKDEVYTVDWSVDGKRVCSGGKDKMVRLW 513

 Score = 53.9 bits (128), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 43/157 (27%), Positives = 79/157 (50%), Gaps = 25/157 (15%)

Query: 144 LASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWK 203
           + + S D ++++W   +     + ++ +  H + V HV +  +   + S+S+D++I+LW 
Sbjct: 374 MVTASDDFTMYLWNPLK---STKPITRMTGHQKLVNHVAFSPDGRHIVSASFDNSIKLW- 429

Query: 204 EDADDWECAAVLNGHKGTV----WCSDFEKSESSLRLASCSDDSTVRVWNYVEEEENGED 259
            +  D +  +   GH  +V    W SD         L SCS D+T++VW+ V+ ++   D
Sbjct: 430 -NGRDGKFISTFRGHVASVYQVAWSSDCR------LLVSCSKDTTLKVWD-VKTKKLAVD 481

Query: 260 VWAQEAILPNVHSRAVYSVSWSLDG-YIASVGSDGLL 295
                  LP  H   VY+V WS+DG  + S G D ++
Sbjct: 482 -------LPG-HKDEVYTVDWSVDGKRVCSGGKDKMV 510

 Score = 34.3 bits (77), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 38/80 (47%), Gaps = 10/80 (12%)

Query: 212 AAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNYVEEEENGEDVWAQEAILPNVH 271
           ++ + GH  T+ CS F    SS R+ + + D+T R+W+         +     + L   H
Sbjct: 136 SSAIAGHGSTILCSAFAPHTSS-RMITGAGDNTARIWDC--------NTQTPMSTLKG-H 185

Query: 272 SRAVYSVSWSLDGYIASVGS 291
              V  VSWS DG + + GS
Sbjct: 186 FNWVLCVSWSPDGELIATGS 205

>ADL184W [1557] [Homologous to ScYNL317W (PFS2) - SH]
           complement(375532..376881) [1350 bp, 449 aa]
          Length = 449

 Score = 62.8 bits (151), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 57/213 (26%), Positives = 100/213 (46%), Gaps = 23/213 (10%)

Query: 37  WSIDCSKGLMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSVSFRPHSSILAAGS 96
           W+ +  + ++AT S +    L N  + +F+ + +  DS    +V  + +      L +G 
Sbjct: 87  WTPEGRRLVVATYSGE--FSLWNGSSFNFESIMQAHDS----AVTVMQYSHAGDWLISGD 140

Query: 97  FDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIW 156
            D TI IW        Q +F   ++L     H   ++ +S+S+S     +CS D  + IW
Sbjct: 141 ADGTIKIW--------QPNFNMVKVLD--RAHTECMRDISFSYSDQKFVTCSDDNVLKIW 190

Query: 157 EADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDADDWECAAVLN 216
                 +E     VL  H  DVK   WH +M L+ S S D+ I+LW  D       + + 
Sbjct: 191 NFSNGQQE----RVLSGHHWDVKSCDWHPKMGLIVSGSKDNLIKLW--DPRTGRNVSTIL 244

Query: 217 GHKGTVWCSDFEKSESSLRLASCSDDSTVRVWN 249
           G K TV  + F+ ++ +L LA  S D ++++++
Sbjct: 245 GLKHTVIKTKFQPTQGNL-LAVVSKDKSIKIYD 276

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/165 (25%), Positives = 70/165 (42%), Gaps = 18/165 (10%)

Query: 132 VKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLA 191
           + A++W+  G  L   +      +W     G  +   S++Q H   V  + +      L 
Sbjct: 82  IPAITWTPEGRRLVVATYSGEFSLWN----GSSFNFESIMQAHDSAVTVMQYSHAGDWLI 137

Query: 192 SSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNYV 251
           S   D TI++W+ +   +    VL+    T    D   S S  +  +CSDD+ +++WN+ 
Sbjct: 138 SGDADGTIKIWQPN---FNMVKVLD-RAHTECMRDISFSYSDQKFVTCSDDNVLKIWNF- 192

Query: 252 EEEENGEDVWAQEAILPNVHSRAVYSVSWSLD-GYIASVGSDGLL 295
               NG+    QE +L + H   V S  W    G I S   D L+
Sbjct: 193 ---SNGQ----QERVL-SGHHWDVKSCDWHPKMGLIVSGSKDNLI 229

 Score = 35.8 bits (81), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 33/64 (51%), Gaps = 4/64 (6%)

Query: 76  HKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQ--DD--FPETELLAIIEGHENE 131
           H+KSV S+++ P   ILA+ + D TI  W +    DP   DD  +   ++ A   G  N 
Sbjct: 338 HEKSVTSLAYSPVGHILASAAKDRTIRFWARSRPVDPNAFDDPTYNNKKVNAWYFGINNN 397

Query: 132 VKAV 135
           + AV
Sbjct: 398 INAV 401

 Score = 35.0 bits (79), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 28/113 (24%), Positives = 54/113 (47%), Gaps = 9/113 (7%)

Query: 45  LMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSVSFRP-HSSILAAGSFDSTISI 103
           L+A  S D+ IK+ +++    Q + EL          S+S+ P + +I + G ++  I  
Sbjct: 262 LLAVVSKDKSIKIYDMR----QHMRELQTIRDDMDYMSLSWHPINETIFSVGCYNGAIKH 317

Query: 104 WGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIW 156
           +    D    +  P      I   HE  V ++++S  G+ LAS ++D+++  W
Sbjct: 318 FDLLHDN--SNSTPACH--TIPYAHEKSVTSLAYSPVGHILASAAKDRTIRFW 366

 Score = 33.1 bits (74), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 42/202 (20%), Positives = 71/202 (35%), Gaps = 58/202 (28%)

Query: 46  MATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSVSFRPHSSILAAGSFDSTISIWG 105
             T S D  +K+ N  N      +E   S H   V+S  + P   ++ +GS D+ I +W 
Sbjct: 178 FVTCSDDNVLKIWNFSNGQ----QERVLSGHHWDVKSCDWHPKMGLIVSGSKDNLIKLW- 232

Query: 106 KEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEY 165
                DP+     + +L +       +K       G  LA  S+DKS+ I++  +   E 
Sbjct: 233 -----DPRTGRNVSTILGL---KHTVIKTKFQPTQGNLLAVVSKDKSIKIYDMRQHMREL 284

Query: 166 E---------------------------------------------CLSVLQEHAQDVKH 180
           +                                             C ++   H + V  
Sbjct: 285 QTIRDDMDYMSLSWHPINETIFSVGCYNGAIKHFDLLHDNSNSTPACHTIPYAHEKSVTS 344

Query: 181 VVWHSEMHLLASSSYDDTIRLW 202
           + +    H+LAS++ D TIR W
Sbjct: 345 LAYSPVGHILASAAKDRTIRFW 366

>Scas_713.50
          Length = 983

 Score = 63.5 bits (153), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 63/242 (26%), Positives = 97/242 (40%), Gaps = 42/242 (17%)

Query: 32  HTDKLWSIDCSK--GLMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVR-------- 81
           H   +WS+D +     + T S+D+ +K  N     FQL +EL   T  K V         
Sbjct: 510 HDAAIWSLDLTSDGKRLITGSADKSVKFWN-----FQLEQELVPGTSDKFVPKLGLHHDT 564

Query: 82  ---------SVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEV 132
                    SV   P    LA    D+T+ ++               +    + GH+  V
Sbjct: 565 TLELSDDILSVRVSPEDKFLAVSLLDNTVKVFF----------LDSMKFFLSLYGHKLPV 614

Query: 133 KAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLAS 192
            ++  S     + + S DK++ IW  D  G+ ++ L   Q+   +VK V    E H   S
Sbjct: 615 LSIDISFDSKMIITSSADKNIKIWGLD-FGDCHKSLFAHQDSIMNVKFV---PESHNFFS 670

Query: 193 SSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNYVE 252
            S D  I+ W  D D +EC   L  H+  VW        S   + S S D ++R+W   E
Sbjct: 671 CSKDGIIKYW--DGDKFECIQKLAAHQSEVWALAIANDASF--VVSSSHDHSIRIWEETE 726

Query: 253 EE 254
           +E
Sbjct: 727 DE 728

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 42/171 (24%), Positives = 70/171 (40%), Gaps = 33/171 (19%)

Query: 89  SSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLASCS 148
           +++LA G  D  + +W          D     +L  + GH + + A+ +  SG  L S S
Sbjct: 118 TNLLAVGYNDGVVKVW----------DLYSKTVLCNLNGHSSAITALKFDTSGTRLISGS 167

Query: 149 RDKSVWIWE-ADELGEEYECLSVLQEHAQDVKHVVW----------HSEMHLLASSSYDD 197
           RD ++ +W+   E+G     L  L+ H +D    +W           +E+  L S+S D 
Sbjct: 168 RDSNIIVWDLVSEVG-----LYKLRSH-KDAITGIWCNEVTNNNQEENELDWLISTSKDG 221

Query: 198 TIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVW 248
            I++W  D    +C      H G  W            + + S DS V+ W
Sbjct: 222 LIKIW--DLKIQQCVETHIAHTGECWSLAVRND----LVITTSSDSQVKFW 266

 Score = 30.8 bits (68), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 62/142 (43%), Gaps = 16/142 (11%)

Query: 119 TELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWE---ADEL--GEEYECLSVLQE 173
           T++  I E H+  + ++  +  G  L + S DKSV  W      EL  G   + +  L  
Sbjct: 501 TQIANIEEAHDAAIWSLDLTSDGKRLITGSADKSVKFWNFQLEQELVPGTSDKFVPKLGL 560

Query: 174 H-------AQDVKHVVWHSEMHLLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSD 226
           H       + D+  V    E   LA S  D+T++++  D+  +  +  L GHK  V   D
Sbjct: 561 HHDTTLELSDDILSVRVSPEDKFLAVSLLDNTVKVFFLDSMKFFLS--LYGHKLPVLSID 618

Query: 227 FEKSESSLRLASCSDDSTVRVW 248
              S  S  + + S D  +++W
Sbjct: 619 I--SFDSKMIITSSADKNIKIW 638

>CAGL0M05335g complement(569132..571552) similar to sp|P38129
           Saccharomyces cerevisiae YBR198c Transcription
           initiation factor TFIID 90, hypothetical start
          Length = 806

 Score = 63.2 bits (152), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 66/255 (25%), Positives = 101/255 (39%), Gaps = 46/255 (18%)

Query: 8   LYTFSHKHTRLQRMSLELLKSLKLHTD-------KLWSIDCSKGLMATSSSDRKIKLVNL 60
           +YTF   +T     SLE     +L          K+WS+D S              L+N 
Sbjct: 466 MYTF--HNTNRDMTSLEFSDDCRLAAAGFQDSYIKIWSLDGSS-------------LINP 510

Query: 61  KNMDFQLVEELDDST------HKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQD 114
           K    Q      D+T      H  +V S SF P +  L +GS D T+ +W  +       
Sbjct: 511 KYSSSQFDRFSQDNTCSTLVGHSGTVYSTSFSPDNMYLVSGSEDKTVKLWSMDTHT---- 566

Query: 115 DFPETELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEH 174
                  L   +GH + V  V +S  G+Y AS S D++  +W  D +      L +   H
Sbjct: 567 ------ALVNYKGHNHPVWDVKFSPLGHYFASASHDQTARLWACDHI----YPLRIFAGH 616

Query: 175 AQDVKHVVWHSEMHLLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSL 234
             DV  V +H     + + S D T R+W  D    +   +  GH   V  +  + S    
Sbjct: 617 TNDVDTVSFHPNGCYVFTGSSDKTCRMW--DVSTGDSVRLFLGHTAPVLST--QVSPDGR 672

Query: 235 RLASCSDDSTVRVWN 249
            LA+ S+D  + +W+
Sbjct: 673 WLATGSEDGVICLWD 687

 Score = 56.2 bits (134), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 69/279 (24%), Positives = 110/279 (39%), Gaps = 32/279 (11%)

Query: 78  KSVRSVSFRPHSSILAAGSFDSTISIWGKEEDA--DPQ------DDFPETELLAIIEGHE 129
           + + S+ F     + AAG  DS I IW  +  +  +P+      D F +    + + GH 
Sbjct: 474 RDMTSLEFSDDCRLAAAGFQDSYIKIWSLDGSSLINPKYSSSQFDRFSQDNTCSTLVGHS 533

Query: 130 NEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHL 189
             V + S+S    YL S S DK+V +W  D     +  L   + H   V  V +    H 
Sbjct: 534 GTVYSTSFSPDNMYLVSGSEDKTVKLWSMD----THTALVNYKGHNHPVWDVKFSPLGHY 589

Query: 190 LASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWN 249
            AS+S+D T RLW    D      +  GH   V    F    +   + + S D T R+W 
Sbjct: 590 FASASHDQTARLWA--CDHIYPLRIFAGHTNDVDTVSFH--PNGCYVFTGSSDKTCRMW- 644

Query: 250 YVEEEENGEDVWAQEAI-LPNVHSRAVYSVSWSLDGYIASVGSDGLLXXXXXXXXXXXXX 308
                    DV   +++ L   H+  V S   S DG   + GS+  +             
Sbjct: 645 ---------DVSTGDSVRLFLGHTAPVLSTQVSPDGRWLATGSEDGVICLWDIGTGKRIK 695

Query: 309 XXQQHEAHGIYEINVVKWATVDDSVLLLTGGDDGCANIW 347
             + H  + ++ ++  K   V     L++GG D    +W
Sbjct: 696 QMRGHGKNAVHSLSFNKEGNV-----LISGGADHSVRVW 729

>Sklu_2416.5 YNL317W, Contig c2416 8692-10071
          Length = 459

 Score = 62.4 bits (150), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 56/213 (26%), Positives = 99/213 (46%), Gaps = 23/213 (10%)

Query: 37  WSIDCSKGLMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSVSFRPHSSILAAGS 96
           W+ +  + ++AT S +    L N    +F+ + +  DS    +V ++ +      L +G 
Sbjct: 89  WTPEGRRLVVATYSGE--FSLWNGSTFNFESIMQAHDS----AVTTMEYSHAGDWLISGD 142

Query: 97  FDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIW 156
            D  I IW        Q +F   ++L   + H   V+ VS+S +     +CS D  + IW
Sbjct: 143 SDGIIKIW--------QPNFNMVKVLD--QAHMECVRDVSFSGTDSKFVTCSDDNILKIW 192

Query: 157 EADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDADDWECAAVLN 216
                 +E     VL  H  DVK   WH  M L+ S S D+ I+LW  D    +C + + 
Sbjct: 193 NFSNGQQE----RVLSGHHWDVKSCDWHPTMGLIVSGSKDNLIKLW--DPRSGQCISTIL 246

Query: 217 GHKGTVWCSDFEKSESSLRLASCSDDSTVRVWN 249
           G K T+  + F+ ++ +L LA  + D + ++++
Sbjct: 247 GFKHTIIKTKFQPTKGNL-LAVVAKDKSCKIFD 278

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 41/166 (24%), Positives = 70/166 (42%), Gaps = 20/166 (12%)

Query: 132 VKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLA 191
           + A+ W+  G  L   +      +W     G  +   S++Q H   V  + +      L 
Sbjct: 84  IPAIKWTPEGRRLVVATYSGEFSLWN----GSTFNFESIMQAHDSAVTTMEYSHAGDWLI 139

Query: 192 SSSYDDTIRLWKEDADDWECAAVLN-GHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNY 250
           S   D  I++W+ +   +    VL+  H   V    F  ++S  +  +CSDD+ +++WN+
Sbjct: 140 SGDSDGIIKIWQPN---FNMVKVLDQAHMECVRDVSFSGTDS--KFVTCSDDNILKIWNF 194

Query: 251 VEEEENGEDVWAQEAILPNVHSRAVYSVSW-SLDGYIASVGSDGLL 295
                NG+    QE +L + H   V S  W    G I S   D L+
Sbjct: 195 ----SNGQ----QERVL-SGHHWDVKSCDWHPTMGLIVSGSKDNLI 231

 Score = 35.4 bits (80), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 27/117 (23%), Positives = 60/117 (51%), Gaps = 11/117 (9%)

Query: 42  SKG-LMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSVSFRP-HSSILAAGSFDS 99
           +KG L+A  + D+  K+ +++    Q ++EL     +    S+++ P + SI   G +D 
Sbjct: 260 TKGNLLAVVAKDKSCKIFDIR----QNMKELKSFRDESDYMSLTWHPINESIFTVGCYDG 315

Query: 100 TISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIW 156
           ++  +   +D    + F +     I   H+  + ++S++  G+ LAS S+D+++  W
Sbjct: 316 SLKHFDLLQDTGSSNSFHD-----IPYAHDKCITSLSYNPVGHILASASKDRTIRFW 367

 Score = 33.5 bits (75), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 31/64 (48%), Gaps = 4/64 (6%)

Query: 76  HKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQ--DD--FPETELLAIIEGHENE 131
           H K + S+S+ P   ILA+ S D TI  W +    DP   DD  +   ++ A   G  N 
Sbjct: 339 HDKCITSLSYNPVGHILASASKDRTIRFWTRSRPMDPNAFDDPTYNNKKVNAWYFGINNN 398

Query: 132 VKAV 135
           + AV
Sbjct: 399 INAV 402

 Score = 32.3 bits (72), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 51/230 (22%), Positives = 87/230 (37%), Gaps = 60/230 (26%)

Query: 64  DFQLVEELDDSTHKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLA 123
           +F +V+ LD + H + VR VSF    S     S D+ + IW          +F   +   
Sbjct: 153 NFNMVKVLDQA-HMECVRDVSFSGTDSKFVTCSDDNILKIW----------NFSNGQQER 201

Query: 124 IIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLS-VLQEHAQDVKHVV 182
           ++ GH  +VK+  W  +   + S S+D  + +W+        +C+S +L      +K   
Sbjct: 202 VLSGHHWDVKSCDWHPTMGLIVSGSKDNLIKLWDP----RSGQCISTILGFKHTIIKTKF 257

Query: 183 WHSEMHLLASSSYDDTIRLWK-----------EDADDWECAA--VLNGHKGTVWCSD--- 226
             ++ +LLA  + D + +++             D  D+       +N    TV C D   
Sbjct: 258 QPTKGNLLAVVAKDKSCKIFDIRQNMKELKSFRDESDYMSLTWHPINESIFTVGCYDGSL 317

Query: 227 ---------------------FEKSESSLR-------LASCSDDSTVRVW 248
                                 +K  +SL        LAS S D T+R W
Sbjct: 318 KHFDLLQDTGSSNSFHDIPYAHDKCITSLSYNPVGHILASASKDRTIRFW 367

>KLLA0E07073g 645766..647124 similar to sp|P42841 Saccharomyces
           cerevisiae YNL317w PFS2 polyadenylation factor I subunit
           2 required for mRNA 3 -end processing, bridges two mRNA
           3 -end processing factors singleton, start by similarity
          Length = 452

 Score = 62.0 bits (149), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 45/164 (27%), Positives = 77/164 (46%), Gaps = 17/164 (10%)

Query: 92  LAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLASCSRDK 151
           + +GS D  + IW        Q +F   +++   + H   V+ +S+S +     SCS D 
Sbjct: 138 MVSGSADGELKIW--------QPNFNMVKVMD--QAHMECVREISFSPTDQKFVSCSDDN 187

Query: 152 SVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDADDWEC 211
            + IW      +E     VL  H  DVK   WH +M L+ S S D+ I+ W  D     C
Sbjct: 188 VLKIWNFSNGQQE----RVLSGHHWDVKSCDWHPKMGLIVSGSKDNLIKFW--DPRSGSC 241

Query: 212 AAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNYVEEEE 255
            + + G K T+  + F+  + +L L+  S D T +V++  ++ +
Sbjct: 242 VSTMLGFKHTIISTKFQPKQGNL-LSVISKDKTCKVYDIRQQAK 284

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 40/166 (24%), Positives = 72/166 (43%), Gaps = 20/166 (12%)

Query: 132 VKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLA 191
           + A++W+  G  L   + +    +W     G  +   S++Q H   V  + +      + 
Sbjct: 84  IPALTWTPEGRRLVVATYNGEFSLWS----GSSFNFESIMQAHDSAVTVMTYSHTGDWMV 139

Query: 192 SSSYDDTIRLWKEDADDWECAAVLN-GHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNY 250
           S S D  +++W+ +   +    V++  H   V    F  S +  +  SCSDD+ +++WN+
Sbjct: 140 SGSADGELKIWQPN---FNMVKVMDQAHMECVREISF--SPTDQKFVSCSDDNVLKIWNF 194

Query: 251 VEEEENGEDVWAQEAILPNVHSRAVYSVSWSLD-GYIASVGSDGLL 295
                NG+    QE +L + H   V S  W    G I S   D L+
Sbjct: 195 ----SNGQ----QERVL-SGHHWDVKSCDWHPKMGLIVSGSKDNLI 231

 Score = 33.5 bits (75), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 26/113 (23%), Positives = 54/113 (47%), Gaps = 10/113 (8%)

Query: 45  LMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSVSFRP-HSSILAAGSFDSTISI 103
           L++  S D+  K+ +++    +L    DD  +     ++ + P   ++   G +D +I  
Sbjct: 264 LLSVISKDKTCKVYDIRQQAKELFSVRDDVDY----MTLQWHPIDETVFTVGCYDGSI-- 317

Query: 104 WGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIW 156
             K  D   Q++ P      I   HE  V ++++S  G+ +AS S+D+++  W
Sbjct: 318 --KHFDLS-QENQPNKPTHNIPYAHEKCVTSLAYSPIGHIMASASKDRTIRFW 367

 Score = 32.3 bits (72), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 21/38 (55%)

Query: 76  HKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQ 113
           H+K V S+++ P   I+A+ S D TI  W +    DP 
Sbjct: 339 HEKCVTSLAYSPIGHIMASASKDRTIRFWTRSRAVDPN 376

>YNL317W (PFS2) [4296] chr14 (40618..42015) Polyadenylation factor I
           subunit 2 required for mRNA 3'-end processing, bridges
           two mRNA 3'-end processing factors, has WD (WD-40)
           repeats [1398 bp, 465 aa]
          Length = 465

 Score = 61.6 bits (148), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 56/213 (26%), Positives = 100/213 (46%), Gaps = 23/213 (10%)

Query: 37  WSIDCSKGLMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSVSFRPHSSILAAGS 96
           W+ +  + ++AT S +    L N  +  F+ + +  DS    +V ++ +   S  + +G 
Sbjct: 101 WTPEGRRLVVATYSGE--FSLWNASSFTFETLMQAHDS----AVTTMKYSHDSDWMISGD 154

Query: 97  FDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIW 156
            D  I IW        Q +F  + +  I   H   ++ +++S +     +CS D  + IW
Sbjct: 155 ADGMIKIW--------QPNF--SMVKEIDAAHTESIRDMAFSSNDSKFVTCSDDNILKIW 204

Query: 157 EADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDADDWECAAVLN 216
                 +E     VL  H  DVK   WH EM L+AS+S D+ ++LW  D     C + + 
Sbjct: 205 NFSNGKQE----RVLSGHHWDVKSCDWHPEMGLIASASKDNLVKLW--DPRSGNCISSIL 258

Query: 217 GHKGTVWCSDFEKSESSLRLASCSDDSTVRVWN 249
             K TV  + F+ ++ +L L + S D + RV++
Sbjct: 259 KFKHTVLKTRFQPTKGNL-LMAISKDKSCRVFD 290

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 71/165 (43%), Gaps = 18/165 (10%)

Query: 132 VKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLA 191
           + A+ W+  G  L   +      +W A     E    +++Q H   V  + +  +   + 
Sbjct: 96  IPAIQWTPEGRRLVVATYSGEFSLWNASSFTFE----TLMQAHDSAVTTMKYSHDSDWMI 151

Query: 192 SSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNYV 251
           S   D  I++W+ +        +   H  ++    F  ++S  +  +CSDD+ +++WN+ 
Sbjct: 152 SGDADGMIKIWQPNFS--MVKEIDAAHTESIRDMAFSSNDS--KFVTCSDDNILKIWNF- 206

Query: 252 EEEENGEDVWAQEAILPNVHSRAVYSVSWSLD-GYIASVGSDGLL 295
               NG+    QE +L + H   V S  W  + G IAS   D L+
Sbjct: 207 ---SNGK----QERVL-SGHHWDVKSCDWHPEMGLIASASKDNLV 243

 Score = 32.7 bits (73), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 25/55 (45%), Gaps = 6/55 (10%)

Query: 65  FQLVEELDDS------THKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQ 113
           F L++ L++        H K + S+S+ P   I A  + D TI  W +    DP 
Sbjct: 332 FDLLQNLNEPILTIPYAHDKCITSLSYNPVGHIFATAAKDRTIRFWTRARPIDPN 386

>YBR198C (TAF5) [381] chr2 complement(616084..618480) Component of
           the TAF(II) complex (TBP-associated protein complex) and
           SAGA complex (Spt-Ada-Gcn5-acetyltransferase), required
           for activated transcription by RNA polymerase II, member
           of WD (WD-40) repeat family [2397 bp, 798 aa]
          Length = 798

 Score = 61.6 bits (148), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 60/223 (26%), Positives = 98/223 (43%), Gaps = 37/223 (16%)

Query: 76  HKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAV 135
           H  +V S SF P +  L +GS D T+ +W  +           T L++  +GH + V  V
Sbjct: 524 HSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDT---------HTALVSY-KGHNHPVWDV 573

Query: 136 SWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSY 195
           S+S  G+Y A+ S D++  +W  D +      L +   H  DV  V +H     + + S 
Sbjct: 574 SFSPLGHYFATASHDQTARLWSCDHI----YPLRIFAGHLNDVDCVSFHPNGCYVFTGSS 629

Query: 196 DDTIRLWKEDADDWECAAVLNGHKGTVW----CSDFEKSESSLRLASCSDDSTVRVWNYV 251
           D T R+W  D    +   +  GH   V     C D         L++ S+D  + VW+  
Sbjct: 630 DKTCRMW--DVSTGDSVRLFLGHTAPVISIAVCPD------GRWLSTGSEDGIINVWDI- 680

Query: 252 EEEENGEDVWAQEAILPNVHSR-AVYSVSWSLDGYI-ASVGSD 292
                G+ +          H + A+YS+S+S +G +  S G+D
Sbjct: 681 ---GTGKRLKQMRG-----HGKNAIYSLSYSKEGNVLISGGAD 715

 Score = 59.3 bits (142), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 70/273 (25%), Positives = 103/273 (37%), Gaps = 47/273 (17%)

Query: 91  ILAAGSFDSTISIWG---------------KEEDADPQDDFPETELLAIIEGHENEVKAV 135
           I AAG  DS I IW                 ++D DP            + GH   V + 
Sbjct: 480 IAAAGFQDSYIKIWSLDGSSLNNPNIALNNNDKDEDPT--------CKTLVGHSGTVYST 531

Query: 136 SWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSY 195
           S+S    YL S S DK+V +W  D     +  L   + H   V  V +    H  A++S+
Sbjct: 532 SFSPDNKYLLSGSEDKTVRLWSMD----THTALVSYKGHNHPVWDVSFSPLGHYFATASH 587

Query: 196 DDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNYVEEEE 255
           D T RLW    D      +  GH   V C  F    +   + + S D T R+W       
Sbjct: 588 DQTARLW--SCDHIYPLRIFAGHLNDVDCVSFH--PNGCYVFTGSSDKTCRMW------- 636

Query: 256 NGEDVWAQEAI-LPNVHSRAVYSVSWSLDGYIASVGSDGLLXXXXXXXXXXXXXXXQQHE 314
              DV   +++ L   H+  V S++   DG   S GS+  +               + H 
Sbjct: 637 ---DVSTGDSVRLFLGHTAPVISIAVCPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHG 693

Query: 315 AHGIYEINVVKWATVDDSVLLLTGGDDGCANIW 347
            + IY ++  K   V     L++GG D    +W
Sbjct: 694 KNAIYSLSYSKEGNV-----LISGGADHTVRVW 721

>CAGL0C03608g 360681..362612 similar to sp|P16649 Saccharomyces
           cerevisiae YCR084c TUP1 general transcription repressor,
           hypothetical start
          Length = 643

 Score = 61.6 bits (148), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 62/258 (24%), Positives = 111/258 (43%), Gaps = 35/258 (13%)

Query: 9   YTFSHKHTRLQRMSLELLKSLKLHTDKLWSIDCSKG---LMATSSSDRKIKLVNLKNMDF 65
           Y   +  T+ + + +EL ++L LH   +  +  S     L    +   KI  V   N+  
Sbjct: 295 YYVLYNPTQPKDIDIELHRTL-LHDSVVCCVKFSNNGEYLATGCNKTTKIFEVATGNLVT 353

Query: 66  QLVEELDDSTHKKS--------VRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFP 117
           +LV++    T   +        +RSV F P    LA G+ D  I IW          D  
Sbjct: 354 ELVDDTKTGTEDANSASSADLYIRSVCFSPDGKFLATGAEDKLIRIW----------DIA 403

Query: 118 ETELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQD 177
           + +++ ++ GHE ++ ++ +  SG  L S S D+++ IW+        +C   L      
Sbjct: 404 QRKIVMVLRGHEQDIYSLDYFQSGNKLVSGSGDRTIRIWDL----HTGQCSLTLSIEDGV 459

Query: 178 VKHVVWHSEMHLLASSSYDDTIRLWKEDAD------DWECAAVLNGHKGTVWCSDFEKSE 231
               V     + +A+ S D T+R+W  ++       D E    + GHK +V+   F +  
Sbjct: 460 TTVAVSPGNGNYVAAGSLDRTVRVWDSNSGFLVERLDSEGETGV-GHKDSVYSVVFTRDG 518

Query: 232 SSLRLASCSDDSTVRVWN 249
            +  + S S D +V++WN
Sbjct: 519 KN--IVSGSLDRSVKLWN 534

 Score = 42.0 bits (97), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 52/191 (27%), Positives = 84/191 (43%), Gaps = 31/191 (16%)

Query: 34  DKLWSIDCSKG---LMATSSSDRKIKLVNLKNMDFQLVEELDDST-----HKKSVRSVSF 85
           D + ++  S G    +A  S DR +++ +  N  F LVE LD        HK SV SV F
Sbjct: 457 DGVTTVAVSPGNGNYVAAGSLDRTVRVWD-SNSGF-LVERLDSEGETGVGHKDSVYSVVF 514

Query: 86  RPHSSILAAGSFDSTISIWGKEE----DADPQDDFPETEL---LAIIEGHENEVKAVSWS 138
                 + +GS D ++ +W           PQ   P+TE    +  I GH++ V +V+ +
Sbjct: 515 TRDGKNIVSGSLDRSVKLWNLRNINGASTSPQ---PKTEGNCEMTYI-GHKDFVLSVTTT 570

Query: 139 HSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVV------WHSEMHLLAS 192
            +  Y+ S S+D+ V  W+          L +LQ H   V  V         +  ++ A+
Sbjct: 571 ENDQYILSGSKDRGVIFWDK----VSGVPLLMLQGHRNSVISVAVANGKPLGANYNVFAT 626

Query: 193 SSYDDTIRLWK 203
            S D   ++WK
Sbjct: 627 GSGDCKAKIWK 637

>Kwal_27.11585
          Length = 823

 Score = 61.6 bits (148), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 45/201 (22%), Positives = 80/201 (39%), Gaps = 18/201 (8%)

Query: 76  HKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAV 135
           H+K + ++S  P+ S+ A  S+D T  IW  +            EL   +  H+  +  V
Sbjct: 503 HEKDINALSISPNDSVFATASYDKTCKIWNVDSG----------ELEGTLANHKRGLWDV 552

Query: 136 SWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSY 195
           ++      LA+CS DK++ +W      E    +  L+ H   V+   + +    + S+  
Sbjct: 553 TFCQYDKLLATCSGDKTIKVWSL----ESMSVVKTLEGHTNAVQRCSFINRNKQIVSTGA 608

Query: 196 DDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNYVEEEE 255
           D  I++W  D    EC   L+ H   +W              +   D   + W    EEE
Sbjct: 609 DGLIKVW--DLSTGECIRTLDAHSNRIWA--LSVLSDGKEFVTADADGVFQFWKDCSEEE 664

Query: 256 NGEDVWAQEAILPNVHSRAVY 276
             E++  Q+ ++    S   Y
Sbjct: 665 QKENLENQKLMVEQEQSLQNY 685

 Score = 44.7 bits (104), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 59/246 (23%), Positives = 96/246 (39%), Gaps = 76/246 (30%)

Query: 110 ADPQDDFP-ETELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECL 168
            D Q+  P E EL    EGH + + ++  S +G +LA+CS+D +V +W+ +   E+++  
Sbjct: 383 VDIQNCLPLEVELY---EGHTDLLNSLDSSENGEWLATCSKDHTVILWKLNADSEKFKPY 439

Query: 169 SVLQEHAQDVKHV--------VWHS------------------------EMHLLASSSY- 195
           +    HA  V  V         W                          +MH +  S Y 
Sbjct: 440 ARFTGHAGPVTAVGLPNVMRNTWPEFIITASNDLTIKKWSVPKPTSNDVDMHNIKVSDYT 499

Query: 196 -------------------------DDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKS 230
                                    D T ++W  D+ + E    L  HK  +W   F + 
Sbjct: 500 RRAHEKDINALSISPNDSVFATASYDKTCKIWNVDSGELE--GTLANHKRGLWDVTFCQY 557

Query: 231 ESSLRLASCSDDSTVRVWNYVEEEENGEDVWAQEAILPNVHSRAVYSVSW-SLDGYIASV 289
           +    LA+CS D T++VW+     E+   V   E      H+ AV   S+ + +  I S 
Sbjct: 558 DK--LLATCSGDKTIKVWSL----ESMSVVKTLEG-----HTNAVQRCSFINRNKQIVST 606

Query: 290 GSDGLL 295
           G+DGL+
Sbjct: 607 GADGLI 612

>AFL038C [3155] [Homologous to ScYGL100W (SEH1) - SH]
           (367581..368573) [993 bp, 330 aa]
          Length = 330

 Score = 60.5 bits (145), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 44/180 (24%), Positives = 80/180 (44%), Gaps = 13/180 (7%)

Query: 121 LLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKH 180
           +     GHE+ V  + +   G ++A+CS D+ + ++  D+   E+      + H   V  
Sbjct: 1   MKPFTTGHEDLVHDICYDFYGRHVATCSSDQHIKVFRLDKDTNEWTLSDSWKGHDSSVVA 60

Query: 181 VVWHSEMH--LLASSSYDDTIRLWKEDAD-------DWECAAVLNGHKGTVWCSDFEKSE 231
           + W S  +  +LAS SY+ TI++W+ED D        W     LN   G ++   F    
Sbjct: 61  LDWASPEYGRILASVSYNKTIKVWEEDPDAPEGSGRRWTRLCTLNDATGPLYSVKFAPGH 120

Query: 232 SSLRLASCSDDSTVRVWNYVEEEENGEDVWAQE----AILPNVHSRAVYSVSWSLDGYIA 287
             LRL +  +D  +R+++ +E  +        E    A  P  H ++ +S+ W    + A
Sbjct: 121 LGLRLGAIGNDGVLRIYDALEPSDLRSWTLTSEVKVLATPPASHLQSDFSLDWCPSRFSA 180

 Score = 37.0 bits (84), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 35/135 (25%), Positives = 59/135 (43%), Gaps = 22/135 (16%)

Query: 57  LVNLKNMDFQLVEELDDSTHKKSVRSVSFRPHSS----ILAAGSFDSTISIWGKEED--- 109
            V  +N   +L +      H+  +RSVS+ P       ++A GS D  + I+   E    
Sbjct: 192 FVYERNKAGKLFQAARLPGHQGLIRSVSWAPSFGRWHQLIATGSKDGRVRIFQLTEKLDA 251

Query: 110 -------------ADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIW 156
                        A P       +LL+    H+ EV +VSW+ +G  L+S   D  V +W
Sbjct: 252 TDDASTDDASTDDAGPAPHI-SVQLLSEHADHKGEVWSVSWNLTGTILSSSGDDGKVRLW 310

Query: 157 EADELGEEYECLSVL 171
           ++     E++C+SV+
Sbjct: 311 KS-SFSNEFKCMSVI 324

 Score = 35.4 bits (80), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 70/287 (24%), Positives = 113/287 (39%), Gaps = 44/287 (15%)

Query: 46  MATSSSDRKIKLVNLKNMDFQLVEELDDS--THKKSVRSVSFRP--HSSILAAGSFDSTI 101
           +AT SSD+ IK+  L     +    L DS   H  SV ++ +    +  ILA+ S++ TI
Sbjct: 24  VATCSSDQHIKVFRLDKDTNEWT--LSDSWKGHDSSVVALDWASPEYGRILASVSYNKTI 81

Query: 102 SIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWS--HSGYYLASCSRDKSVWIWEAD 159
            +W ++ DA P+        L  +      + +V ++  H G  L +   D  + I++A 
Sbjct: 82  KVWEEDPDA-PEGSGRRWTRLCTLNDATGPLYSVKFAPGHLGLRLGAIGNDGVLRIYDAL 140

Query: 160 E--------LGEEYECLSVLQ-EHAQDVKHVVW---HSEMHLLASSSYDDTIRLWKEDAD 207
           E        L  E + L+     H Q    + W         L   + D      +  A 
Sbjct: 141 EPSDLRSWTLTSEVKVLATPPASHLQSDFSLDWCPSRFSAERLVVCALDQAFVYERNKAG 200

Query: 208 DWECAAVLNGHKGTV----WCSDFEKSESSLRLASCSDDSTVRVWNYVEE------EENG 257
               AA L GH+G +    W   F +      +A+ S D  VR++   E+          
Sbjct: 201 KLFQAARLPGHQGLIRSVSWAPSFGRWHQ--LIATGSKDGRVRIFQLTEKLDATDDASTD 258

Query: 258 EDVWAQEAILPNV----------HSRAVYSVSWSLDGYI-ASVGSDG 293
           +         P++          H   V+SVSW+L G I +S G DG
Sbjct: 259 DASTDDAGPAPHISVQLLSEHADHKGEVWSVSWNLTGTILSSSGDDG 305

 Score = 33.9 bits (76), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 59/123 (47%), Gaps = 26/123 (21%)

Query: 123 AIIEGHENEVKAVSWSHS-GYY---LASCSRDKSVWIWEADEL----------------- 161
           A + GH+  +++VSW+ S G +   +A+ S+D  V I++  E                  
Sbjct: 206 ARLPGHQGLIRSVSWAPSFGRWHQLIATGSKDGRVRIFQLTEKLDATDDASTDDASTDDA 265

Query: 162 -GEEYECLSVLQEHAQ---DVKHVVWHSEMHLLASSSYDDTIRLWKED-ADDWECAAVLN 216
               +  + +L EHA    +V  V W+    +L+SS  D  +RLWK   +++++C +V+ 
Sbjct: 266 GPAPHISVQLLSEHADHKGEVWSVSWNLTGTILSSSGDDGKVRLWKSSFSNEFKCMSVIC 325

Query: 217 GHK 219
             K
Sbjct: 326 AQK 328

>Kwal_23.5035
          Length = 744

 Score = 60.8 bits (146), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 70/302 (23%), Positives = 130/302 (43%), Gaps = 52/302 (17%)

Query: 11  FSHKHTRLQRMSLELLKSLKLHTDKLWSIDCSKGLMATSSSDRKIKLVNLKNMDFQLVEE 70
           F    T L+  +++++  L+   D           + T + D+ I++ + K   F  + +
Sbjct: 358 FKPHRTTLRGHTMKIVTCLQFEDD----------YVITGADDKMIRVYDAKTEKF--ITQ 405

Query: 71  LDDSTHKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHEN 130
           L  S H   V ++ +  H  IL +GS D ++ +W          +    +   + +GH +
Sbjct: 406 L--SGHDGGVWALKYG-HDGILVSGSTDRSVRVW----------NIKSGKCTHVFKGHTS 452

Query: 131 EVKAVSW-SHSGY-YLASCSRDKSVWIWEADEL-GEEYE---C------------LSVLQ 172
            V+ +    H+G  ++ + SRD ++ +W+      E+Y    C            + VL+
Sbjct: 453 TVRCLDIVEHNGKKFIVTGSRDHTLHVWKLPNCNAEDYNPEVCEVFNTTDANPYFVGVLR 512

Query: 173 EHAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSES 232
            H   V+ V  H   +++ S SYD  + +W  D    +C  VL GH   ++ + ++   +
Sbjct: 513 GHMAAVRTVSGHG--NIVVSGSYDFNLMVW--DIAQMKCLYVLTGHTDRIYSTIYDYQRN 568

Query: 233 SLRLASCSDDSTVRVWNYVEEEENGEDVWAQEAILPNVHSRAVYSVSWSLDGYIASVGSD 292
             R  S   DSTV+VW+  +  +NG       +  P      V   S +L G+ A VG  
Sbjct: 569 --RCISAGMDSTVKVWDLADVSKNGPCTTITSSNNP---CTKVTGSSITLQGHTALVGLL 623

Query: 293 GL 294
           GL
Sbjct: 624 GL 625

>CAGL0E00561g 49750..52260 some similarities with sp|P16649
           Saccharomyces cerevisiae YCR084c TUP1, hypothetical
           start
          Length = 836

 Score = 60.8 bits (146), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 49/186 (26%), Positives = 82/186 (44%), Gaps = 23/186 (12%)

Query: 80  VRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSH 139
           +RSV F P    LA G+ D  I IW          D  + +++ +++GHE ++ ++ +  
Sbjct: 558 IRSVCFSPDGKFLATGAEDKLIRIW----------DIEQKKIVMVLKGHEQDIYSLDYFP 607

Query: 140 SGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTI 199
           SG  L S S D++V IW+     +  +C   L          V   +   +A+ S D  +
Sbjct: 608 SGDKLVSGSGDRTVRIWDL----KTGQCTLTLSIEDGVTTVAVSPGDGKFIAAGSLDRAV 663

Query: 200 RLWKEDAD------DWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNYVEE 253
           R+W  D        D E   +  GHK +V+   F +  +   + S S D +V++WN    
Sbjct: 664 RVWDSDTGFLVERLDSEN-ELGTGHKDSVYSVVFTRDGNG--VVSGSLDRSVKLWNLRNV 720

Query: 254 EENGED 259
             N  D
Sbjct: 721 NHNNAD 726

 Score = 45.4 bits (106), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 50/186 (26%), Positives = 86/186 (46%), Gaps = 22/186 (11%)

Query: 34  DKLWSIDCSKG---LMATSSSDRKIKLVNLKNMDFQLVEELDD-----STHKKSVRSVSF 85
           D + ++  S G    +A  S DR +++ +  +  F LVE LD      + HK SV SV F
Sbjct: 639 DGVTTVAVSPGDGKFIAAGSLDRAVRVWD-SDTGF-LVERLDSENELGTGHKDSVYSVVF 696

Query: 86  RPHSSILAAGSFDSTISIWG-KEEDADPQDDFPETELLAII-EGHENEVKAVSWSHSGYY 143
               + + +GS D ++ +W  +  + +  D  P +    +   GH++ V +V+ +    Y
Sbjct: 697 TRDGNGVVSGSLDRSVKLWNLRNVNHNNADGKPTSGTCEVTYTGHKDFVLSVATTEDDEY 756

Query: 144 LASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWH------SEMHLLASSSYDD 197
           + S S+D+ V  W  D++      L +LQ H   V  V  +         H+ A+ S D 
Sbjct: 757 ILSGSKDRGVLFW--DKVSG--NPLLMLQGHRNSVISVAVNHGHPLGPNYHIFATGSGDC 812

Query: 198 TIRLWK 203
             R+WK
Sbjct: 813 KARIWK 818

>YCR084C (TUP1) [608] chr3 complement(260307..262448) General
           repressor of RNA polymerase II transcription that is
           brought to target promoters by regulated,
           sequence-specific DNA-binding proteins, exists in a
           complex with Ssn6p that is converted to a
           transcriptional activator in a Hog1p-dependent manner
           [2142 bp, 713 aa]
          Length = 713

 Score = 60.8 bits (146), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 53/195 (27%), Positives = 85/195 (43%), Gaps = 34/195 (17%)

Query: 68  VEELDDSTHKKS---VRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAI 124
           VE L+ S+   S   +RSV F P    LA G+ D  I IW          D    +++ I
Sbjct: 431 VENLNTSSSPSSDLYIRSVCFSPDGKFLATGAEDRLIRIW----------DIENRKIVMI 480

Query: 125 IEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWH 184
           ++GHE ++ ++ +  SG  L S S D++V IW+        +C   L          V  
Sbjct: 481 LQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDL----RTGQCSLTLSIEDGVTTVAVSP 536

Query: 185 SEMHLLASSSYDDTIRLWKEDADDWECAAVL----------NGHKGTVWCSDFEKSESSL 234
            +   +A+ S D  +R+W     D E   ++           GHK +V+   F +   S 
Sbjct: 537 GDGKYIAAGSLDRAVRVW-----DSETGFLVERLDSENESGTGHKDSVYSVVFTRDGQS- 590

Query: 235 RLASCSDDSTVRVWN 249
            + S S D +V++WN
Sbjct: 591 -VVSGSLDRSVKLWN 604

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 41/150 (27%), Positives = 67/150 (44%), Gaps = 17/150 (11%)

Query: 67  LVEELDD-----STHKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDD-FPETE 120
           LVE LD      + HK SV SV F      + +GS D ++ +W  +   +  D   P + 
Sbjct: 561 LVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLQNANNKSDSKTPNSG 620

Query: 121 LLAIIE-GHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVK 179
              +   GH++ V +V+ + +  Y+ S S+D+ V  W+     +    L +LQ H   V 
Sbjct: 621 TCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDK----KSGNPLLMLQGHRNSVI 676

Query: 180 HVV------WHSEMHLLASSSYDDTIRLWK 203
            V          E ++ A+ S D   R+WK
Sbjct: 677 SVAVANGSPLGPEYNVFATGSGDCKARIWK 706

>CAGL0M04279g 469040..471862 highly similar to sp|Q12220
           Saccharomyces cerevisiae YLR129w DIP2 DOM34P-interacting
           protein, start by similarity
          Length = 940

 Score = 60.5 bits (145), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 84/193 (43%), Gaps = 21/193 (10%)

Query: 83  VSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGY 142
           + + P +++LAAG  D  I IW          D     +L    GH++ +  +++  +G 
Sbjct: 85  LKYHPETNLLAAGYADGVIKIW----------DLISKTVLISFNGHKSAITVLAFDTTGT 134

Query: 143 YLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLW 202
            L S S+D  + +W  D +GE    L  L+ H +D    +W  + + L S+S D  +++W
Sbjct: 135 RLISASKDSDIIVW--DLVGE--SGLYKLRSH-KDAITGLWCEDENWLISTSKDGLVKIW 189

Query: 203 KEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNYVEEEENGEDVWA 262
             D    +C      H G  W     +  +     +CS DS V++W    + ENG  +  
Sbjct: 190 --DLKSQQCVETHLAHTGECWSLGIIEDMA----VTCSADSQVKLWKLDLQAENGSKLTE 243

Query: 263 QEAILPNVHSRAV 275
           +  I      R V
Sbjct: 244 KGIIEKQSKQRGV 256

 Score = 54.3 bits (129), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 45/165 (27%), Positives = 74/165 (44%), Gaps = 22/165 (13%)

Query: 45  LMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSVSFRPHSSILAAGSFDSTISIW 104
            +A S  D  +K+  L +M F L        HK  V S+     S ++   S D  I IW
Sbjct: 542 FIAVSLLDNTVKVFFLDSMKFFL----SLYGHKLPVLSMDISYDSKLIVTCSADKNIKIW 597

Query: 105 GKEEDADPQDDFPE--TELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELG 162
           G         DF +    L A    H++ +  V +    Y   SCS+D +V  W+    G
Sbjct: 598 GL--------DFGDCHKSLFA----HQDSIMNVKFLPESYNFFSCSKDATVKYWD----G 641

Query: 163 EEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDAD 207
           +++EC+  L  H  +V  +   ++   + S+ +D +IR+W+E  D
Sbjct: 642 QKFECIQKLAAHQSEVWSISVSNDGTFVISTGHDHSIRVWEETED 686

 Score = 42.0 bits (97), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 60/269 (22%), Positives = 104/269 (38%), Gaps = 31/269 (11%)

Query: 38  SIDCSKGLMATSSSDRKIKLVNLKNMDFQLVE-----ELDD--STHKKSVRSVSFRPHSS 90
           S +C   L         + +V  +N + QL +      LD+    H  ++ S+       
Sbjct: 424 SFECGYALTCKFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLTSDGR 483

Query: 91  ILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHE------NEVKAVSWSHSGYYL 144
            L  GS D T+  W  E    P  D     +  +   H+      +++ +V  S    ++
Sbjct: 484 KLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPDDKFI 543

Query: 145 ASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWKE 204
           A    D +V ++  D +    +    L  H   V  +    +  L+ + S D  I++W  
Sbjct: 544 AVSLLDNTVKVFFLDSM----KFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGL 599

Query: 205 DADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNYVEEEENGEDVWAQE 264
           D  D  C   L  H+ ++    F     S    SCS D+TV+ W       +G+     +
Sbjct: 600 DFGD--CHKSLFAHQDSIMNVKF--LPESYNFFSCSKDATVKYW-------DGQKFECIQ 648

Query: 265 AILPNVHSRAVYSVSWSLDG-YIASVGSD 292
            +    H   V+S+S S DG ++ S G D
Sbjct: 649 KL--AAHQSEVWSISVSNDGTFVISTGHD 675

>ACR137W [1184] [Homologous to ScYPL151C (PRP46) - SH]
           complement(590077..591354) [1278 bp, 425 aa]
          Length = 425

 Score = 59.7 bits (143), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 49/177 (27%), Positives = 75/177 (42%), Gaps = 19/177 (10%)

Query: 76  HKKSVRSVSFRP-HSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKA 134
           H   VR V   P  ++  A GS DSTI +W          D    +L   ++GH   V+ 
Sbjct: 112 HTGWVRCVCVDPVDNAWFATGSNDSTIRVW----------DLATGKLKVTLQGHIMTVRD 161

Query: 135 VSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSS 194
           +  S    Y+ S S+DK V  W+     E    +         V  V  H  + L+ S+ 
Sbjct: 162 ICISARHPYMFSASQDKLVKCWDL----ERNTVVRDFHGTLSGVHSVDLHPSLDLIVSAG 217

Query: 195 YDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNYV 251
            D  +R+W  D     C   L GH+G +  +         ++ SCS D+TV++W+ V
Sbjct: 218 RDSVVRVW--DIRSRSCVLTLAGHRGPI--NKVRCLPVDPQIVSCSTDATVKLWDLV 270

 Score = 33.1 bits (74), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 36/68 (52%), Gaps = 1/68 (1%)

Query: 182 VWHSEMHLLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSD 241
           ++  E    A + Y++ +    +    W+   V+NGH G V C   +  +++   A+ S+
Sbjct: 76  IYRFEADTSALARYEEVVSQKPQWHAPWKLTRVINGHTGWVRCVCVDPVDNAW-FATGSN 134

Query: 242 DSTVRVWN 249
           DST+RVW+
Sbjct: 135 DSTIRVWD 142

 Score = 28.9 bits (63), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 2/44 (4%)

Query: 116 FPETELLAIIEGHENE--VKAVSWSHSGYYLASCSRDKSVWIWE 157
           F + E  A+    E+E  V A ++  +G  L +C RDKS+ IW+
Sbjct: 358 FQKLETTAMPGSLESEKGVLASTFDRTGLRLLTCERDKSIKIWK 401

>AGR168W [4479] [Homologous to ScYBL008W (HIR1) - SH]
           complement(1061522..1063999) [2478 bp, 825 aa]
          Length = 825

 Score = 59.7 bits (143), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 40/144 (27%), Positives = 71/144 (49%), Gaps = 10/144 (6%)

Query: 66  QLVEELDD-STHKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDA-----DPQDDFPET 119
           QL + L + S H  SV ++ F P +  LA+GS D  + IW KEE A     D ++D    
Sbjct: 65  QLRKPLANMSRHTGSVTALKFSPDNKYLASGSDDKILLIWEKEEGAVQPLFDMENDLEHW 124

Query: 120 ELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVK 179
            +   +  H+N+++ + W+     L +   D+S+ +W     G  +E +     H   VK
Sbjct: 125 NVRRRLVAHDNDIQDICWAPDSSILVTVGLDRSIIVWN----GSTFEKIKRFDVHQSHVK 180

Query: 180 HVVWHSEMHLLASSSYDDTIRLWK 203
            VV+       A++S D T+++++
Sbjct: 181 GVVFDPANKYFATASDDRTVKVFR 204

 Score = 54.7 bits (130), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 48/178 (26%), Positives = 75/178 (42%), Gaps = 23/178 (12%)

Query: 92  LAAGSFDSTISIWGKEED---ADPQDDFPETE-----LLAIIEGHENEVKAVSWSHSGYY 143
           +A G  D  I IW   +    A P+  +P  E      LA +  H   V A+ +S    Y
Sbjct: 32  VATGGLDGKIRIWSVADILVFAKPKVSWPAREEQLRKPLANMSRHTGSVTALKFSPDNKY 91

Query: 144 LASCSRDKSVWIWEADELG-----------EEYECLSVLQEHAQDVKHVVWHSEMHLLAS 192
           LAS S DK + IWE +E             E +     L  H  D++ + W  +  +L +
Sbjct: 92  LASGSDDKILLIWEKEEGAVQPLFDMENDLEHWNVRRRLVAHDNDIQDICWAPDSSILVT 151

Query: 193 SSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNY 250
              D +I +W  +   +E     + H+  V    F+ +      A+ SDD TV+V+ Y
Sbjct: 152 VGLDRSIIVW--NGSTFEKIKRFDVHQSHVKGVVFDPANKY--FATASDDRTVKVFRY 205

>CAGL0I03454g 292823..293734 similar to sp|Q04491 Saccharomyces
           cerevisiae YLR208w SEC13 protein transport protein,
           start by similarity
          Length = 303

 Score = 58.5 bits (140), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 56/188 (29%), Positives = 88/188 (46%), Gaps = 30/188 (15%)

Query: 45  LMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSVSFRPHSSI------------- 91
           ++   S+D KI +V LK+      + LD++ HK  V S+S+ P                 
Sbjct: 120 ILLCGSADGKISVVELKDGQIASTKILDNA-HKFGVNSISWAPLMKTDSSDDGDETTAVK 178

Query: 92  -LAAGSFDSTISIWGKEEDADPQDDFPETELLA-IIEGHENEVKAVSWSHSGY---YLAS 146
              +G  D+ + IW         DD  ET ++A  +EGH++ V AV WS +     Y+AS
Sbjct: 179 QFISGGNDNLVKIW-------KFDDDQETYVVADTLEGHKDAVTAVDWSPTTLLQSYVAS 231

Query: 147 CSRDKSVWIWEADELGE--EYECLSVLQ-EHAQDVKHVVWHSEMHLLASSSYDDTIRLWK 203
            S DK   +W  D   +  +++ +SV + +  Q +  V W    +LLA S  D  + +WK
Sbjct: 232 VSNDKQCLVWTQDHSSKKNDWKKISVNEGKFEQKLGSVSWSLSGNLLAVSDDDKNVTIWK 291

Query: 204 EDAD-DWE 210
           E  D  WE
Sbjct: 292 ESGDGKWE 299

 Score = 53.9 bits (128), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 47/166 (28%), Positives = 75/166 (45%), Gaps = 11/166 (6%)

Query: 121 LLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKH 180
           ++ I   HE  +   + ++ G  LA+CS DK+V I+E +++      L  L  H   V +
Sbjct: 1   MVKIENAHEGVIHHAALNYYGTRLATCSSDKTVKIFEINDVNNSSSLLETLVGHEGPVWY 60

Query: 181 VVW-HSEM--HLLASSSYDDTIRLWKEDADDWECAAVLNG--HKGTVWCSDFEKSESSLR 235
             W H  +  +LLA+  YD  + +WKE     +   +     H  +V C  +   E  L 
Sbjct: 61  ADWCHPSLGENLLATCGYDGKVLIWKESGHGGKMQIIGKHAVHSASVNCVKWAPHEYGLI 120

Query: 236 LASCSDDSTVRVWNYVEEEENGEDVWAQEAILPNVHSRAVYSVSWS 281
           L   S D  +     V E ++G+   A   IL N H   V S+SW+
Sbjct: 121 LLCGSADGKIS----VVELKDGQ--IASTKILDNAHKFGVNSISWA 160

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 68/283 (24%), Positives = 114/283 (40%), Gaps = 55/283 (19%)

Query: 22  SLELLKSLKLHTDKLWSID-----CSKGLMATSSSDRKIKLVNLKNMDFQLVEELDDSTH 76
           S  LL++L  H   +W  D       + L+AT   D K+ +        ++      + H
Sbjct: 44  SSSLLETLVGHEGPVWYADWCHPSLGENLLATCGYDGKVLIWKESGHGGKMQIIGKHAVH 103

Query: 77  KKSVRSVSFRPH--SSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKA 134
             SV  V + PH    IL  GS D  IS+    E  D Q     T++L     H+  V +
Sbjct: 104 SASVNCVKWAPHEYGLILLCGSADGKISV---VELKDGQ--IASTKILD--NAHKFGVNS 156

Query: 135 VSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSS 194
           +SW+                + + D   +  E  +V Q                   S  
Sbjct: 157 ISWAP---------------LMKTDSSDDGDETTAVKQ-----------------FISGG 184

Query: 195 YDDTIRLWK--EDADDWECAAVLNGHKGTVWCSDFEKSESSL---RLASCSDDSTVRVWN 249
            D+ +++WK  +D + +  A  L GHK  V   D+  S ++L    +AS S+D    VW 
Sbjct: 185 NDNLVKIWKFDDDQETYVVADTLEGHKDAVTAVDW--SPTTLLQSYVASVSNDKQCLVW- 241

Query: 250 YVEEEENGEDVWAQEAILPNVHSRAVYSVSWSLDGYIASVGSD 292
             ++  + ++ W + ++      + + SVSWSL G + +V  D
Sbjct: 242 -TQDHSSKKNDWKKISVNEGKFEQKLGSVSWSLSGNLLAVSDD 283

>KLLA0F10263g 949926..951974 gi|2494900|sp|P56094|TUP1_KLULA
           Kluyveromyces lactis Transcriptional repressor TUP1,
           start by similarity
          Length = 682

 Score = 59.3 bits (142), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 76/176 (43%), Gaps = 23/176 (13%)

Query: 80  VRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSH 139
           +RSV F P    LA G+ D  I IW          D    +++  ++GHE ++ ++ +  
Sbjct: 409 IRSVCFSPDGKFLATGAEDKLIRIW----------DLETKKIVMTLKGHEQDIYSLDYFP 458

Query: 140 SGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTI 199
           SG  L S S D++V IW+         C   L          V   E   +A+ S D T+
Sbjct: 459 SGNKLVSGSGDRTVRIWDL----TTGTCSLTLSIEDGVTTVAVSPGEGKFIAAGSLDRTV 514

Query: 200 RLWKEDAD------DWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWN 249
           R+W  D        D E   +  GH+ +V+   F +      + S S D +V++WN
Sbjct: 515 RVWDSDTGFLVERLDSE-NELGTGHRDSVYSVVFTRDGKG--VVSGSLDRSVKLWN 567

 Score = 44.3 bits (103), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 48/185 (25%), Positives = 84/185 (45%), Gaps = 26/185 (14%)

Query: 45  LMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSVSFRPHSSILAAGSFDSTISIW 104
            +AT + D+ I++ +L+    ++V  L    H++ + S+ + P  + L +GS D T+ IW
Sbjct: 420 FLATGAEDKLIRIWDLETK--KIVMTLKG--HEQDIYSLDYFPSGNKLVSGSGDRTVRIW 475

Query: 105 GKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHS-GYYLASCSRDKSVWIWEADELGE 163
                     D   T   ++    E+ V  V+ S   G ++A+ S D++V +W++D  G 
Sbjct: 476 ----------DL-TTGTCSLTLSIEDGVTTVAVSPGEGKFIAAGSLDRTVRVWDSD-TGF 523

Query: 164 EYECLSVLQE----HAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDA-----DDWECAAV 214
             E L    E    H   V  VV+  +   + S S D +++LW  +         EC   
Sbjct: 524 LVERLDSENELGTGHRDSVYSVVFTRDGKGVVSGSLDRSVKLWNLNGLSGQKSHAECEVT 583

Query: 215 LNGHK 219
             GHK
Sbjct: 584 YTGHK 588

>YPL151C (PRP46) [5296] chr16 complement(266179..267534) Putative
           spliceosomal protein with similarity to S. pombe prp5p,
           has four WD (WD-40) repeats [1356 bp, 451 aa]
          Length = 451

 Score = 58.9 bits (141), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 49/173 (28%), Positives = 78/173 (45%), Gaps = 19/173 (10%)

Query: 80  VRSVSFRP-HSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWS 138
           VR V+  P  +     GS D+T+ +W          D    +L   + GH   V+ V+ S
Sbjct: 142 VRCVAIDPVDNEWFITGSNDTTMKVW----------DLATGKLKTTLAGHVMTVRDVAVS 191

Query: 139 HSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDT 198
               YL S S DK+V  W+     E+ + +     H   V+ V  H  + L+A++  D  
Sbjct: 192 DRHPYLFSVSEDKTVKCWDL----EKNQIIRDYYGHLSGVRTVSIHPTLDLIATAGRDSV 247

Query: 199 IRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNYV 251
           I+LW  D         L GHKG +  +  + +    ++ S S D+TVR+W+ V
Sbjct: 248 IKLW--DMRTRIPVITLVGHKGPI--NQVQCTPVDPQVVSSSTDATVRLWDVV 296

>Kwal_27.12053
          Length = 755

 Score = 58.9 bits (141), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 70/272 (25%), Positives = 109/272 (40%), Gaps = 31/272 (11%)

Query: 82  SVSFRPHSSILAAGSFDSTISIWGKEEDADP-QDDFP----ETELLAIIEGHENEVKAVS 136
           S+ F     + AAG  DS I IW    D +P ++  P    E      + GH   V + S
Sbjct: 432 SLEFSDDVRLAAAGFQDSIIKIW--SLDGEPLKNKLPSKQGERTNNETLVGHSGTVYSTS 489

Query: 137 WSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYD 196
           +S    YL S S DK+V +W  D     Y  L   + H   +  V +    H  A++S+D
Sbjct: 490 FSPDNRYLLSASEDKTVRLWSTD----TYTSLVNYKGHNHPIWDVAFSPLGHYFATASHD 545

Query: 197 DTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNYVEEEEN 256
            T RLW    D      +  GH   V    F  + +   + + S D T R+W        
Sbjct: 546 QTARLW--SCDHIYPLRIFAGHLNDVDTVSFHPNGT--YVFTGSSDKTCRMW-------- 593

Query: 257 GEDVWAQEAI-LPNVHSRAVYSVSWSLDGYIASVGSDGLLXXXXXXXXXXXXXXXQQHEA 315
             D+ + +++ L   H+  V S + S DG   S GS+  +               + H  
Sbjct: 594 --DITSGDSVRLFLGHTAPVTSTAVSPDGRWLSTGSEDGVINVWDIGTGKRLKQMRGHGK 651

Query: 316 HGIYEINVVKWATVDDSVLLLTGGDDGCANIW 347
           + +Y ++  K   V     L++GG D    +W
Sbjct: 652 NAVYSLSYSKEGHV-----LISGGADHSVRVW 678

>YBL008W (HIR1) [186] chr2 (209618..212140) Histone transcription
           inhibitor, required for periodic repression of 3 of the
           4 histone gene loci and for autogenous repression of
           HTA1-HTB1 locus by H2A and H2B, member of WD (WD-40)
           repeat family [2523 bp, 840 aa]
          Length = 840

 Score = 58.9 bits (141), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 56/207 (27%), Positives = 88/207 (42%), Gaps = 24/207 (11%)

Query: 5   KHNLYTF--SHKHTRLQRMSLELLKSLKLHTDKLWSIDCSKGLMATSSSDRKIKLVNLKN 62
           K+ +YT   SH   RL    L+          ++WSID     M   S   +I L     
Sbjct: 17  KYEIYTVDVSHDGKRLATGGLD-------GKIRIWSIDSILRCMELESLTPEIPL----P 65

Query: 63  MDFQLVEELDDSTHKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFP---ET 119
            D Q+      S H  S+  V F P    LA+GS D  + IW  +E+   Q  F    E 
Sbjct: 66  QDLQM-PLCSMSRHTGSITCVKFSPDGKYLASGSDDRILLIWALDEEQSSQPAFGSEHER 124

Query: 120 E---LLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQ 176
           E   +   +  H+N+++ + W+     L +   D+SV +W     G  +E L     H  
Sbjct: 125 EHWTVRKRLVAHDNDIQDICWAPDSSILVTVGLDRSVIVWN----GSTFEKLKRFDVHQS 180

Query: 177 DVKHVVWHSEMHLLASSSYDDTIRLWK 203
            VK VV+       A++S D T+++++
Sbjct: 181 LVKGVVFDPANKYFATTSDDRTMKIFR 207

 Score = 32.7 bits (73), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 54/141 (38%), Gaps = 35/141 (24%)

Query: 126 EGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGE--EYECLSVLQEHAQDVKHVVW 183
           E  + E+  V  SH G  LA+   D  + IW  D +    E E L+      QD+     
Sbjct: 14  ESRKYEIYTVDVSHDGKRLATGGLDGKIRIWSIDSILRCMELESLTPEIPLPQDL----- 68

Query: 184 HSEMHLLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDS 243
             +M L + S                        H G++ C  F  S     LAS SDD 
Sbjct: 69  --QMPLCSMSR-----------------------HTGSITCVKF--SPDGKYLASGSDDR 101

Query: 244 TVRVWNYVEEEENGEDVWAQE 264
            + +W  ++EE++ +  +  E
Sbjct: 102 ILLIW-ALDEEQSSQPAFGSE 121

>Scas_629.12
          Length = 671

 Score = 58.9 bits (141), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 47/177 (26%), Positives = 80/177 (45%), Gaps = 25/177 (14%)

Query: 80  VRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSH 139
           +RSV F P    LA G+ D  I IW          D  E +++ +++GHE +V ++ +  
Sbjct: 390 IRSVCFSPDGEFLATGAEDKLIRIW----------DIQERKIVMVLKGHEQDVYSLDYFP 439

Query: 140 SGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTI 199
           +G  L S S D++V IW+        +C   L          V  ++   +A+ S D  +
Sbjct: 440 NGEKLVSGSGDRTVRIWDL----RTGQCSLTLSIEYGVTTVAVSPNDGKFIAAGSLDRAV 495

Query: 200 RLWKEDADDWECAAVLN-------GHKGTVWCSDFEKSESSLRLASCSDDSTVRVWN 249
           R+W  D+        L+       GH+ +V+   F +  +   + S S D TV++WN
Sbjct: 496 RVW--DSTTGFLVERLDSENELGTGHRDSVYSVVFTRDGN--EVVSGSLDKTVKLWN 548

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 42/155 (27%), Positives = 66/155 (42%), Gaps = 24/155 (15%)

Query: 67  LVEELDD-----STHKKSVRSVSFRPHSSILAAGSFDSTISIWG-------KEEDADPQD 114
           LVE LD      + H+ SV SV F    + + +GS D T+ +W          E  D   
Sbjct: 505 LVERLDSENELGTGHRDSVYSVVFTRDGNEVVSGSLDKTVKLWNMRHSGNSNNESNDKGS 564

Query: 115 DFPETELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEH 174
                E+  +  GH++ V +V+ S    Y+ S S+D+ +  W+     E    L +LQ H
Sbjct: 565 ASATCEVTYV--GHKDFVLSVTTSQDDKYILSGSKDRGILFWDK----ESGNPLLMLQGH 618

Query: 175 AQDVKHV------VWHSEMHLLASSSYDDTIRLWK 203
              V  V          + ++ A+ S D   R+WK
Sbjct: 619 RNSVISVAVANGSALGPKYNVFATGSGDCKARIWK 653

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/165 (24%), Positives = 78/165 (47%), Gaps = 25/165 (15%)

Query: 45  LMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSVSFRPHSSILAAGSFDSTISIW 104
            +AT + D+ I++ +++     +V +     H++ V S+ + P+   L +GS D T+ IW
Sbjct: 401 FLATGAEDKLIRIWDIQERKIVMVLK----GHEQDVYSLDYFPNGEKLVSGSGDRTVRIW 456

Query: 105 GKEEDADPQDDFPETELLAIIEGHENEVKAVSWS-HSGYYLASCSRDKSVWIWEA----- 158
                     D   T   ++    E  V  V+ S + G ++A+ S D++V +W++     
Sbjct: 457 ----------DL-RTGQCSLTLSIEYGVTTVAVSPNDGKFIAAGSLDRAVRVWDSTTGFL 505

Query: 159 -DELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLW 202
            + L  E E  +    H   V  VV+  + + + S S D T++LW
Sbjct: 506 VERLDSENELGT---GHRDSVYSVVFTRDGNEVVSGSLDKTVKLW 547

>YLR208W (SEC13) [3609] chr12 (559553..560446) Component of the
           COPII coat of vesicles involved in endoplasmic reticulum
           to Golgi transport, contains six WD (WD-40) repeats [894
           bp, 297 aa]
          Length = 297

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 50/163 (30%), Positives = 74/163 (45%), Gaps = 11/163 (6%)

Query: 121 LLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKH 180
           ++ I   H   +      + G  LA+CS DK++ I+E +  GE ++ +  L  H   V  
Sbjct: 1   MVVIANAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVE--GETHKLIDTLTGHEGPVWR 58

Query: 181 VVW-HSEMH-LLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLAS 238
           V W H +   +LAS SYD  + +WKE+   W   AV   H  +V    +   E    L  
Sbjct: 59  VDWAHPKFGTILASCSYDGKVLIWKEENGRWSQIAVHAVHSASVNSVQWAPHEYGPLLLV 118

Query: 239 CSDDSTVRVWNYVEEEENGEDVWAQEAILPNVHSRAVYSVSWS 281
            S D  V V   VE +ENG        I+ + H+  V S SW+
Sbjct: 119 ASSDGKVSV---VEFKENG----TTSPIIIDAHAIGVNSASWA 154

 Score = 54.3 bits (129), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 69/266 (25%), Positives = 108/266 (40%), Gaps = 40/266 (15%)

Query: 46  MATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSV--SFRPHSSILAAGSFDSTISI 103
           +AT SSD+ IK+  ++    +L++ L  + H+  V  V  +     +ILA+ S+D  + I
Sbjct: 24  LATCSSDKTIKIFEVEGETHKLIDTL--TGHEGPVWRVDWAHPKFGTILASCSYDGKVLI 81

Query: 104 WGKEEDADPQDDFPETELLAIIEGHENEVKAVSWS--HSGYYLASCSRDKSVWIWEADEL 161
           W +E     Q        +A+   H   V +V W+    G  L   S D  V + E  E 
Sbjct: 82  WKEENGRWSQ--------IAVHAVHSASVNSVQWAPHEYGPLLLVASSDGKVSVVEFKEN 133

Query: 162 GEEYECLSVLQEHAQDVKHVVWHS-------------EMHLLASSSYDDTIRLWK--EDA 206
           G       ++  HA  V    W               E     +   D+ +++WK   DA
Sbjct: 134 GTTSPI--IIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIWKYNSDA 191

Query: 207 DDWECAAVLNGHKGTVWCSDFEKSESSL---RLASCSDDSTVRVWNYVEEEENGEDVWAQ 263
             +   + L GH    W  D   S + L    LAS S D T  +W    E+   +    +
Sbjct: 192 QTYVLESTLEGHSD--WVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQGPWKKTLLK 249

Query: 264 EAILPNVHSRAVYSVSWSLDGYIASV 289
           E   P+V  RA    SWSL G + ++
Sbjct: 250 EEKFPDVLWRA----SWSLSGNVLAL 271

 Score = 54.3 bits (129), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 75/172 (43%), Gaps = 24/172 (13%)

Query: 190 LASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWN 249
           LA+ S D TI++++ + +  +    L GH+G VW  D+   +    LASCS D  V +W 
Sbjct: 24  LATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIW- 82

Query: 250 YVEEEENGEDVWAQEAILPNVHSRAVYSVSWSLDGY---IASVGSDGLLXXXXXXXXXXX 306
              +EENG   W+Q A+   VHS +V SV W+   Y   +    SDG +           
Sbjct: 83  ---KEENGR--WSQIAVHA-VHSASVNSVQWAPHEYGPLLLVASSDGKVSVVEFKENGTT 136

Query: 307 XXXXQQHEAHGIYEINVVKWAT-----------VDDSVLLLTGGDDGCANIW 347
                  +AH I  +N   WA              +S   +TGG D    IW
Sbjct: 137 SPIII--DAHAI-GVNSASWAPATIEEDGEHNGTKESRKFVTGGADNLVKIW 185

 Score = 51.2 bits (121), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 53/188 (28%), Positives = 82/188 (43%), Gaps = 28/188 (14%)

Query: 45  LMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSVSFRP-------------HSSI 91
           L+  +SSD K+ +V  K         +D   H   V S S+ P              S  
Sbjct: 115 LLLVASSDGKVSVVEFKENGTTSPIIID--AHAIGVNSASWAPATIEEDGEHNGTKESRK 172

Query: 92  LAAGSFDSTISIWGKEEDADPQDDFPETELL-AIIEGHENEVKAVSWSHSGY---YLASC 147
              G  D+ + IW    DA       +T +L + +EGH + V+ V+WS +     YLAS 
Sbjct: 173 FVTGGADNLVKIWKYNSDA-------QTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASV 225

Query: 148 SRDKSVWIWEADELGEEYECLSVLQEHAQDVK-HVVWHSEMHLLASSSYDDTIRLWKEDA 206
           S+D++  IW  D     ++   + +E   DV     W    ++LA S  D+ + LWKE+ 
Sbjct: 226 SQDRTCIIWTQDNEQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWKENL 285

Query: 207 D-DWECAA 213
           +  WE A 
Sbjct: 286 EGKWEPAG 293

>Kwal_23.6429
          Length = 750

 Score = 58.9 bits (141), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 48/180 (26%), Positives = 77/180 (42%), Gaps = 31/180 (17%)

Query: 80  VRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSH 139
           +RSV F P    LA G+ D  I IW          D     ++  ++GHE ++ ++ +  
Sbjct: 473 IRSVCFSPDGKFLATGAEDKLIRIW----------DLATRRIVMTLQGHEQDIYSLDYFP 522

Query: 140 SGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTI 199
           SG  L S S D++V IW+        +C   L          V   +  L+A+ S D T+
Sbjct: 523 SGDKLVSGSGDRTVRIWDL----RTGQCSLTLSIEDGVTTVAVSPGDGKLIAAGSLDRTV 578

Query: 200 RLWKEDADDWECAAVL----------NGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWN 249
           R+W     D E   ++           GHK +V+   F +      + S S D +V++WN
Sbjct: 579 RIW-----DSETGFLVERLDSENELGTGHKDSVYSVVFTRDGHG--VVSGSLDRSVKLWN 631

 Score = 55.5 bits (132), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 61/250 (24%), Positives = 105/250 (42%), Gaps = 25/250 (10%)

Query: 24  ELLKSLKLHTDKLWSID--CSKGLMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVR 81
            ++ +L+ H   ++S+D   S   + + S DR +++ +L+     L   ++D      V 
Sbjct: 503 RIVMTLQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDG-----VT 557

Query: 82  SVSFRPH-SSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHS 140
           +V+  P    ++AAGS D T+ IW  E     +    E EL     GH++ V +V ++  
Sbjct: 558 TVAVSPGDGKLIAAGSLDRTVRIWDSETGFLVERLDSENELGT---GHKDSVYSVVFTRD 614

Query: 141 GYYLASCSRDKSVWIWE---ADELGEEYECLSVLQE-----HAQDVKHVVWHSEMHLLAS 192
           G+ + S S D+SV +W    A+    E +  +   E     H   V  V        + S
Sbjct: 615 GHGVVSGSLDRSVKLWNLRSANGGTAEGKANTAASEVTYTGHKDFVLSVATTQNDEFILS 674

Query: 193 SSYDDTIRLWKEDADDWECAAVLNGHKGTVW----CSDFEKSESSLRLASCSDDSTVRVW 248
            S D  +  W  D        +L GH+ +V      +D          A+ S D   R+W
Sbjct: 675 GSKDRGVLFW--DTPSGNPLLMLQGHRNSVISVAVANDHPLGPEYGVFATGSGDCKARIW 732

Query: 249 NYVEEEENGE 258
            Y ++  N E
Sbjct: 733 KYSKQTSNAE 742

 Score = 42.0 bits (97), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 45/163 (27%), Positives = 76/163 (46%), Gaps = 21/163 (12%)

Query: 45  LMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSVSFRPHSSILAAGSFDSTISIW 104
            +AT + D+ I++ +L     ++V  L    H++ + S+ + P    L +GS D T+ IW
Sbjct: 484 FLATGAEDKLIRIWDLATR--RIVMTLQG--HEQDIYSLDYFPSGDKLVSGSGDRTVRIW 539

Query: 105 GKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHS-GYYLASCSRDKSVWIWEADELGE 163
                     D   T   ++    E+ V  V+ S   G  +A+ S D++V IW++ E G 
Sbjct: 540 ----------DL-RTGQCSLTLSIEDGVTTVAVSPGDGKLIAAGSLDRTVRIWDS-ETGF 587

Query: 164 EYECLSVLQE----HAQDVKHVVWHSEMHLLASSSYDDTIRLW 202
             E L    E    H   V  VV+  + H + S S D +++LW
Sbjct: 588 LVERLDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLW 630

>CAGL0J08778g 866175..867071 highly similar to sp|Q04491
           Saccharomyces cerevisiae YLR208w SEC13, start by
           similarity
          Length = 298

 Score = 57.8 bits (138), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 49/163 (30%), Positives = 77/163 (47%), Gaps = 11/163 (6%)

Query: 121 LLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKH 180
           ++ I   H + +      + G  LA+CS DK++ I+E +  GE ++ +  L  H   V  
Sbjct: 1   MVEIANAHNDLIHDAVLDYYGKKLATCSSDKTIKIFEVE--GESHKLVDTLVGHEGPVWR 58

Query: 181 VVW-HSEMH-LLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLAS 238
           V W H +   +LAS SYD  + +WKE+ D W   AV   H  +V    +   E    L +
Sbjct: 59  VDWAHPKFGTILASCSYDGKVIIWKEENDRWSQIAVHAVHTASVNSVQWAPHEYGALLLA 118

Query: 239 CSDDSTVRVWNYVEEEENGEDVWAQEAILPNVHSRAVYSVSWS 281
            S D  V V   VE +ENG        ++ + H+  V + SW+
Sbjct: 119 ASSDGKVSV---VEFKENG----TATPLIFDAHAIGVNAASWA 154

 Score = 57.4 bits (137), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 66/267 (24%), Positives = 107/267 (40%), Gaps = 41/267 (15%)

Query: 46  MATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSVSF--RPHSSILAAGSFDSTISI 103
           +AT SSD+ IK+  ++    +LV+ L    H+  V  V +      +ILA+ S+D  + I
Sbjct: 24  LATCSSDKTIKIFEVEGESHKLVDTL--VGHEGPVWRVDWAHPKFGTILASCSYDGKVII 81

Query: 104 WGKEEDADPQDDFPETELLAIIEGHENEVKAVSWS--HSGYYLASCSRDKSVWIWEADEL 161
           W +E D   Q        +A+   H   V +V W+    G  L + S D  V + E  E 
Sbjct: 82  WKEENDRWSQ--------IAVHAVHTASVNSVQWAPHEYGALLLAASSDGKVSVVEFKEN 133

Query: 162 GEEYECLSVLQEHAQDVKHVVWHS--------------EMHLLASSSYDDTIRLWKEDAD 207
           G       +   HA  V    W                E+    +   D+ +++W+ + +
Sbjct: 134 GTATPL--IFDAHAIGVNAASWAPATVEGGNNPGEAPKEVRRFVTGGADNLVKIWRYNPE 191

Query: 208 --DWECAAVLNGHKGTVWCSDFEKSESSL---RLASCSDDSTVRVWNYVEEEENGEDVWA 262
              +     L GH    W  D   S S L    +AS S D T  +W     +E+    W 
Sbjct: 192 TQSYLVEDTLEGHSD--WVRDVAWSPSVLLRSYIASVSQDRTCNIWT----QEDNTGPWV 245

Query: 263 QEAILPNVHSRAVYSVSWSLDGYIASV 289
           +  + P      ++  SWSL G I ++
Sbjct: 246 KTQLTPEEFPDVLWRASWSLSGNILAI 272

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 51/173 (29%), Positives = 75/173 (43%), Gaps = 25/173 (14%)

Query: 190 LASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWN 249
           LA+ S D TI++++ + +  +    L GH+G VW  D+   +    LASCS D  V +W 
Sbjct: 24  LATCSSDKTIKIFEVEGESHKLVDTLVGHEGPVWRVDWAHPKFGTILASCSYDGKVIIW- 82

Query: 250 YVEEEENGEDVWAQEAILPNVHSRAVYSVSWSLDGYIA---SVGSDGLLXXXXXXXXXXX 306
              +EEN  D W+Q A+   VH+ +V SV W+   Y A   +  SDG +           
Sbjct: 83  ---KEEN--DRWSQIAVHA-VHTASVNSVQWAPHEYGALLLAASSDGKVSVVEFKENGTA 136

Query: 307 XXXXQQHEAHGIYEINVVKWATV------------DDSVLLLTGGDDGCANIW 347
                  +AH I  +N   WA               +    +TGG D    IW
Sbjct: 137 TPLI--FDAHAI-GVNAASWAPATVEGGNNPGEAPKEVRRFVTGGADNLVKIW 186

 Score = 48.1 bits (113), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 51/202 (25%), Positives = 82/202 (40%), Gaps = 33/202 (16%)

Query: 37  WSIDCSKGLMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSVSFRPHS------- 89
           W+      L+  +SSD K+ +V  K          D   H   V + S+ P +       
Sbjct: 107 WAPHEYGALLLAASSDGKVSVVEFKENGTATPLIFD--AHAIGVNAASWAPATVEGGNNP 164

Query: 90  -------SILAAGSFDSTISIWGKEEDADPQDDFPETELLAI---IEGHENEVKAVSWSH 139
                       G  D+ + IW            PET+   +   +EGH + V+ V+WS 
Sbjct: 165 GEAPKEVRRFVTGGADNLVKIWRYN---------PETQSYLVEDTLEGHSDWVRDVAWSP 215

Query: 140 SGY---YLASCSRDKSVWIW-EADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSY 195
           S     Y+AS S+D++  IW + D  G   +     +E    +    W    ++LA S  
Sbjct: 216 SVLLRSYIASVSQDRTCNIWTQEDNTGPWVKTQLTPEEFPDVLWRASWSLSGNILAISGG 275

Query: 196 DDTIRLWKEDAD-DWECAAVLN 216
           D+ + LWKE+ +  WE A  +N
Sbjct: 276 DNKVTLWKENLNGKWESAGEVN 297

>Scas_674.20
          Length = 297

 Score = 57.8 bits (138), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 50/163 (30%), Positives = 78/163 (47%), Gaps = 11/163 (6%)

Query: 121 LLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKH 180
           ++AI   H + +      + G  LA+CS DK++ I+E +  GE ++ ++ L+ H   V  
Sbjct: 1   MVAIANAHNDLIHDAVLDYYGKRLATCSSDKTIKIFEVE--GETHKEVATLEGHDGPVWR 58

Query: 181 VVW-HSEMH-LLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLAS 238
           V W H +   +LAS SYD  + +WKE+   W   A    H  +V    +   E    L +
Sbjct: 59  VDWAHPKFGTILASCSYDGKVLIWKEENGRWSQIACHAVHSASVNSVQWAPHEYGALLLA 118

Query: 239 CSDDSTVRVWNYVEEEENGEDVWAQEAILPNVHSRAVYSVSWS 281
            S D  V V   VE +ENG        I+ + H+  V S SW+
Sbjct: 119 ASSDGKVSV---VEFKENG----TLTPIIIDAHNIGVNSASWA 154

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 54/172 (31%), Positives = 76/172 (44%), Gaps = 24/172 (13%)

Query: 190 LASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWN 249
           LA+ S D TI++++ + +  +  A L GH G VW  D+   +    LASCS D  V +W 
Sbjct: 24  LATCSSDKTIKIFEVEGETHKEVATLEGHDGPVWRVDWAHPKFGTILASCSYDGKVLIW- 82

Query: 250 YVEEEENGEDVWAQEAILPNVHSRAVYSVSWSLDGYIA---SVGSDGLLXXXXXXXXXXX 306
              +EENG   W+Q A    VHS +V SV W+   Y A   +  SDG +           
Sbjct: 83  ---KEENGR--WSQIACHA-VHSASVNSVQWAPHEYGALLLAASSDGKVSVVEFKENGTL 136

Query: 307 XXXXQQHEAHGIYEINVVKWATV-----------DDSVLLLTGGDDGCANIW 347
                  +AH I  +N   WA             ++S   +TGG D    IW
Sbjct: 137 TPIII--DAHNI-GVNSASWAPATLQENKPTKSPEESRRFVTGGADNLVKIW 185

 Score = 50.1 bits (118), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 52/189 (27%), Positives = 85/189 (44%), Gaps = 28/189 (14%)

Query: 44  GLMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSVSFRP-------------HSS 90
            L+  +SSD K+ +V  K  +  L   + D+ H   V S S+ P              S 
Sbjct: 114 ALLLAASSDGKVSVVEFKE-NGTLTPIIIDA-HNIGVNSASWAPATLQENKPTKSPEESR 171

Query: 91  ILAAGSFDSTISIWGKEEDADPQDDFPETELLA-IIEGHENEVKAVSWSHS---GYYLAS 146
               G  D+ + IW    ++       +T LL   ++GH + V+ V+WS S     Y+AS
Sbjct: 172 RFVTGGADNLVKIWKYNNES-------QTYLLEDTLQGHSDWVRDVAWSPSVLLRSYIAS 224

Query: 147 CSRDKSVWIWEADELGEEYECLSVLQEHAQDVK-HVVWHSEMHLLASSSYDDTIRLWKED 205
            S+DK+  IW  +     ++   + +E   DV     W    ++LA S  D+ + LWKE+
Sbjct: 225 VSQDKTCIIWTQENNDSSWKKTELQKERFPDVLWRASWSLSGNILALSGGDNKVTLWKEN 284

Query: 206 AD-DWECAA 213
            + +WE A 
Sbjct: 285 LEGNWEPAG 293

 Score = 43.9 bits (102), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 64/266 (24%), Positives = 102/266 (38%), Gaps = 40/266 (15%)

Query: 46  MATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSVSF--RPHSSILAAGSFDSTISI 103
           +AT SSD+ IK+  ++    + V  L+   H   V  V +      +ILA+ S+D  + I
Sbjct: 24  LATCSSDKTIKIFEVEGETHKEVATLEG--HDGPVWRVDWAHPKFGTILASCSYDGKVLI 81

Query: 104 WGKEEDADPQDDFPETELLAIIEGHENEVKAVSWS--HSGYYLASCSRDKSVWIWEADEL 161
           W +E     Q        +A    H   V +V W+    G  L + S D  V + E  E 
Sbjct: 82  WKEENGRWSQ--------IACHAVHSASVNSVQWAPHEYGALLLAASSDGKVSVVEFKEN 133

Query: 162 GEEYECLSVLQEHAQDVKHVVWHS-------------EMHLLASSSYDDTIRLWK--EDA 206
           G       ++  H   V    W               E     +   D+ +++WK   ++
Sbjct: 134 GTLTPI--IIDAHNIGVNSASWAPATLQENKPTKSPEESRRFVTGGADNLVKIWKYNNES 191

Query: 207 DDWECAAVLNGHKGTVWCSDFEKSESSL---RLASCSDDSTVRVWNYVEEEENGEDVWAQ 263
             +     L GH    W  D   S S L    +AS S D T  +W     +EN +  W +
Sbjct: 192 QTYLLEDTLQGHSD--WVRDVAWSPSVLLRSYIASVSQDKTCIIWT----QENNDSSWKK 245

Query: 264 EAILPNVHSRAVYSVSWSLDGYIASV 289
             +        ++  SWSL G I ++
Sbjct: 246 TELQKERFPDVLWRASWSLSGNILAL 271

>KLLA0F13244g 1224178..1226622 similar to sgd|S0004212 Saccharomyces
           cerevisiae YLR222c, start by similarity
          Length = 814

 Score = 58.5 bits (140), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 37/149 (24%), Positives = 65/149 (43%), Gaps = 16/149 (10%)

Query: 76  HKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAV 135
           H+K + ++S  P+ S+ A  S+D T  IW          +  + E  A +  H+  +  V
Sbjct: 494 HEKDINAISISPNDSLFATASYDKTCKIW----------NLDDGEFQATLANHKRGLWDV 543

Query: 136 SWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSY 195
           ++      LA+CS DK++ IW      E Y  +  L+ H   V+   + ++   L S+  
Sbjct: 544 AFCQYDKLLATCSGDKTIKIWSL----ESYAVVKTLEGHTNAVQRCSFINKNKQLISTGA 599

Query: 196 DDTIRLWKEDADDWECAAVLNGHKGTVWC 224
           D  + +W  D    E    L+ H   +W 
Sbjct: 600 DGLVIIW--DLSTGESVKTLDAHNNRIWA 626

 Score = 35.0 bits (79), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 45/199 (22%), Positives = 90/199 (45%), Gaps = 25/199 (12%)

Query: 108 EDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYEC 167
           E+ + ++ FP    + + EGH + + ++  +  G ++A+ S+D SV +W      E++  
Sbjct: 371 ENGENKETFPIE--VKMYEGHTDLLNSLDATADGLWVATASKDHSVILWRYHAKYEDFYP 428

Query: 168 LSVLQEHAQDVKHVVWHSEM-----HLLASSSYDDTIRLWKED---ADDWECAAVLNGHK 219
            +    H   V  V   + M       + ++S D TI+ WK     +D+ E   ++   +
Sbjct: 429 YTKFVGHVGSVNAVGLPNVMPRSWPEFIITASNDLTIKKWKVPKVTSDEPEDLILVKTSE 488

Query: 220 GTVWCSDFEKSESSLR-----LASCSDDSTVRVWNYVEEEENGEDVWAQEAILPNVHSRA 274
            T    + + +  S+       A+ S D T ++WN     ++GE     +A L N H R 
Sbjct: 489 YTRRAHEKDINAISISPNDSLFATASYDKTCKIWNL----DDGE----FQATLAN-HKRG 539

Query: 275 VYSVSW-SLDGYIASVGSD 292
           ++ V++   D  +A+   D
Sbjct: 540 LWDVAFCQYDKLLATCSGD 558

>CAGL0E02805g complement(265137..267659) similar to sp|P32479
           Saccharomyces cerevisiae YBL008w HIR1 histone
           transcription regulator, start by similarity
          Length = 840

 Score = 58.5 bits (140), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 60/230 (26%), Positives = 92/230 (40%), Gaps = 36/230 (15%)

Query: 80  VRSVSFRPHSSILAAGSFDSTISIW---------GKEEDADPQDDFPETELLAIIEGHEN 130
           + +V   P    +A G  D  I IW           E   D     P    LA +  H  
Sbjct: 20  IYTVDVSPDGKRVATGGLDGKIRIWSVDALVSAAAGESGVDRDTHRP----LASMSRHTG 75

Query: 131 EVKAVSWSHSGYYLASCSRDKSVWIWEADE------LGEEYE-----CLSVLQEHAQDVK 179
            V  V +S  G YLAS S D+ + IW  DE       G E E         L  H  D++
Sbjct: 76  SVTCVKFSPDGNYLASGSDDRILLIWAMDEENHGGSFGSEGEKEHWTVRKRLVAHDNDIQ 135

Query: 180 HVVWHSEMHLLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASC 239
            + W  +  +L +   D ++ +W  +  ++E     + H+  V    F+ +      A+ 
Sbjct: 136 DICWAPDSSILVTVGLDRSVIVW--NGLNFERLKRFDVHQSLVKGVIFDPANKY--FATA 191

Query: 240 SDDSTVRVWNYVEEEENGEDVWAQEAIL--PNVHSRAV---YSVSWSLDG 284
           SDD T+RV+ Y    + GE  +  E ++  P + S        +SWS DG
Sbjct: 192 SDDRTMRVFRY---HKTGEVSFTIEQVIVEPFIASPLTTYFRRLSWSPDG 238

>Kwal_14.1611
          Length = 334

 Score = 57.8 bits (138), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 67/142 (47%), Gaps = 9/142 (6%)

Query: 123 AIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVV 182
             I GHE+ V  +S+   G ++A+CS D+ + ++       E++     + H   V  + 
Sbjct: 3   PFITGHEDLVHDISYDFYGRHVATCSSDQHIKVFRLVRETNEWQLSDSWKAHDSSVVGLD 62

Query: 183 WHSEMH--LLASSSYDDTIRLWKEDADDWECAA-------VLNGHKGTVWCSDFEKSESS 233
           W S  +  ++AS SYD  + LW+E+ D  EC+         LN   G ++   F      
Sbjct: 63  WASPEYGRIIASVSYDKQVNLWEEEPDAAECSGRRWTKLCTLNDATGPLFSVKFAPGHLG 122

Query: 234 LRLASCSDDSTVRVWNYVEEEE 255
           L+L +  +D  +R++  +E  +
Sbjct: 123 LKLGAIGNDGILRIYEAMEPSD 144

 Score = 41.6 bits (96), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 76/295 (25%), Positives = 118/295 (40%), Gaps = 55/295 (18%)

Query: 46  MATSSSDRKIKLVNLKNMDFQLVEE-----LDDS--THKKSVRSVSFRP--HSSILAAGS 96
           +AT SSD+ IK+       F+LV E     L DS   H  SV  + +    +  I+A+ S
Sbjct: 24  VATCSSDQHIKV-------FRLVRETNEWQLSDSWKAHDSSVVGLDWASPEYGRIIASVS 76

Query: 97  FDSTISIWGKEEDADPQDDFPETELLAI--IEGHENEVKAVSWSHSGYYLASCSRDKSVW 154
           +D  +++W +E DA        T+L  +    G    VK     H G  L +   D  + 
Sbjct: 77  YDKQVNLWEEEPDAAECSGRRWTKLCTLNDATGPLFSVKFAP-GHLGLKLGAIGNDGILR 135

Query: 155 IWEADE--------LGEEYECL-SVLQEHAQDVKHVVW---HSEMHLLASSSYDDTIRLW 202
           I+EA E        L  E + L S    H Q    + W         L   + D  +   
Sbjct: 136 IYEAMEPSDLRSWTLTSEVKVLPSPPASHLQSDFCLTWCPSRFSPEKLIVCALDQALIYQ 195

Query: 203 KEDADDWECAAVLNGHKGTVWCSDFEKSESS--LRLASCSDDSTVRVWNYVEEEENGEDV 260
           K+ A     AA L GH G +    +  S       +A+   D  VR++  +E  ++ +D 
Sbjct: 196 KDKAGKLYVAAKLEGHAGLIRSVSWAPSVGRWYQLIATACKDGKVRIFKLMETAQDDQDA 255

Query: 261 WAQEAI----------LPNV-----------HSRAVYSVSWSLDGYI-ASVGSDG 293
            + + +          +P+            H   V+SVSW+L G I +S G DG
Sbjct: 256 MSVDQVEEESENGSESIPSSLKVELVSESDDHRGEVWSVSWNLTGTILSSAGDDG 310

 Score = 35.4 bits (80), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 33/54 (61%), Gaps = 1/54 (1%)

Query: 118 ETELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVL 171
           + EL++  + H  EV +VSW+ +G  L+S   D  V +W+A     E++C+SV+
Sbjct: 277 KVELVSESDDHRGEVWSVSWNLTGTILSSAGDDGKVRLWKA-SYSSEFKCMSVI 329

 Score = 30.4 bits (67), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 29/128 (22%), Positives = 58/128 (45%), Gaps = 31/128 (24%)

Query: 123 AIIEGHENEVKAVSWSHS--GYY--LASCSRDKSVWIWEADELGEE-------------- 164
           A +EGH   +++VSW+ S   +Y  +A+  +D  V I++  E  ++              
Sbjct: 206 AKLEGHAGLIRSVSWAPSVGRWYQLIATACKDGKVRIFKLMETAQDDQDAMSVDQVEEES 265

Query: 165 ------------YECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWKED-ADDWEC 211
                        E +S   +H  +V  V W+    +L+S+  D  +RLWK   + +++C
Sbjct: 266 ENGSESIPSSLKVELVSESDDHRGEVWSVSWNLTGTILSSAGDDGKVRLWKASYSSEFKC 325

Query: 212 AAVLNGHK 219
            +V++  +
Sbjct: 326 MSVISAQQ 333

>Kwal_56.23920
          Length = 937

 Score = 58.5 bits (140), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 58/242 (23%), Positives = 98/242 (40%), Gaps = 42/242 (17%)

Query: 32  HTDKLWSIDCSK--GLMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKK----------- 78
           H+  +WS+D +     + T S+D+ +        DFQ+ +E    T  K           
Sbjct: 466 HSGAIWSLDMTTDGKRLVTGSADKTVCF-----WDFQVEQEPVPGTTDKFNPKLKMFHDT 520

Query: 79  ------SVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEV 132
                  V +V   P + +LA    D+T+ ++  +            +    + GH+  V
Sbjct: 521 TLELNDDVLAVKISPDNRLLAVSLLDNTVKVFFMDS----------MKFFLSLYGHKLPV 570

Query: 133 KAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLAS 192
            ++  S     L + S DK++ IW  D  G+   C   L  H   +  VV+  E H   S
Sbjct: 571 LSIDISFDSKLLITSSADKNIKIWGLD-FGD---CHRSLFAHNDSIMKVVFVPESHNFFS 626

Query: 193 SSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNYVE 252
            S D  ++ W  D D +EC   L  H+  VW      S     + S S D ++RVW+  +
Sbjct: 627 CSKDALVKYW--DGDKFECIQKLAAHQKEVWT--LAISSDGRFVVSASHDQSIRVWSETD 682

Query: 253 EE 254
           ++
Sbjct: 683 DQ 684

 Score = 57.0 bits (136), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 50/181 (27%), Positives = 81/181 (44%), Gaps = 19/181 (10%)

Query: 28  SLKLHTDKLW-SIDCSKGLMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSVSFR 86
           +L+L+ D L   I     L+A S  D  +K+  + +M F L        HK  V S+   
Sbjct: 521 TLELNDDVLAVKISPDNRLLAVSLLDNTVKVFFMDSMKFFL----SLYGHKLPVLSIDIS 576

Query: 87  PHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLAS 146
             S +L   S D  I IWG         DF +      +  H + +  V +    +   S
Sbjct: 577 FDSKLLITSSADKNIKIWGL--------DFGDCH--RSLFAHNDSIMKVVFVPESHNFFS 626

Query: 147 CSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDA 206
           CS+D  V  W+    G+++EC+  L  H ++V  +   S+   + S+S+D +IR+W E  
Sbjct: 627 CSKDALVKYWD----GDKFECIQKLAAHQKEVWTLAISSDGRFVVSASHDQSIRVWSETD 682

Query: 207 D 207
           D
Sbjct: 683 D 683

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 45/184 (24%), Positives = 74/184 (40%), Gaps = 21/184 (11%)

Query: 74  STHKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVK 133
           ST       + + P + +LA G  D  I IW          D     +L    GH++ + 
Sbjct: 72  STKPAETSYLQYHPETRLLAVGYNDGAIKIW----------DLLSKSVLISFNGHKSAIT 121

Query: 134 AVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASS 193
            +++  +G  L S SRD  + +W  D +GE    L  L+ H   +   +W      L S+
Sbjct: 122 ILTFDQTGTRLISGSRDSDIIVW--DLVGE--VGLYKLRSHKDSITG-LWCEGEEWLIST 176

Query: 194 SYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNYVEE 253
           S D  I++W  D    +C      H G  W     +      + +   D+ +++WN   E
Sbjct: 177 SKDGLIKVW--DLKVQQCVETHVAHVGECWSMGVHED----LVITAGADNQIKLWNLNFE 230

Query: 254 EENG 257
           E  G
Sbjct: 231 ESAG 234

 Score = 34.7 bits (78), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 41/177 (23%), Positives = 72/177 (40%), Gaps = 27/177 (15%)

Query: 85  FRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEG-HENEVKAVSWSHSGYY 143
           F P  +++  G+    + ++          D   + LL  IEG H   + ++  +  G  
Sbjct: 432 FLPGGALVVLGTKTGDLHLY----------DLASSTLLNTIEGAHSGAIWSLDMTTDGKR 481

Query: 144 LASCSRDKSVWIWE-----------ADELGEEYECL-SVLQEHAQDVKHVVWHSEMHLLA 191
           L + S DK+V  W+            D+   + +       E   DV  V    +  LLA
Sbjct: 482 LVTGSADKTVCFWDFQVEQEPVPGTTDKFNPKLKMFHDTTLELNDDVLAVKISPDNRLLA 541

Query: 192 SSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVW 248
            S  D+T++++  D+  +  +  L GHK  V   D   S  S  L + S D  +++W
Sbjct: 542 VSLLDNTVKVFFMDSMKFFLS--LYGHKLPVLSIDI--SFDSKLLITSSADKNIKIW 594

>Sklu_2420.2 YPL151C, Contig c2420 3924-5249
          Length = 441

 Score = 57.4 bits (137), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 50/175 (28%), Positives = 76/175 (43%), Gaps = 19/175 (10%)

Query: 76  HKKSVRSVSFRP-HSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKA 134
           H   VR+V+  P  +   A GS D+TI IW          D    +L   + GH   VK 
Sbjct: 128 HNGWVRTVAVDPIDNEWFATGSNDTTIKIW----------DLATGKLKLTLSGHIMTVKD 177

Query: 135 VSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSS 194
           +  S    Y+ S S DK V  W+     E+   +     H   V  V  H  ++L+A++ 
Sbjct: 178 ICISKRHPYMFSASEDKLVKCWDL----EKNRVIRDYHGHLSGVHTVDIHPTLNLIATAG 233

Query: 195 YDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWN 249
            D  +RLW  D         + GHK  +  +  +      ++ SCS D+TVR+W+
Sbjct: 234 RDSVVRLW--DIRTKLPVMTMAGHKSPI--NRVKCLPVDPQVVSCSADATVRLWD 284

>CAGL0L00781g 95506..97527 similar to sp|P39014 Saccharomyces
           cerevisiae YIL046w MET30, hypothetical start
          Length = 673

 Score = 57.8 bits (138), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 47/174 (27%), Positives = 81/174 (46%), Gaps = 25/174 (14%)

Query: 76  HKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAV 135
           H   V ++ F  +  +L  GS+D+T++IW          D    +L+  + GH + VK +
Sbjct: 333 HMDGVLTLQF--NYRLLFTGSYDTTVAIW----------DLFTGKLIRRLTGHSDGVKTL 380

Query: 136 SWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSY 195
            +      L + S DK++ +W         EC+S  + H   V  V  H +  ++ S S 
Sbjct: 381 YFDDQK--LITGSLDKTIRVWNY----ITGECISTYRGHTDSVMSVDSHKK--IIVSGSA 432

Query: 196 DDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWN 249
           D T+++W  ++        L GH  T W +  +    S    SCSDD+T+R+W+
Sbjct: 433 DKTVKVWHVES---RTCYTLKGH--TEWVNCVKLHPKSFSCYSCSDDTTIRMWD 481

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 65/272 (23%), Positives = 102/272 (37%), Gaps = 68/272 (25%)

Query: 20  RMSLELLKSLKLHTDKLWSIDCSKGLMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKS 79
           R  L  ++  K H D + ++  +  L+ T S D  + + +L     +L+  L  + H   
Sbjct: 321 RKGLCTIQEFKGHMDGVLTLQFNYRLLFTGSYDTTVAIWDL--FTGKLIRRL--TGHSDG 376

Query: 80  VRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSH 139
           V+++ F      L  GS D TI +W          ++   E ++   GH + V +V  SH
Sbjct: 377 VKTLYFDDQK--LITGSLDKTIRVW----------NYITGECISTYRGHTDSVMSVD-SH 423

Query: 140 SGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTI 199
               + S S DK+V +W      E   C + L+ H + V  V  H +     S S D TI
Sbjct: 424 KKI-IVSGSADKTVKVWHV----ESRTCYT-LKGHTEWVNCVKLHPKSFSCYSCSDDTTI 477

Query: 200 RLWKEDADDWECAAVLNGHKGTVWC--------------------------------SDF 227
           R+W  D     C  V  GH G V                                   D 
Sbjct: 478 RMW--DIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDP 535

Query: 228 EKSESSLR-----------LASCSDDSTVRVW 248
           E   +  R           L SC+ D+T+++W
Sbjct: 536 ENGVNGQRELDKKMPYPTHLLSCALDNTIKLW 567

 Score = 33.1 bits (74), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 45/241 (18%), Positives = 90/241 (37%), Gaps = 68/241 (28%)

Query: 24  ELLKSLKLHTDKLWSIDCSKGLMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSV 83
           E + + + HTD + S+D  K ++ + S+D+ +K+ ++++     ++      H + V  V
Sbjct: 405 ECISTYRGHTDSVMSVDSHKKIIVSGSADKTVKVWHVESRTCYTLK-----GHTEWVNCV 459

Query: 84  SFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAV-------- 135
              P S    + S D+TI +W          D      L +  GH  +V+ V        
Sbjct: 460 KLHPKSFSCYSCSDDTTIRMW----------DIRTNTCLRVFRGHVGQVQKVIPLTIIDA 509

Query: 136 ----------------SWSHSG---------------------YYLASCSRDKSVWIWEA 158
                           + + +G                      +L SC+ D ++ +WE 
Sbjct: 510 QNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCALDNTIKLWEV 569

Query: 159 DELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDADDWECAAVLNGH 218
                   C+     H + V  +   ++   + S S+D +I++W  D    +C    +G 
Sbjct: 570 ----RSGRCIRTQFGHVEGVWDIA--ADNFRIISGSHDGSIKIW--DLQSGKCMHTFHGR 621

Query: 219 K 219
           K
Sbjct: 622 K 622

 Score = 33.1 bits (74), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 32/66 (48%), Gaps = 6/66 (9%)

Query: 189 LLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVW 248
           LL + SYD T+ +W  D    +    L GH   V    F+      +L + S D T+RVW
Sbjct: 346 LLFTGSYDTTVAIW--DLFTGKLIRRLTGHSDGVKTLYFDDQ----KLITGSLDKTIRVW 399

Query: 249 NYVEEE 254
           NY+  E
Sbjct: 400 NYITGE 405

>YLR129W (DIP2) [3539] chr12 (399658..402489) Component of U3 snoRNP
           (renamed small subunit processome - SSU processome),
           which is required for 18S rRNA biogenesis [2832 bp, 943
           aa]
          Length = 943

 Score = 57.8 bits (138), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 53/193 (27%), Positives = 84/193 (43%), Gaps = 27/193 (13%)

Query: 24  ELLKSLKLH-------TDKLWSIDCSKG--LMATSSSDRKIKLVNLKNMDFQLVEELDDS 74
           + L  LKLH       TD +  +  S     +A S  D  +K+  L +M F L       
Sbjct: 515 KFLPVLKLHHDTTLELTDDILCVRVSPDDRYLAISLLDNTVKVFFLDSMKFYL----SLY 570

Query: 75  THKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKA 134
            HK  V S+     S ++   S D  I IWG         DF +      +  H++ +  
Sbjct: 571 GHKLPVLSIDISFDSKMIITSSADKNIKIWGL--------DFGDCH--KSLFAHQDSIMN 620

Query: 135 VSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSS 194
           V +    +   SCS+D  V  W+    GE++EC+  L  H  +V  +   ++   + SSS
Sbjct: 621 VKFLPQSHNFFSCSKDAVVKYWD----GEKFECIQKLYAHQSEVWALAVATDGGFVVSSS 676

Query: 195 YDDTIRLWKEDAD 207
           +D +IR+W+E  D
Sbjct: 677 HDHSIRIWEETED 689

 Score = 47.8 bits (112), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 51/237 (21%), Positives = 95/237 (40%), Gaps = 32/237 (13%)

Query: 32  HTDKLWSIDCSK--GLMATSSSDRKIKL----------VNLKNMDFQLVEELDDSTHKKS 79
           H   +WS+D +     + T S+D+ +K              KN    +++   D+T + +
Sbjct: 472 HDAAIWSLDLTSDGKRLVTGSADKTVKFWDFKVENSLVPGTKNKFLPVLKLHHDTTLELT 531

Query: 80  --VRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSW 137
             +  V   P    LA    D+T+ ++               +    + GH+  V ++  
Sbjct: 532 DDILCVRVSPDDRYLAISLLDNTVKVFF----------LDSMKFYLSLYGHKLPVLSIDI 581

Query: 138 SHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDD 197
           S     + + S DK++ IW  D  G+   C   L  H   + +V +  + H   S S D 
Sbjct: 582 SFDSKMIITSSADKNIKIWGLD-FGD---CHKSLFAHQDSIMNVKFLPQSHNFFSCSKDA 637

Query: 198 TIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNYVEEE 254
            ++ W  D + +EC   L  H+  VW      +     + S S D ++R+W   E++
Sbjct: 638 VVKYW--DGEKFECIQKLYAHQSEVWA--LAVATDGGFVVSSSHDHSIRIWEETEDQ 690

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/170 (24%), Positives = 68/170 (40%), Gaps = 22/170 (12%)

Query: 89  SSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLASCS 148
           + +LA G  D  I +W          D     +L    GH+  +  + +  +G  L S S
Sbjct: 91  TDLLAVGYADGVIKVW----------DLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGS 140

Query: 149 RDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDADD 208
           +D ++ +W  D +GE    L  L+ H   +    W      L S+S D  I+LW  D   
Sbjct: 141 KDSNIIVW--DLVGE--VGLYKLRSHKDSITG-FWCQGEDWLISTSKDGMIKLW--DLKT 193

Query: 209 WECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNY-VEEEENG 257
            +C      H G  W    +       L +   DS V++W   +E ++ G
Sbjct: 194 HQCIETHIAHTGECWGLAVKDD----LLITTGTDSQVKIWKLDIENDKMG 239

 Score = 29.3 bits (64), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 28/138 (20%), Positives = 59/138 (42%), Gaps = 17/138 (12%)

Query: 71  LDDSTHKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHEN 130
           L+ + HK ++  + F    + L +GS DS I +W          D      L  +  H++
Sbjct: 115 LNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVW----------DLVGEVGLYKLRSHKD 164

Query: 131 EVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLL 190
            +    W     +L S S+D  + +W+     + ++C+     H  +   +    +  LL
Sbjct: 165 SITGF-WCQGEDWLISTSKDGMIKLWDL----KTHQCIETHIAHTGECWGLAVKDD--LL 217

Query: 191 ASSSYDDTIRLWKEDADD 208
            ++  D  +++WK D ++
Sbjct: 218 ITTGTDSQVKIWKLDIEN 235

>Kwal_47.17465
          Length = 800

 Score = 57.8 bits (138), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 64/135 (47%), Gaps = 9/135 (6%)

Query: 74  STHKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDAD-----PQDDFPETELLAIIEGH 128
           S H  SV  V F P  + LA+GS D  + IW K+ED        ++D     +   +  H
Sbjct: 19  SRHTGSVTVVRFSPDGNFLASGSDDRILLIWEKDEDQKQPIFGAENDKEHWNVRRRLVAH 78

Query: 129 ENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMH 188
           +N+++ + W+     L +   D+SV +W     G  +E +     H   VK V++     
Sbjct: 79  DNDIQDICWAPDSSILVTVGLDRSVIVWN----GSTFEKIKRFDVHQSLVKGVIFDPANK 134

Query: 189 LLASSSYDDTIRLWK 203
             A++S D T+R+++
Sbjct: 135 YFATASDDRTVRIFR 149

 Score = 52.4 bits (124), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 38/140 (27%), Positives = 62/140 (44%), Gaps = 15/140 (10%)

Query: 122 LAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADE------LGEE-----YECLSV 170
           LA +  H   V  V +S  G +LAS S D+ + IWE DE       G E     +     
Sbjct: 15  LASMSRHTGSVTVVRFSPDGNFLASGSDDRILLIWEKDEDQKQPIFGAENDKEHWNVRRR 74

Query: 171 LQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKS 230
           L  H  D++ + W  +  +L +   D ++ +W  +   +E     + H+  V    F+ +
Sbjct: 75  LVAHDNDIQDICWAPDSSILVTVGLDRSVIVW--NGSTFEKIKRFDVHQSLVKGVIFDPA 132

Query: 231 ESSLRLASCSDDSTVRVWNY 250
                 A+ SDD TVR++ Y
Sbjct: 133 NKY--FATASDDRTVRIFRY 150

>YIL046W (MET30) [2621] chr9 (268650..270572) F-box protein that
           targets proteins for ubiquitination by interacting with
           the SCF complex (Skp1p-Cdc53p-Cdc34p), regulates sulfur
           assimilation genes in response to S-adenosylmethionine
           levels, contains five WD (WD-40) repeats [1923 bp, 640
           aa]
          Length = 640

 Score = 57.4 bits (137), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 49/174 (28%), Positives = 80/174 (45%), Gaps = 25/174 (14%)

Query: 76  HKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAV 135
           H   V ++ F  +  +L  GS+DSTI IW          D    +L+  + GH + VK +
Sbjct: 301 HMDGVLTLQF--NYRLLFTGSYDSTIGIW----------DLFTGKLIRRLSGHSDGVKTL 348

Query: 136 SWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSY 195
            +      L + S DK++ +W         EC+S  + H+  V  V   S   ++ S S 
Sbjct: 349 YFDDRK--LITGSLDKTIRVWNY----ITGECISTYRGHSDSVLSV--DSYQKVIVSGSA 400

Query: 196 DDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWN 249
           D T+++W  ++        L GH  T W +  +    S    SCSDD+T+R+W+
Sbjct: 401 DKTVKVWHVES---RTCYTLRGH--TEWVNCVKLHPKSFSCFSCSDDTTIRMWD 449

 Score = 41.6 bits (96), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 52/236 (22%), Positives = 95/236 (40%), Gaps = 40/236 (16%)

Query: 24  ELLKSLKLHTDKLWSIDCSKGLMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSV 83
           E + + + H+D + S+D  + ++ + S+D+ +K+ ++++     +       H + V  V
Sbjct: 373 ECISTYRGHSDSVLSVDSYQKVIVSGSADKTVKVWHVESRTCYTLR-----GHTEWVNCV 427

Query: 84  SFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAV-------- 135
              P S    + S D+TI +W          D      L +  GH  +V+ +        
Sbjct: 428 KLHPKSFSCFSCSDDTTIRMW----------DIRTNSCLKVFRGHVGQVQKIIPLTIKDV 477

Query: 136 -SWSHSGYYLASCSRDKSVWIWEADEL-GEEYECLSVLQEHAQDVKHVVWHSEMHLLASS 193
            + +       S  +D       ADE      E  +VL E+     H         L S 
Sbjct: 478 ENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTH---------LLSC 528

Query: 194 SYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWN 249
             D+TI+LW  D    +C     GH   VW    + +  + R+ S S D +++VW+
Sbjct: 529 GLDNTIKLW--DVKTGKCIRTQFGHVEGVW----DIAADNFRIISGSHDGSIKVWD 578

 Score = 33.9 bits (76), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 33/67 (49%), Gaps = 6/67 (8%)

Query: 188 HLLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRV 247
            LL + SYD TI +W  D    +    L+GH   V    F+      +L + S D T+RV
Sbjct: 313 RLLFTGSYDSTIGIW--DLFTGKLIRRLSGHSDGVKTLYFDDR----KLITGSLDKTIRV 366

Query: 248 WNYVEEE 254
           WNY+  E
Sbjct: 367 WNYITGE 373

>CAGL0G09845g 940598..942100 similar to sp|P20053 Saccharomyces
           cerevisiae YPR178w PRP4 U4/U6 snRNP, hypothetical start
          Length = 500

 Score = 57.0 bits (136), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 51/224 (22%), Positives = 95/224 (42%), Gaps = 20/224 (8%)

Query: 22  SLELLKSLKLHTDKLWSI--DCSKGLMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKS 79
           +LE+ ++L+ H  K+  I    +  ++ T   D  I + N  + +F     +    H+  
Sbjct: 243 TLEVTQTLQNHDGKVGGIAWTSNDSVLITGGEDHLITVSNRSDGEFITSNSI--GGHEGR 300

Query: 80  VRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSH 139
           +  +   P    +   SFDST  +W          D  + + L + EGH  E+  +++  
Sbjct: 301 ITDLQVHPSGKFIGTSSFDSTWRLW----------DIEKQKQLLLQEGHSKELYCLAFQA 350

Query: 140 SGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTI 199
            G  +++   DK+  IW+        + +S LQ HA+ +  + W  + H LA+   D  I
Sbjct: 351 DGALVSTAGTDKTAIIWDL----RSGKAVSQLQGHAKTIYCMDWSIDGHTLATGGGDGVI 406

Query: 200 RLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDS 243
            +W  D    +    +  HK  V    F+K+     ++S  D S
Sbjct: 407 TIW--DLRKSDKLTKITEHKSIVTSLKFDKANDHNLISSGYDRS 448

 Score = 54.7 bits (130), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 45/219 (20%), Positives = 105/219 (47%), Gaps = 26/219 (11%)

Query: 78  KSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSW 137
           + + +V+F  + + +A+GS++  +SI           D    E+   ++ H+ +V  ++W
Sbjct: 213 RPISTVTFCNNGNYVASGSWNGEVSII----------DSNTLEVTQTLQNHDGKVGGIAW 262

Query: 138 SHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDD 197
           + +   L +   D  + +  ++    E+   + +  H   +  +  H     + +SS+D 
Sbjct: 263 TSNDSVLITGGEDHLITV--SNRSDGEFITSNSIGGHEGRITDLQVHPSGKFIGTSSFDS 320

Query: 198 TIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNYVEEEENG 257
           T RLW  D +  +   +  GH   ++C  F+ ++ +L +++   D T  +W+      +G
Sbjct: 321 TWRLW--DIEKQKQLLLQEGHSKELYCLAFQ-ADGAL-VSTAGTDKTAIIWDL----RSG 372

Query: 258 EDVWAQEAILPNVHSRAVYSVSWSLDGY-IASVGSDGLL 295
           + V   +      H++ +Y + WS+DG+ +A+ G DG++
Sbjct: 373 KAVSQLQG-----HAKTIYCMDWSIDGHTLATGGGDGVI 406

 Score = 53.9 bits (128), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 56/228 (24%), Positives = 97/228 (42%), Gaps = 21/228 (9%)

Query: 120 ELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVK 179
           +LLA        +  V++ ++G Y+AS S +  V I +++ L    E    LQ H   V 
Sbjct: 203 DLLATQVVSTRPISTVTFCNNGNYVASGSWNGEVSIIDSNTL----EVTQTLQNHDGKVG 258

Query: 180 HVVWHSEMHLLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASC 239
            + W S   +L +   D  I +      ++  +  + GH+G +  +D +   S   + + 
Sbjct: 259 GIAWTSNDSVLITGGEDHLITVSNRSDGEFITSNSIGGHEGRI--TDLQVHPSGKFIGTS 316

Query: 240 SDDSTVRVWNYVEEEENGEDVWAQEAILPNVHSRAVYSVSWSLDGYIASVGSDGLLXXXX 299
           S DST R+W+ +E++        ++ +L   HS+ +Y +++  DG + S           
Sbjct: 317 SFDSTWRLWD-IEKQ--------KQLLLQEGHSKELYCLAFQADGALVSTAGTDKTAIIW 367

Query: 300 XXXXXXXXXXXQQHEAHGIYEINVVKWATVDDSVLLLTGGDDGCANIW 347
                      Q H A  IY    + W+   D   L TGG DG   IW
Sbjct: 368 DLRSGKAVSQLQGH-AKTIY---CMDWSI--DGHTLATGGGDGVITIW 409

>KLLA0F11231g complement(1034708..1036012) similar to sp|Q12417
           Saccharomyces cerevisiae YPL151c PRP46, start by
           similarity
          Length = 434

 Score = 56.6 bits (135), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 45/160 (28%), Positives = 69/160 (43%), Gaps = 18/160 (11%)

Query: 92  LAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLASCSRDK 151
            A GS D+TI IW          D    +L   + GH   V+ ++ S    Y+ S S DK
Sbjct: 138 FATGSNDTTIKIW----------DLAAGKLKITLIGHVMSVRDIAISKRHPYMFSASEDK 187

Query: 152 SVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDADDWEC 211
            V  W+     E    +     H   V  V  H  + ++A++  D  +RLW  D      
Sbjct: 188 LVKCWDL----ERNTAIRDFHGHLSGVHTVDVHPSLDIIATAGRDAVVRLW--DIRSRSE 241

Query: 212 AAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNYV 251
             VL GHK  +  +  +      ++ SCS D+TVR+W+ +
Sbjct: 242 IMVLPGHKSPI--NKVKCLPVDPQIISCSGDATVRLWDII 279

 Score = 30.0 bits (66), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 35/74 (47%), Gaps = 1/74 (1%)

Query: 176 QDVKHVVWHSEMHLLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLR 235
           Q V+ V       +     Y+ T     +    W+ + V+NGH G V C   +  ++   
Sbjct: 79  QLVRRVFQQPHQQISLMERYEKTRSYKPQWHAPWKLSKVINGHTGWVRCVCVDPVDNEW- 137

Query: 236 LASCSDDSTVRVWN 249
            A+ S+D+T+++W+
Sbjct: 138 FATGSNDTTIKIWD 151

>Scas_585.8
          Length = 460

 Score = 56.6 bits (135), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 45/175 (25%), Positives = 77/175 (44%), Gaps = 19/175 (10%)

Query: 76  HKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIE-GHENEVKA 134
           H  +V  + +      + +G  D  I IW            P   ++   E  H   ++ 
Sbjct: 130 HDSAVSCIQYSHAGDWMCSGDADGGIKIWQ-----------PNFNMVKEFENAHTECIRD 178

Query: 135 VSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSS 194
           +S+S++     +CS D  + IW       E      L  H  D+K   WH EM L+ S+S
Sbjct: 179 ISFSNNDSKFVTCSDDNVLKIWNFSNGQVE----RTLSGHHWDIKSCDWHPEMGLIVSAS 234

Query: 195 YDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWN 249
            D+ ++LW  D    +C + +   K TV  + F+ +  +L LA+ S D + RV++
Sbjct: 235 KDNLVKLW--DPRSGQCISTIIKFKHTVLKTRFQPTRGNL-LAAISKDKSCRVFD 286

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/119 (20%), Positives = 51/119 (42%), Gaps = 9/119 (7%)

Query: 132 VKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLA 191
           + A++W+  G  L   + +    +W      E     S++Q H   V  + +      + 
Sbjct: 93  IPAITWTPEGRRLVVATYNGEFSLWNGTSFNE-----SLMQAHDSAVSCIQYSHAGDWMC 147

Query: 192 SSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNY 250
           S   D  I++W+ + +        N H   +    F  ++S  +  +CSDD+ +++WN+
Sbjct: 148 SGDADGGIKIWQPNFN--MVKEFENAHTECIRDISFSNNDS--KFVTCSDDNVLKIWNF 202

 Score = 37.0 bits (84), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 30/55 (54%), Gaps = 6/55 (10%)

Query: 65  FQLVEELDDSTH------KKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQ 113
           F L+++L+  +H       K V S+++ P  +ILA+ S D TI  W + +  DP 
Sbjct: 328 FDLLQDLEGPSHVIPYAHDKCVTSMAYNPAGNILASASKDRTIRFWTRAKPVDPN 382

 Score = 34.7 bits (78), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 47/228 (20%), Positives = 88/228 (38%), Gaps = 58/228 (25%)

Query: 64  DFQLVEELDDSTHKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLA 123
           +F +V+E +++ H + +R +SF  + S     S D+ + IW          +F   ++  
Sbjct: 161 NFNMVKEFENA-HTECIRDISFSNNDSKFVTCSDDNVLKIW----------NFSNGQVER 209

Query: 124 IIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDV-KHVV 182
            + GH  ++K+  W      + S S+D  V +W+        +C+S + +    V K   
Sbjct: 210 TLSGHHWDIKSCDWHPEMGLIVSASKDNLVKLWDP----RSGQCISTIIKFKHTVLKTRF 265

Query: 183 WHSEMHLLASSSYDDTIRLWK-----------EDADDW---------ECAAVLNGHKGTV 222
             +  +LLA+ S D + R++             D  D+         E    +  + G +
Sbjct: 266 QPTRGNLLAAISKDKSCRVFDIRHSMKELMCVRDEVDYMTLTWNPINESMFTVGNYDGAM 325

Query: 223 WCSDF---------------EKSESSLR-------LASCSDDSTVRVW 248
              D                +K  +S+        LAS S D T+R W
Sbjct: 326 KYFDLLQDLEGPSHVIPYAHDKCVTSMAYNPAGNILASASKDRTIRFW 373

>ACR199C [1246] [Homologous to ScYLR208W (SEC13) - SH]
           (698881..699768) [888 bp, 295 aa]
          Length = 295

 Score = 55.8 bits (133), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 55/170 (32%), Positives = 77/170 (45%), Gaps = 22/170 (12%)

Query: 190 LASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWN 249
           LA+ S D TI++++ D D  +    L+GH+G VW  D+   +  + LASCS D  V +W 
Sbjct: 24  LATCSSDKTIQIFEVDGDSHKLVDSLHGHEGPVWQVDWAHPKFGVILASCSYDGKVLIW- 82

Query: 250 YVEEEENGEDVWAQEAILPNVHSRAVYSVSWSLDGY---IASVGSDGLLXXXXXXXXXXX 306
              +EENG   W+Q A    VHS +V SV W+   Y   +    SDG             
Sbjct: 83  ---KEENGR--WSQIAAY-EVHSASVNSVKWAPHEYGPLLLCSSSDGKFSVVEFKENGTT 136

Query: 307 XXXXQQHEAHGIYEINVVKW--ATVDDS-------VLLLTGGDDGCANIW 347
                  +AH I  +N   W  AT++D          + TGG D    IW
Sbjct: 137 SPIII--DAHAI-GVNAACWAPATIEDDGQQSQHLRRIATGGADNLVKIW 183

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 53/189 (28%), Positives = 81/189 (42%), Gaps = 23/189 (12%)

Query: 121 LLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKH 180
           ++ I   H   +      + G  LA+CS DK++ I+E D  G+ ++ +  L  H   V  
Sbjct: 1   MVTITNAHTELIHDAVLDYYGKRLATCSSDKTIQIFEVD--GDSHKLVDSLHGHEGPVWQ 58

Query: 181 VVW-HSEMH-LLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLAS 238
           V W H +   +LAS SYD  + +WKE+   W   A    H  +V    +   E    L  
Sbjct: 59  VDWAHPKFGVILASCSYDGKVLIWKEENGRWSQIAAYEVHSASVNSVKWAPHEYGPLLLC 118

Query: 239 CSDDSTVRVWNYVEEEENGEDVWAQEAILPNVHSRAVYSVSWSL-----DGY-------I 286
            S D    V   VE +ENG        I+ + H+  V +  W+      DG        I
Sbjct: 119 SSSDGKFSV---VEFKENG----TTSPIIIDAHAIGVNAACWAPATIEDDGQQSQHLRRI 171

Query: 287 ASVGSDGLL 295
           A+ G+D L+
Sbjct: 172 ATGGADNLV 180

 Score = 51.2 bits (121), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 67/264 (25%), Positives = 106/264 (40%), Gaps = 38/264 (14%)

Query: 46  MATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSVSF--RPHSSILAAGSFDSTISI 103
           +AT SSD+ I++  +     +LV+ L    H+  V  V +       ILA+ S+D  + I
Sbjct: 24  LATCSSDKTIQIFEVDGDSHKLVDSLHG--HEGPVWQVDWAHPKFGVILASCSYDGKVLI 81

Query: 104 WGKEEDADPQDDFPETELLAIIEGHENEVKAVSWS--HSGYYLASCSRDKSVWIWEADEL 161
           W +E     Q        +A  E H   V +V W+    G  L   S D    + E  E 
Sbjct: 82  WKEENGRWSQ--------IAAYEVHSASVNSVKWAPHEYGPLLLCSSSDGKFSVVEFKEN 133

Query: 162 GEEYECLSVLQEHAQDVKHVVW---------HSEMHL--LASSSYDDTIRLWK--EDADD 208
           G       ++  HA  V    W             HL  +A+   D+ +++WK   +A+ 
Sbjct: 134 GTTSPI--IIDAHAIGVNAACWAPATIEDDGQQSQHLRRIATGGADNLVKIWKYNPEANT 191

Query: 209 WECAAVLNGHKGTVWCSDFEKSESSLR---LASCSDDSTVRVWNYVEEEENGEDVWAQEA 265
           +     L  H    W  D   S S L    LA+ S D T  +W     +EN +  W +  
Sbjct: 192 YLLEDTLAAHAD--WVRDVAWSPSVLPRAYLATVSQDRTCIIWT----QENNQGPWTKTL 245

Query: 266 ILPNVHSRAVYSVSWSLDGYIASV 289
           +  +     ++  SWSL G I ++
Sbjct: 246 LKEDKFPDVLWRASWSLSGNILAL 269

 Score = 43.9 bits (102), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 50/186 (26%), Positives = 79/186 (42%), Gaps = 26/186 (13%)

Query: 45  LMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSVSFRP-----------HSSILA 93
           L+  SSSD K  +V  K         +D   H   V +  + P           H   +A
Sbjct: 115 LLLCSSSDGKFSVVEFKENGTTSPIIID--AHAIGVNAACWAPATIEDDGQQSQHLRRIA 172

Query: 94  AGSFDSTISIWGKEEDADPQDDFPETELLA-IIEGHENEVKAVSWSHS---GYYLASCSR 149
            G  D+ + IW    +A+       T LL   +  H + V+ V+WS S     YLA+ S+
Sbjct: 173 TGGADNLVKIWKYNPEAN-------TYLLEDTLAAHADWVRDVAWSPSVLPRAYLATVSQ 225

Query: 150 DKSVWIWEADELGEEYECLSVLQEHAQDVK-HVVWHSEMHLLASSSYDDTIRLWKEDAD- 207
           D++  IW  +     +    + ++   DV     W    ++LA S  D+ + LWKE+ + 
Sbjct: 226 DRTCIIWTQENNQGPWTKTLLKEDKFPDVLWRASWSLSGNILALSGGDNKVTLWKENLEG 285

Query: 208 DWECAA 213
            WE AA
Sbjct: 286 KWESAA 291

>YGL137W (SEC27) [1850] chr7 (249872..249889,250090..252741)
           Coatomer (COPI) complex beta' chain (beta'-COP) of
           secretory pathway vesicles, required for retrograde
           transport from Golgi to endoplasmic reticulum, member of
           the WD (WD-40) repeat family [2670 bp, 889 aa]
          Length = 889

 Score = 56.6 bits (135), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 61/265 (23%), Positives = 115/265 (43%), Gaps = 41/265 (15%)

Query: 10  TFSHKHTRLQRMSLE-----LLKSLKLHTDKLWSIDCS---KGLMATSSSDRKIKLVNLK 61
           TFS++  R++ +        +L +L     +LW+ +     + +  T +  R  K +  K
Sbjct: 8   TFSNRSDRVKGIDFHPTEPWVLTTLYSGRVELWNYETQVEVRSIQVTETPVRAGKFIARK 67

Query: 62  NM------DFQLV--------EELDDSTHKKSVRSVSFRPHSSILAAGSFDSTISIWGKE 107
           N       DF++         + +D   H   +RS++  P    + +GS D T+ +W  E
Sbjct: 68  NWIIVGSDDFRIRVFNYNTGEKVVDFEAHPDYIRSIAVHPTKPYVLSGSDDLTVKLWNWE 127

Query: 108 EDADPQDDFPETELLAIIEGHENEVKAVSWSHS-GYYLASCSRDKSVWIWEADELGEEYE 166
            +   +  F         EGHE+ V  V+++       AS   D++V +W    LG+   
Sbjct: 128 NNWALEQTF---------EGHEHFVMCVAFNPKDPSTFASGCLDRTVKVWS---LGQSTP 175

Query: 167 CLSVLQEHAQDVKHVVWHS--EMHLLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWC 224
             ++     + V +V ++   +   + ++S D TI++W  D     C A L GH   V  
Sbjct: 176 NFTLTTGQERGVNYVDYYPLPDKPYMITASDDLTIKIW--DYQTKSCVATLEGHMSNVSF 233

Query: 225 SDFEKSESSLRLASCSDDSTVRVWN 249
           + F  +   +   S S+D T+++WN
Sbjct: 234 AVFHPTLPII--ISGSEDGTLKIWN 256

 Score = 54.3 bits (129), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 48/201 (23%), Positives = 88/201 (43%), Gaps = 23/201 (11%)

Query: 29  LKLHTDKLWSIDC--SKGLMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSVSFR 86
            + H D + SI    +K  + + S D  +KL N +N ++ L +  +   H+  V  V+F 
Sbjct: 93  FEAHPDYIRSIAVHPTKPYVLSGSDDLTVKLWNWEN-NWALEQTFEG--HEHFVMCVAFN 149

Query: 87  PH-SSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSH--SGYY 143
           P   S  A+G  D T+ +W   +          T    +  G E  V  V +       Y
Sbjct: 150 PKDPSTFASGCLDRTVKVWSLGQ---------STPNFTLTTGQERGVNYVDYYPLPDKPY 200

Query: 144 LASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWK 203
           + + S D ++ IW+     +   C++ L+ H  +V   V+H  + ++ S S D T+++W 
Sbjct: 201 MITASDDLTIKIWDY----QTKSCVATLEGHMSNVSFAVFHPTLPIIISGSEDGTLKIW- 255

Query: 204 EDADDWECAAVLNGHKGTVWC 224
            ++  ++    LN      WC
Sbjct: 256 -NSSTYKVEKTLNVGLERSWC 275

 Score = 37.0 bits (84), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 50/236 (21%), Positives = 95/236 (40%), Gaps = 27/236 (11%)

Query: 21  MSLELLKSLKLHTDKLWSIDCSKG---LMATSSSDRKIKLVNLKNMDFQLVEELDDSTHK 77
           M L++ K+    +D++  ID       ++ T  S R    V L N + Q VE       +
Sbjct: 1   MKLDIKKTFSNRSDRVKGIDFHPTEPWVLTTLYSGR----VELWNYETQ-VEVRSIQVTE 55

Query: 78  KSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSW 137
             VR+  F    + +  GS D  I ++          ++   E +   E H + +++++ 
Sbjct: 56  TPVRAGKFIARKNWIIVGSDDFRIRVF----------NYNTGEKVVDFEAHPDYIRSIAV 105

Query: 138 SHSGYYLASCSRDKSV--WIWEADELGEEYECLSVLQEHAQDVKHVVWHS-EMHLLASSS 194
             +  Y+ S S D +V  W WE +   E+       + H   V  V ++  +    AS  
Sbjct: 106 HPTKPYVLSGSDDLTVKLWNWENNWALEQ-----TFEGHEHFVMCVAFNPKDPSTFASGC 160

Query: 195 YDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNY 250
            D T+++W                +G  +  D+        + + SDD T+++W+Y
Sbjct: 161 LDRTVKVWSLGQSTPNFTLTTGQERGVNYV-DYYPLPDKPYMITASDDLTIKIWDY 215

>CAGL0L02629g complement(307323..309710) similar to sp|P07834
           Saccharomyces cerevisiae YFL009w CDC4 cell division
           control, hypothetical start
          Length = 795

 Score = 56.2 bits (134), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 53/228 (23%), Positives = 95/228 (41%), Gaps = 45/228 (19%)

Query: 89  SSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSW-SHSGY-YLAS 146
           + IL +GS D ++ IW          +    +   + +GH + V+ +    H G  Y+ +
Sbjct: 420 NGILVSGSTDRSVRIW----------NIHLGKCTHVFKGHTSTVRCLDIVEHEGVKYIVT 469

Query: 147 CSRDKSVWIWEADELG------------------------EEYECLSVLQEHAQDVKHVV 182
            SRD ++ IW+  ++                         E    + VL+ H   V+ V 
Sbjct: 470 GSRDNTLHIWKLPQMSDSNIDEGMPNVYSNNGPLFFHSPEENPYFVGVLRGHIASVRTVS 529

Query: 183 WHSEMHLLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDD 242
            H    ++ S SYD+ + +W  D    +C  +L GH   ++ + ++   +  R  S S D
Sbjct: 530 GHGR--IVISGSYDNNLIVW--DIIQMKCLYILMGHTDRIYSTIYDYKRN--RCISASMD 583

Query: 243 STVRVWNYVEEEENGEDVWAQEAILPNVHSRAVYSVSWSLDGYIASVG 290
           ST+++W+      NGE V    A +P      +     +L G+ A VG
Sbjct: 584 STIKIWDLQNIWNNGECVNVTNATVP---CTKITGPMMTLQGHTALVG 628

 Score = 51.2 bits (121), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 57/267 (21%), Positives = 110/267 (41%), Gaps = 51/267 (19%)

Query: 21  MSLELLKSLKLHTDKLWSID-CSKGLMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKS 79
           ++ + L  L  H   +W++     G++ + S+DR +++ N+       V +     H  +
Sbjct: 397 ITKKFLIELSGHDGGVWALKYAGNGILVSGSTDRSVRIWNIHLGKCTHVFK----GHTST 452

Query: 80  VRSVSFRPHSSI--LAAGSFDSTISIWGKEEDADPQDD----------------FPETE- 120
           VR +    H  +  +  GS D+T+ IW   + +D   D                 PE   
Sbjct: 453 VRCLDIVEHEGVKYIVTGSRDNTLHIWKLPQMSDSNIDEGMPNVYSNNGPLFFHSPEENP 512

Query: 121 -LLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVK 179
             + ++ GH   V+ VS    G  + S S D ++ +W+  ++    +CL +L  H   + 
Sbjct: 513 YFVGVLRGHIASVRTVSGH--GRIVISGSYDNNLIVWDIIQM----KCLYILMGHTDRIY 566

Query: 180 HVVWHSEMHLLASSSYDDTIRLWKEDA--DDWECAAVLNGHKGTVWCSDFEKSESSLR-- 235
             ++  + +   S+S D TI++W      ++ EC  V N    TV C+       +L+  
Sbjct: 567 STIYDYKRNRCISASMDSTIKIWDLQNIWNNGECVNVTN---ATVPCTKITGPMMTLQGH 623

Query: 236 -------------LASCSDDSTVRVWN 249
                        L S + D ++R W+
Sbjct: 624 TALVGLLKLSDKFLVSAAADGSLRGWD 650

>YNL006W (LST8) [4579] chr14 (620066..620977) Protein required for
           transport of permeases from the Golgi to the plasma
           membrane [912 bp, 303 aa]
          Length = 303

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 56/246 (22%), Positives = 109/246 (44%), Gaps = 40/246 (16%)

Query: 43  KGLMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSVSFRPHSSILAAGSFDSTIS 102
           K L+AT+   + ++L +++  +   V   +   H+ +V SVSF+  +  +   S D TI 
Sbjct: 44  KKLLATAGH-QNVRLYDIRTTNPNPVASFEG--HRGNVTSVSFQQDNRWMVTSSEDGTIK 100

Query: 103 IWGKEEDADPQD---DFPETEL-----------------LAIIEGHENE----------- 131
           +W     + P++   + P  E+                 + I +  EN+           
Sbjct: 101 VWDVRSPSIPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDT 160

Query: 132 -VKAVSWSHSGYYLASCSRDKSVWIWEADEL--GEEYECLSVLQEHAQDVKHVVWHSEMH 188
            ++++S +  G  LA+ +   + ++WE          + ++  + H+  +  ++  S++ 
Sbjct: 161 SLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVK 220

Query: 189 LLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVW 248
            LA+ S D T R+W  D DD++    L+GH+  VW  D   S  S  L + S D  VR+W
Sbjct: 221 HLATCSADHTARVWSID-DDFKLETTLDGHQRWVW--DCAFSADSAYLVTASSDHYVRLW 277

Query: 249 NYVEEE 254
           +    E
Sbjct: 278 DLSTRE 283

>Kwal_26.8776
          Length = 433

 Score = 55.5 bits (132), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 45/158 (28%), Positives = 67/158 (42%), Gaps = 18/158 (11%)

Query: 92  LAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLASCSRDK 151
            A GS D+TI +W          D    +L   + GH   V++V+ S     + S S DK
Sbjct: 137 FATGSNDTTIKVW----------DMASGKLKLTLTGHVMTVRSVAVSQRHPLMFSASEDK 186

Query: 152 SVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDADDWEC 211
            V  W+     E    +     H   V  V  H  + L+AS+  D  +RLW  D      
Sbjct: 187 MVKCWDL----ERNAAIRDYHGHFSGVNTVDVHPTLDLIASAGRDAVVRLW--DIRTRLP 240

Query: 212 AAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWN 249
              L GHK  +  +  +      ++ SCS D+TVR+W+
Sbjct: 241 VMTLAGHKSPI--NQVKCFPVDPQIMSCSSDATVRLWD 276

 Score = 30.0 bits (66), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 26/41 (63%), Gaps = 1/41 (2%)

Query: 209 WECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWN 249
           W+   V+NGH G V C   +  +++   A+ S+D+T++VW+
Sbjct: 111 WKLMRVINGHNGWVRCVCPDPVDNAW-FATGSNDTTIKVWD 150

>Scas_704.40
          Length = 608

 Score = 55.5 bits (132), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 46/174 (26%), Positives = 81/174 (46%), Gaps = 25/174 (14%)

Query: 76  HKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAV 135
           H   V ++ F  +  +L  GS+DST++IW          D    +L+  + GH + VK +
Sbjct: 252 HMDGVLTLQF--NYRLLFTGSYDSTVAIW----------DLCSNKLIRRLSGHTDGVKTL 299

Query: 136 SWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSY 195
            +  +   L + S DK++ +W      +  EC+S  + H   V  V   +   ++ S S 
Sbjct: 300 YFDEAK--LVTGSLDKTIRVWNY----KTGECISTYRGHTDSVMSV--DAFKKIIVSGSA 351

Query: 196 DDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWN 249
           D T+++W  ++        L GH  T W +  +    S    S SDD+T+R+W+
Sbjct: 352 DKTVKIWHVES---RTCYTLRGH--TEWVNCVKLHPKSFTCFSGSDDTTIRMWD 400

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 55/239 (23%), Positives = 99/239 (41%), Gaps = 42/239 (17%)

Query: 24  ELLKSLKLHTDKLWSIDCSKGLMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSV 83
           E + + + HTD + S+D  K ++ + S+D+ +K+ ++++     +       H + V  V
Sbjct: 324 ECISTYRGHTDSVMSVDAFKKIIVSGSADKTVKIWHVESRTCYTLR-----GHTEWVNCV 378

Query: 84  SFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYY 143
              P S    +GS D+TI +W          D      L +  GH  +V+ V        
Sbjct: 379 KLHPKSFTCFSGSDDTTIRMW----------DIRTNSCLKVFRGHVGQVQKV------IP 422

Query: 144 LASCSRDKSVW--IWEADELGEEYECLSVLQ-----------EHAQDVKHVVWHSEMHLL 190
           L     +  V   I  ++E  +E    +              E  Q +   + +   HLL
Sbjct: 423 LTIIDAENLVVDNISGSNEGDDEPASTTTPTAAIAAEAATNDEENQTLDKSIPY-PTHLL 481

Query: 191 ASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWN 249
            S S D+TI+LW  D    +C     GH   VW    + +  + R+ S S D ++++W+
Sbjct: 482 -SCSLDNTIKLW--DVQTGQCIRTQFGHVEGVW----DIAADNFRIISGSHDGSIKIWD 533

 Score = 32.7 bits (73), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 34/67 (50%), Gaps = 6/67 (8%)

Query: 188 HLLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRV 247
            LL + SYD T+ +W  D    +    L+GH   V    F+++    +L + S D T+RV
Sbjct: 264 RLLFTGSYDSTVAIW--DLCSNKLIRRLSGHTDGVKTLYFDEA----KLVTGSLDKTIRV 317

Query: 248 WNYVEEE 254
           WNY   E
Sbjct: 318 WNYKTGE 324

>KLLA0D07546g complement(647984..649927) some similarities with
           sp|P07834 Saccharomyces cerevisiae YFL009w CDC4 cell
           division control protein, hypothetical start
          Length = 647

 Score = 55.1 bits (131), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 56/230 (24%), Positives = 99/230 (43%), Gaps = 39/230 (16%)

Query: 46  MATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSVSFRPHSSILAAGSFDSTISIWG 105
           + T + D+KI + + +N  F L  EL+   H+  V ++ F     IL +GS D ++ IW 
Sbjct: 273 IITGADDKKINVYDAENDLFLL--ELNG--HEGGVWALKFV-DGKILVSGSTDRSVRIWN 327

Query: 106 KEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSG--YYLASCSRDKSVWIWEADELGE 163
            E            +   + +GH + V+ +     G   Y+ + SRD ++ +W+   + E
Sbjct: 328 IETG----------KCTHVFKGHTSTVRCLEVVEYGDSKYIVTGSRDNTLHVWKLPPMKE 377

Query: 164 ----------------EYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDAD 207
                               + VL+ H   V+ V  H    ++ S SYD  + +W  D  
Sbjct: 378 LDKGSQEPIFYRTPEENPYFVGVLRGHMSSVRTVSGHGR--IVISGSYDHNLMVW--DII 433

Query: 208 DWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNYVEEEENG 257
             +   +L GH   V+ + ++   +  R  S S D+TV +W+    E NG
Sbjct: 434 SMKLLYILTGHTDRVYSTIYDYKRN--RCISASMDTTVMIWDLENIENNG 481

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 48/101 (47%), Gaps = 5/101 (4%)

Query: 189 LLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVW 248
           +L S S D ++R+W  + +  +C  V  GH  TV C +  +   S  + + S D+T+ VW
Sbjct: 313 ILVSGSTDRSVRIW--NIETGKCTHVFKGHTSTVRCLEVVEYGDSKYIVTGSRDNTLHVW 370

Query: 249 NYVEEEENGEDVWAQEAILPNVHSRAVYSVSWSLDGYIASV 289
                +E   D  +QE I         Y V   L G+++SV
Sbjct: 371 KLPPMKE--LDKGSQEPIFYRTPEENPYFVG-VLRGHMSSV 408

>ADL082C [1659] [Homologous to ScYIL046W (MET30) - SH]
           (538948..540657) [1710 bp, 569 aa]
          Length = 569

 Score = 54.7 bits (130), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 47/167 (28%), Positives = 75/167 (44%), Gaps = 23/167 (13%)

Query: 83  VSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGY 142
           +S +  + +L  GS+DST++IW          D    +L+  + GH + VKA+ +     
Sbjct: 263 LSLQLTNKLLLTGSYDSTVAIW----------DLATGKLIRRLSGHTDGVKALRFDDQ-- 310

Query: 143 YLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLW 202
            L + S DK++ +W          C+S  + H   V  V   S   L+ S S D T+++W
Sbjct: 311 KLITGSLDKTIRVWNY----VTGACVSTYRGHQDSVLSV--DSFRKLIVSGSADKTVKVW 364

Query: 203 KEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWN 249
             ++        L GH G V C        S    S SDD T+R+W+
Sbjct: 365 HVES---RTCYTLRGHTGWVNCVKLH--PKSFTCFSGSDDMTIRMWD 406

 Score = 52.4 bits (124), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 64/265 (24%), Positives = 103/265 (38%), Gaps = 60/265 (22%)

Query: 20  RMSLELLKSLKLHTDKLWSIDCSKGLMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKS 79
           R  +  ++  K H D + S+  +  L+ T S D  + + +L     +L+  L  S H   
Sbjct: 246 RKGIYRIQEFKGHMDGVLSLQLTNKLLLTGSYDSTVAIWDLATG--KLIRRL--SGHTDG 301

Query: 80  VRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSH 139
           V+++ F      L  GS D TI +W          ++     ++   GH++ V +V    
Sbjct: 302 VKALRFDDQK--LITGSLDKTIRVW----------NYVTGACVSTYRGHQDSVLSVDSFR 349

Query: 140 SGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTI 199
               + S S DK+V +W      E   C + L+ H   V  V  H +     S S D TI
Sbjct: 350 K--LIVSGSADKTVKVWHV----ESRTCYT-LRGHTGWVNCVKLHPKSFTCFSGSDDMTI 402

Query: 200 RLWKEDADDWECAAVLNGHKG----------------------------------TVWCS 225
           R+W  D     C  V +GH G                                  +V  +
Sbjct: 403 RMW--DIRTNTCVRVFHGHVGQVQKVIPLTLGSDLIEDPKDAVVPPDATAPAHDPSVQAA 460

Query: 226 DFEKS-ESSLRLASCSDDSTVRVWN 249
           +F+ S      L SCS D+T+++WN
Sbjct: 461 NFDHSLPYPTHLLSCSLDNTIKLWN 485

 Score = 35.0 bits (79), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 32/63 (50%), Gaps = 6/63 (9%)

Query: 189 LLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVW 248
           LL + SYD T+ +W  D    +    L+GH   V    F+      +L + S D T+RVW
Sbjct: 271 LLLTGSYDSTVAIW--DLATGKLIRRLSGHTDGVKALRFDDQ----KLITGSLDKTIRVW 324

Query: 249 NYV 251
           NYV
Sbjct: 325 NYV 327

>AGL234W [4078] [Homologous to ScYCR084C (TUP1) - SH]
           complement(257969..259858) [1890 bp, 629 aa]
          Length = 629

 Score = 54.3 bits (129), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 46/180 (25%), Positives = 77/180 (42%), Gaps = 31/180 (17%)

Query: 80  VRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSH 139
           +RSV F P    LA G+ D  I IW          D    ++L  ++GHE ++ ++ +  
Sbjct: 355 IRSVCFSPDGKYLATGAEDKLIRIW----------DLTTKKILMTLQGHEQDIYSLDYFP 404

Query: 140 SGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTI 199
           +G  L S S D++V IW+        +C   L          V   +   +A+ S D T+
Sbjct: 405 AGDKLVSGSGDRTVRIWDL----RTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRTV 460

Query: 200 RLWKEDADDWECAAVL----------NGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWN 249
           R+W     D E   ++           GHK +V+   F +      + S S D +V++W+
Sbjct: 461 RVW-----DSETGFLVERLDSENELSTGHKDSVYSVVFTRDGQG--VISGSLDRSVKLWD 513

 Score = 42.0 bits (97), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 47/184 (25%), Positives = 79/184 (42%), Gaps = 29/184 (15%)

Query: 46  MATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSVSFRPHSSILAAGSFDSTISIWG 105
           +AT + D+ I++ +L      +  +     H++ + S+ + P    L +GS D T+ IW 
Sbjct: 367 LATGAEDKLIRIWDLTTKKILMTLQ----GHEQDIYSLDYFPAGDKLVSGSGDRTVRIW- 421

Query: 106 KEEDADPQDDFPETELLAIIEGHENEVKAVSWSHS-GYYLASCSRDKSVWIWEADELGEE 164
                    D   T   ++    E+ V  V+ S   G Y+A+ S D++V +W++ E G  
Sbjct: 422 ---------DL-RTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRTVRVWDS-ETGFL 470

Query: 165 YECLSVLQE----HAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDADDWECAAVLNGHKG 220
            E L    E    H   V  VV+  +   + S S D +++LW            LNG K 
Sbjct: 471 VERLDSENELSTGHKDSVYSVVFTRDGQGVISGSLDRSVKLWDLRG--------LNGQKS 522

Query: 221 TVWC 224
              C
Sbjct: 523 HATC 526

 Score = 35.0 bits (79), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 41/92 (44%), Gaps = 4/92 (4%)

Query: 158 ADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDADDWECAAVLNG 217
           AD  GE    +         ++ V +  +   LA+ + D  IR+W  D    +    L G
Sbjct: 335 ADNGGENSATIQPASSSDLYIRSVCFSPDGKYLATGAEDKLIRIW--DLTTKKILMTLQG 392

Query: 218 HKGTVWCSDFEKSESSLRLASCSDDSTVRVWN 249
           H+  ++  D+  +    +L S S D TVR+W+
Sbjct: 393 HEQDIYSLDYFPAGD--KLVSGSGDRTVRIWD 422

>AFL118W [3077] [Homologous to ScYGL137W (SEC27) - SH]
           complement(216252..216269,216423..218903) [2499 bp, 832
           aa]
          Length = 832

 Score = 54.3 bits (129), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 50/208 (24%), Positives = 93/208 (44%), Gaps = 19/208 (9%)

Query: 43  KGLMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSVSFRPHSSILAAGSFDSTIS 102
           K  +   S D KI++ N    +    + +D   H   +R+++  P  S + + S D T+ 
Sbjct: 67  KSWIIVGSDDFKIRVFNYNTGE----KVVDFEAHPDYIRALAVHPTRSYVLSASDDLTVK 122

Query: 103 IWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHS-GYYLASCSRDKSVWIWEADEL 161
           +W  E++   +  F         EGHE+ V +V+++       A+   D +V IW   + 
Sbjct: 123 LWNWEKNWALEQTF---------EGHEHFVMSVTFNPKDPNTFATACLDHTVKIWSLGQE 173

Query: 162 GEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDADDWECAAVLNGHKGT 221
              +   + L++    V +  +  + +L+ SS  D T+++W  D     C A L GH   
Sbjct: 174 TSNFTLRAHLEKGVNFVDYYPFQDKPYLITSSD-DRTVKVW--DYQTKSCVATLEGHLSN 230

Query: 222 VWCSDFEKSESSLRLASCSDDSTVRVWN 249
           V  + +      +   S S+D TV++WN
Sbjct: 231 VSYAVYHPMLPII--ISGSEDGTVKIWN 256

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 37/150 (24%), Positives = 68/150 (45%), Gaps = 14/150 (9%)

Query: 76  HKKSVRSVSFRPH-SSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKA 134
           H+  V SV+F P   +  A    D T+ IW   ++           L A +E   N V  
Sbjct: 139 HEHFVMSVTFNPKDPNTFATACLDHTVKIWSLGQETS------NFTLRAHLEKGVNFVDY 192

Query: 135 VSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSS 194
             +    Y L + S D++V +W+     +   C++ L+ H  +V + V+H  + ++ S S
Sbjct: 193 YPFQDKPY-LITSSDDRTVKVWDY----QTKSCVATLEGHLSNVSYAVYHPMLPIIISGS 247

Query: 195 YDDTIRLWKEDADDWECAAVLNGHKGTVWC 224
            D T+++W  +++ ++    LN      WC
Sbjct: 248 EDGTVKIW--NSNTYKLERTLNLGLERSWC 275

 Score = 44.7 bits (104), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 58/238 (24%), Positives = 103/238 (43%), Gaps = 31/238 (13%)

Query: 21  MSLELLKSLKLHTDKLWSIDCSKG---LMATSSSDRKIKLVNLKNMDFQLVEELDDSTHK 77
           M LE  K+    TD++  ID       ++ T  S R      + N + Q  E    S  +
Sbjct: 1   MKLETKKTFVSRTDRVKGIDFHPSEPWVLITLYSGR----AEIWNYETQ-TEVRSISVCE 55

Query: 78  KSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSW 137
             VR+  F P  S +  GS D  I ++          ++   E +   E H + ++A++ 
Sbjct: 56  APVRAGKFIPRKSWIIVGSDDFKIRVF----------NYNTGEKVVDFEAHPDYIRALAV 105

Query: 138 SHSGYYLASCSRDKSV--WIWEADELGEEYECLSVLQEHAQDVKHVVWHS-EMHLLASSS 194
             +  Y+ S S D +V  W WE +   E+       + H   V  V ++  + +  A++ 
Sbjct: 106 HPTRSYVLSASDDLTVKLWNWEKNWALEQ-----TFEGHEHFVMSVTFNPKDPNTFATAC 160

Query: 195 YDDTIRLWK--EDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNY 250
            D T+++W   ++  ++   A L   KG  +  D+   +    L + SDD TV+VW+Y
Sbjct: 161 LDHTVKIWSLGQETSNFTLRAHL--EKGVNFV-DYYPFQDKPYLITSSDDRTVKVWDY 215

>Kwal_23.5769
          Length = 627

 Score = 54.3 bits (129), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 47/174 (27%), Positives = 78/174 (44%), Gaps = 25/174 (14%)

Query: 76  HKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAV 135
           H   V S+ F  +  +L  GS+DST++IW          D    +L+  + GH + VKA+
Sbjct: 316 HMDGVLSLQF--NYRLLFTGSYDSTVAIW----------DLATGKLVRRLTGHRDGVKAI 363

Query: 136 SWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSY 195
            +   G  L + S D+ + +W          C++    H+  V  V   S   ++ S S 
Sbjct: 364 YFD--GQKLITGSLDRMIRVWNY----VTGACVAAYPGHSDSVLSV--DSYKKIIVSGSA 415

Query: 196 DDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWN 249
           D T+++W  ++        L GH  T W    +    S    S SDD+T+R+W+
Sbjct: 416 DKTVKVWHVES---RTCYTLRGH--TEWVGTVKLHPKSFTCFSGSDDTTIRMWD 464

 Score = 41.2 bits (95), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 49/218 (22%), Positives = 88/218 (40%), Gaps = 28/218 (12%)

Query: 32  HTDKLWSIDCSKGLMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSVSFRPHSSI 91
           H+D + S+D  K ++ + S+D+ +K+ ++++     +       H + V +V   P S  
Sbjct: 396 HSDSVLSVDSYKKIIVSGSADKTVKVWHVESRTCYTLR-----GHTEWVGTVKLHPKSFT 450

Query: 92  LAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLASCSRDK 151
             +GS D+TI +W          D      + +  GH  +V+ V        L     + 
Sbjct: 451 CFSGSDDTTIRMW----------DIRSNTCVKVFRGHVGQVQKV------LPLTILDTEN 494

Query: 152 SVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDADDWEC 211
            V    +D    E        +              HLL S S D+TI+LW  +    +C
Sbjct: 495 LVTDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLL-SCSLDNTIKLW--EVRTGKC 551

Query: 212 AAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWN 249
                GH   +W    + +  + R+ S + D TV+VW+
Sbjct: 552 VRTHFGHVEGIW----DIAADNFRIVSGAHDKTVKVWD 585

 Score = 34.3 bits (77), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 31/64 (48%), Gaps = 6/64 (9%)

Query: 188 HLLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRV 247
            LL + SYD T+ +W  D    +    L GH+  V    F+      +L + S D  +RV
Sbjct: 328 RLLFTGSYDSTVAIW--DLATGKLVRRLTGHRDGVKAIYFDGQ----KLITGSLDRMIRV 381

Query: 248 WNYV 251
           WNYV
Sbjct: 382 WNYV 385

>KLLA0A04928g 439349..441934 similar to sp|P32479 Saccharomyces
           cerevisiae YBL008w HIR1 histone transcription regulator,
           start by similarity
          Length = 861

 Score = 54.3 bits (129), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 54/223 (24%), Positives = 89/223 (39%), Gaps = 33/223 (14%)

Query: 87  PHSSILAAGSFDSTISIW--------GKEEDADPQDDFPETELLAIIEGHENEVKAVSWS 138
           P S  LA G  D  I IW            +A    D    + L+ +  H   V  V +S
Sbjct: 27  PDSQRLATGGLDGKIRIWSIPDILKFASNPNASTDKDI-LMKPLSTMSRHAGSVTTVKFS 85

Query: 139 HSGYYLASCSRDKSVWIWEADE------LGEE------YECLSVLQEHAQDVKHVVWHSE 186
             G YLAS S D+ + IWE +        G E      +     L  H  D++ + W  +
Sbjct: 86  PDGKYLASGSDDRILLIWELEGGTTQPMFGAESTDIEHWNVRRRLVAHDNDIQDICWAPD 145

Query: 187 MHLLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVR 246
             ++ S   D  I +W  +   +E     + H+  V    F+ +      A+ SDD T++
Sbjct: 146 SSIMVSVGLDRAIIIW--NGSTFEKVKRFDVHQSHVKGVVFDPANK--YFATASDDRTIK 201

Query: 247 VWNYVEEEENGEDVWAQEAILPNVHSRAVYS-----VSWSLDG 284
           ++ Y    + GE  ++ E ++      +  +     +SWS DG
Sbjct: 202 MFRY---HKTGETSFSVEHVITEPFKGSPLTTYFRRLSWSPDG 241

 Score = 51.6 bits (122), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 46/177 (25%), Positives = 77/177 (43%), Gaps = 22/177 (12%)

Query: 35  KLWSI-DCSK-GLMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSVSFRPHSSIL 92
           ++WSI D  K      +S+D+ I +  L  M          S H  SV +V F P    L
Sbjct: 42  RIWSIPDILKFASNPNASTDKDILMKPLSTM----------SRHAGSVTTVKFSPDGKYL 91

Query: 93  AAGSFDSTISIWGKE-EDADPQDDFPETEL-----LAIIEGHENEVKAVSWSHSGYYLAS 146
           A+GS D  + IW  E     P      T++        +  H+N+++ + W+     + S
Sbjct: 92  ASGSDDRILLIWELEGGTTQPMFGAESTDIEHWNVRRRLVAHDNDIQDICWAPDSSIMVS 151

Query: 147 CSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWK 203
              D+++ IW     G  +E +     H   VK VV+       A++S D TI++++
Sbjct: 152 VGLDRAIIIWN----GSTFEKVKRFDVHQSHVKGVVFDPANKYFATASDDRTIKMFR 204

>KLLA0B01958g join(170646..170663,170896..173550) similar to
           sp|P41811 Saccharomyces cerevisiae YGL137w SEC27
           coatomer complex beta chain (beta -cop) of secretory
           pathway vesicles, hypothetical start
          Length = 890

 Score = 54.3 bits (129), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 59/229 (25%), Positives = 98/229 (42%), Gaps = 31/229 (13%)

Query: 24  ELLKSLKLHTDKLWSIDC--SKGLMATSSSDRKIKLVN-LKNMDFQLVEELDDSTHKKSV 80
           E +   + H D + SI    +K  + T S D  IKL N  KN   Q       + H+  V
Sbjct: 88  EKVTEFEAHPDYIRSIAVHPTKPFVLTGSDDLTIKLWNWEKNWGCQQTF----TGHEHFV 143

Query: 81  RSVSFRPH-SSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWS- 138
            SV+F P   +  A+G  D TI +W   +D       P   L A      +E K V++  
Sbjct: 144 MSVAFNPKDPNQFASGCLDHTIKVWSIGQDV------PNFTLKA------HETKGVNYVD 191

Query: 139 ----HSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSS 194
                   YL + S D ++ +W+     +    ++ L+ H  +V + V+H  + ++ S S
Sbjct: 192 YYPLQDKPYLITTSDDGTIKVWDY----QTKSNVATLEGHMANVSYAVFHPTLPIIISGS 247

Query: 195 YDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDS 243
            D T+++W  +A+ ++    LN      WC     S     +AS  D+ 
Sbjct: 248 EDGTLKIW--NANTYKLEKTLNIGLERSWCIATHPSGKRNYIASGFDNG 294

 Score = 51.6 bits (122), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 51/212 (24%), Positives = 93/212 (43%), Gaps = 23/212 (10%)

Query: 41  CSKGLMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSVSFRPHSSILAAGSFDST 100
             K  +   S D K+++ N      + V E +   H   +RS++  P    +  GS D T
Sbjct: 65  ARKNWVVVGSDDFKLRVYNYNTG--EKVTEFE--AHPDYIRSIAVHPTKPFVLTGSDDLT 120

Query: 101 ISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHS-GYYLASCSRDKSVWIWEAD 159
           I +W  E++   Q  F          GHE+ V +V+++       AS   D ++ +W   
Sbjct: 121 IKLWNWEKNWGCQQTF---------TGHEHFVMSVAFNPKDPNQFASGCLDHTIKVWS-- 169

Query: 160 ELGEEYECLSVLQEHAQDVKHVVWHS--EMHLLASSSYDDTIRLWKEDADDWECAAVLNG 217
            +G++    ++     + V +V ++   +   L ++S D TI++W  D       A L G
Sbjct: 170 -IGQDVPNFTLKAHETKGVNYVDYYPLQDKPYLITTSDDGTIKVW--DYQTKSNVATLEG 226

Query: 218 HKGTVWCSDFEKSESSLRLASCSDDSTVRVWN 249
           H   V  + F  +   +   S S+D T+++WN
Sbjct: 227 HMANVSYAVFHPTLPII--ISGSEDGTLKIWN 256

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 63/281 (22%), Positives = 116/281 (41%), Gaps = 35/281 (12%)

Query: 21  MSLELLKSLKLHTDKLWSIDCSKG---LMATSSSDRKIKLVNLKNMDFQLVEELDDSTHK 77
           M L++ K L   TD++  ID       ++ T  S R I++ N +         L D+   
Sbjct: 1   MKLDINKKLSARTDRVKGIDFHPEEPWVLITLYSGR-IEIWNYETQTQVRSIPLCDA--- 56

Query: 78  KSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSW 137
             VR+  F    + +  GS D  + ++          ++   E +   E H + +++++ 
Sbjct: 57  -PVRAGRFIARKNWVVVGSDDFKLRVY----------NYNTGEKVTEFEAHPDYIRSIAV 105

Query: 138 SHSGYYLASCSRDKSV--WIWEADELGEEYECLSVLQEHAQDVKHVVWHS-EMHLLASSS 194
             +  ++ + S D ++  W WE +     + C      H   V  V ++  + +  AS  
Sbjct: 106 HPTKPFVLTGSDDLTIKLWNWEKN-----WGCQQTFTGHEHFVMSVAFNPKDPNQFASGC 160

Query: 195 YDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNYVEEE 254
            D TI++W    D        +  KG  +  D+   +    L + SDD T++VW+Y    
Sbjct: 161 LDHTIKVWSIGQDVPNFTLKAHETKGVNYV-DYYPLQDKPYLITTSDDGTIKVWDY---- 215

Query: 255 ENGEDVWAQEAILPNVHSRAVYSVSWSLDGYIASVGSDGLL 295
           +   +V   E  + NV S AV+  +  +   I S   DG L
Sbjct: 216 QTKSNVATLEGHMANV-SYAVFHPTLPI---IISGSEDGTL 252

 Score = 38.9 bits (89), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 39/182 (21%), Positives = 64/182 (35%), Gaps = 56/182 (30%)

Query: 166 ECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCS 225
           E ++  + H   ++ +  H     + + S D TI+LW  + + W C     GH+  V   
Sbjct: 88  EKVTEFEAHPDYIRSIAVHPTKPFVLTGSDDLTIKLWNWEKN-WGCQQTFTGHEHFVMSV 146

Query: 226 DFEKSESSLRLASCSDDSTVRVWNYVEEEENGEDVWAQEAILPNVHSRAVYSVSWSLDGY 285
            F   + + + AS   D T++VW+       G+DV       PN   +A           
Sbjct: 147 AFNPKDPN-QFASGCLDHTIKVWSI------GQDV-------PNFTLKA----------- 181

Query: 286 IASVGSDGLLXXXXXXXXXXXXXXXQQHEAHGIYEINVVKWATVDDSVLLLTGGDDGCAN 345
                                      HE  G+   N V +  + D   L+T  DDG   
Sbjct: 182 ---------------------------HETKGV---NYVDYYPLQDKPYLITTSDDGTIK 211

Query: 346 IW 347
           +W
Sbjct: 212 VW 213

>YPR178W (PRP4) [5592] chr16 (892326..893723) U4/U6 snRNA-associated
           splicing factor, member of WD (WD-40) repeat family
           [1398 bp, 465 aa]
          Length = 465

 Score = 53.9 bits (128), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 61/248 (24%), Positives = 108/248 (43%), Gaps = 34/248 (13%)

Query: 53  RKIKLVNLKNMDF---QLVEELDDSTHKKSVRSVSFRPHSSILAAGSFDSTISIWGKEED 109
           R+ +L  + N++    QLV         K + +VS      ++A GS+   + +      
Sbjct: 155 RRTELQRMANLELAGSQLVS-------TKPISAVSLSTDDMVVATGSWAGDLQVL----- 202

Query: 110 ADPQDDFPETELLAIIEGHENEVKAVSW-SHSGYYLASCSRDKSVWIWEADELGEEYECL 168
            + Q   P T+ L   + H  ++ A+ W   S   + SC+ D  +  ++          L
Sbjct: 203 -NSQTLQPLTQKL---DSHVGKIGAIDWHPDSNNQMISCAEDGLIKNFQYSNEEGGLRLL 258

Query: 169 SVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFE 228
             L  H + +  V +H     + S+S+D T RLW  DA   +   +  GH   V+   F+
Sbjct: 259 GDLVGHERRISDVKYHPSGKFIGSASHDMTWRLW--DASTHQELLLQEGHDKGVFSLSFQ 316

Query: 229 KSESSLRLASCSDDSTVRVWNYVEEEENGEDVWAQEAILPNVHSRAVYSVSWSLDGY-IA 287
             + SL + S   DS   +W+      +G  V          HS+ +Y+V+WS +GY +A
Sbjct: 317 -CDGSL-VCSGGMDSLSMLWDI----RSGSKVMTLAG-----HSKPIYTVAWSPNGYQVA 365

Query: 288 SVGSDGLL 295
           + G DG++
Sbjct: 366 TGGGDGII 373

 Score = 51.2 bits (121), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 53/229 (23%), Positives = 92/229 (40%), Gaps = 19/229 (8%)

Query: 25  LLKSLKLHTDKLWSID---CSKGLMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVR 81
           L + L  H  K+ +ID    S   M + + D  IK     N +  L    D   H++ + 
Sbjct: 210 LTQKLDSHVGKIGAIDWHPDSNNQMISCAEDGLIKNFQYSNEEGGLRLLGDLVGHERRIS 269

Query: 82  SVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSG 141
            V + P    + + S D T  +W         D     ELL + EGH+  V ++S+   G
Sbjct: 270 DVKYHPSGKFIGSASHDMTWRLW---------DASTHQELL-LQEGHDKGVFSLSFQCDG 319

Query: 142 YYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRL 201
             + S   D    +W+          +  L  H++ +  V W    + +A+   D  I +
Sbjct: 320 SLVCSGGMDSLSMLWDI----RSGSKVMTLAGHSKPIYTVAWSPNGYQVATGGGDGIINV 375

Query: 202 WK-EDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWN 249
           W     D+ +   +L  H+  V    F K +   +L SC  D+ + V++
Sbjct: 376 WDIRKRDEGQLNQIL-AHRNIVTQVRFSKEDGGKKLVSCGYDNLINVYS 423

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/129 (25%), Positives = 58/129 (44%), Gaps = 14/129 (10%)

Query: 76  HKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAV 135
           H K + +V++ P+   +A G  D  I++W    D   +D+    ++LA    H N V  V
Sbjct: 348 HSKPIYTVAWSPNGYQVATGGGDGIINVW----DIRKRDEGQLNQILA----HRNIVTQV 399

Query: 136 SWSH--SGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASS 193
            +S    G  L SC  D  + ++ +D     +  +  L  H   +  +   +  H L S 
Sbjct: 400 RFSKEDGGKKLVSCGYDNLINVYSSDT----WLKMGSLAGHTDKIISLDISNNSHFLVSG 455

Query: 194 SYDDTIRLW 202
            +D +I+LW
Sbjct: 456 GWDRSIKLW 464

 Score = 42.0 bits (97), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 56/248 (22%), Positives = 110/248 (44%), Gaps = 25/248 (10%)

Query: 14  KHTRLQRMS-LELLKSLKLHTDKLWSIDCSKG--LMATSSSDRKIKLVNLKNMDFQLVEE 70
           + T LQRM+ LEL  S  + T  + ++  S    ++AT S    ++++N + +   L ++
Sbjct: 155 RRTELQRMANLELAGSQLVSTKPISAVSLSTDDMVVATGSWAGDLQVLNSQTLQ-PLTQK 213

Query: 71  LDDSTHKKSVRSVSFRPHSS-ILAAGSFDSTIS--IWGKEEDADPQDDFPETELLAIIEG 127
           LD  +H   + ++ + P S+  + + + D  I    +  EE            LL  + G
Sbjct: 214 LD--SHVGKIGAIDWHPDSNNQMISCAEDGLIKNFQYSNEEGG--------LRLLGDLVG 263

Query: 128 HENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEM 187
           HE  +  V +  SG ++ S S D +  +W+A      ++ L + + H + V  + +  + 
Sbjct: 264 HERRISDVKYHPSGKFIGSASHDMTWRLWDA----STHQELLLQEGHDKGVFSLSFQCDG 319

Query: 188 HLLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRV 247
            L+ S   D    LW  D         L GH   ++   +  S +  ++A+   D  + V
Sbjct: 320 SLVCSGGMDSLSMLW--DIRSGSKVMTLAGHSKPIYTVAW--SPNGYQVATGGGDGIINV 375

Query: 248 WNYVEEEE 255
           W+  + +E
Sbjct: 376 WDIRKRDE 383

>KLLA0E12287g join(1086778..1087329,1087730..1088158) similar to
           sp|P38011 Saccharomyces cerevisiae YMR116c ASC1 40S
           small subunit ribosomal protein, start by similarity
          Length = 326

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 42/133 (31%), Positives = 67/133 (50%), Gaps = 6/133 (4%)

Query: 121 LLAIIEGHENEVKAVSWSHS-GYYLASCSRDKSVWIWEADELGEEYEC-LSVLQEHAQDV 178
           L   +EGH   V ++S S +    L S SRDK++  W   E  +++   +   + H+  V
Sbjct: 10  LRGTLEGHNGWVTSLSTSAAQPNLLVSGSRDKTLISWRLTENEQQFGVPVRSYKGHSHIV 69

Query: 179 KHVVWHSEMHLLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLAS 238
           + VV  ++ +   S+S+D T+RLW     + E   V  GH G V     + + S  ++ S
Sbjct: 70  QDVVVSADGNYAVSASWDKTLRLWNLATGNSEARFV--GHTGDVLSVAIDANSS--KIIS 125

Query: 239 CSDDSTVRVWNYV 251
            S D T+RVWN V
Sbjct: 126 ASRDKTIRVWNTV 138

>Scas_702.16
          Length = 816

 Score = 53.9 bits (128), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 50/193 (25%), Positives = 81/193 (41%), Gaps = 26/193 (13%)

Query: 80  VRSVSFRPHSSILAAGSFDSTISIWGKE------EDADPQDDFP-ETEL---LAIIEGHE 129
           + +V   P    +A G  D  I IW  +      +    +D+ P + EL   LA +  H 
Sbjct: 20  IYTVDVSPDGKRVATGGLDGKIRIWSVDSIKQIVKILSLKDEVPIDKELKKPLASMSRHT 79

Query: 130 NEVKAVSWSHSGYYLASCSRDKSVWIWEADE-------LGEEYE-----CLSVLQEHAQD 177
             V  + +S +G YLAS S D+ + IW  DE        G E E         L  H  D
Sbjct: 80  GSVTCLKFSPNGKYLASGSDDRILLIWTLDEERPIQPIFGGESEKERWAVRKRLVAHDND 139

Query: 178 VKHVVWHSEMHLLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLA 237
           ++ + W  +  LL S   D  + +W  +   +E     + H+  V    F+ +      A
Sbjct: 140 IQDICWAPDSSLLVSVGLDRAVIIW--NGITFEKLKRFDVHQSHVKGVIFDPANKY--FA 195

Query: 238 SCSDDSTVRVWNY 250
           + SDD T++++ Y
Sbjct: 196 TASDDRTMKIFRY 208

 Score = 35.4 bits (80), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 41/181 (22%), Positives = 75/181 (41%), Gaps = 61/181 (33%)

Query: 35  KLWSIDCSKGLMATSSSDRKIKLVNLKN---MDFQLVEELDD-STHKKSVRSVSFRPHSS 90
           ++WS+D  K +         +K+++LK+   +D +L + L   S H  SV  + F P+  
Sbjct: 42  RIWSVDSIKQI---------VKILSLKDEVPIDKELKKPLASMSRHTGSVTCLKFSPNGK 92

Query: 91  ILAAGSFDSTISIWGKEEDADPQDDF----------------------------PETELL 122
            LA+GS D  + IW  +E+   Q  F                            P++ LL
Sbjct: 93  YLASGSDDRILLIWTLDEERPIQPIFGGESEKERWAVRKRLVAHDNDIQDICWAPDSSLL 152

Query: 123 -------AII-------------EGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELG 162
                  A+I             + H++ VK V +  +  Y A+ S D+++ I+   ++G
Sbjct: 153 VSVGLDRAVIIWNGITFEKLKRFDVHQSHVKGVIFDPANKYFATASDDRTMKIFRYHKIG 212

Query: 163 E 163
           +
Sbjct: 213 D 213

 Score = 32.7 bits (73), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 42/176 (23%), Positives = 65/176 (36%), Gaps = 40/176 (22%)

Query: 126 EGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHS 185
           E    E+  V  S  G  +A+   D  + IW  D + +  + LS+  E   D        
Sbjct: 14  ESRSYEIYTVDVSPDGKRVATGGLDGKIRIWSVDSIKQIVKILSLKDEVPID-------K 66

Query: 186 EMHLLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTV 245
           E+                      +  A ++ H G+V C  F  S +   LAS SDD  +
Sbjct: 67  ELK---------------------KPLASMSRHTGSVTCLKF--SPNGKYLASGSDDRIL 103

Query: 246 RVWNYVEEE--------ENGEDVWAQEAILPNVHSRAVYSVSWSLD-GYIASVGSD 292
            +W   EE         E+ ++ WA    L   H   +  + W+ D   + SVG D
Sbjct: 104 LIWTLDEERPIQPIFGGESEKERWAVRKRL-VAHDNDIQDICWAPDSSLLVSVGLD 158

>CAGL0H08932g join(871668..871685,872089..874779) highly similar to
           sp|P41811 Saccharomyces cerevisiae YGL137w SEC27
          Length = 902

 Score = 53.1 bits (126), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 60/265 (22%), Positives = 111/265 (41%), Gaps = 41/265 (15%)

Query: 10  TFSHKHTRLQRMSLE-----LLKSLKLHTDKLWSIDCS---KGLMATSSSDRKIKLVNLK 61
           TFS +  R++ + L      +L +L     ++W+ +     + +  T +  R  K +  K
Sbjct: 8   TFSKRSNRVKGIDLHPSEPWVLTTLYSGRVEIWNYETQQEVRSIQVTDTPVRAGKFITRK 67

Query: 62  N-------------MDFQLVEELDD-STHKKSVRSVSFRPHSSILAAGSFDSTISIWGKE 107
           N              ++   E++ D   H   +RS++  P    +  GS D T+ +W  E
Sbjct: 68  NWIVVGSDDNKVRVFNYNTGEKVADFVAHPDYIRSIAVHPSKPYILTGSDDLTVKLWNWE 127

Query: 108 EDADPQDDFPETELLAIIEGHENEVKAVSWSHS-GYYLASCSRDKSVWIWEADELGEEYE 166
            D   +  F         +GHE+ V  V+++       AS   D  V +W    LG+   
Sbjct: 128 NDWSLEQTF---------KGHEHFVMCVAFNPKDPNVFASGCLDHKVKVW---SLGQSTP 175

Query: 167 CLSVLQEHAQDVKHVVWH--SEMHLLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWC 224
             ++     + V +V ++   +   + +SS D T++++  D     C A L GH   V  
Sbjct: 176 NFTLHTGQEKGVNYVDYYPLPDKPYMITSSDDTTVKIF--DYQTKSCVATLEGHMSNVSF 233

Query: 225 SDFEKSESSLRLASCSDDSTVRVWN 249
           + F  +     + S S+D TV++WN
Sbjct: 234 AVFHPTLPI--IISGSEDGTVKLWN 256

 Score = 52.4 bits (124), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 50/198 (25%), Positives = 86/198 (43%), Gaps = 23/198 (11%)

Query: 32  HTDKLWSIDC--SKGLMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSVSFRPH- 88
           H D + SI    SK  + T S D  +KL N +N D+ L +      H+  V  V+F P  
Sbjct: 96  HPDYIRSIAVHPSKPYILTGSDDLTVKLWNWEN-DWSLEQTF--KGHEHFVMCVAFNPKD 152

Query: 89  SSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSH--SGYYLAS 146
            ++ A+G  D  + +W   +          T    +  G E  V  V +       Y+ +
Sbjct: 153 PNVFASGCLDHKVKVWSLGQ---------STPNFTLHTGQEKGVNYVDYYPLPDKPYMIT 203

Query: 147 CSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDA 206
            S D +V I++     +   C++ L+ H  +V   V+H  + ++ S S D T++LW  ++
Sbjct: 204 SSDDTTVKIFDY----QTKSCVATLEGHMSNVSFAVFHPTLPIIISGSEDGTVKLW--NS 257

Query: 207 DDWECAAVLNGHKGTVWC 224
             ++    LN      WC
Sbjct: 258 STYKLEKTLNLGLERSWC 275

 Score = 32.7 bits (73), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 34/175 (19%), Positives = 72/175 (41%), Gaps = 19/175 (10%)

Query: 79  SVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWS 138
            VR+  F    + +  GS D+ + ++          ++   E +A    H + +++++  
Sbjct: 57  PVRAGKFITRKNWIVVGSDDNKVRVF----------NYNTGEKVADFVAHPDYIRSIAVH 106

Query: 139 HSGYYLASCSRDKSV--WIWEADELGEEYECLSVLQEHAQDVKHVVWHS-EMHLLASSSY 195
            S  Y+ + S D +V  W WE D     +      + H   V  V ++  + ++ AS   
Sbjct: 107 PSKPYILTGSDDLTVKLWNWEND-----WSLEQTFKGHEHFVMCVAFNPKDPNVFASGCL 161

Query: 196 DDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNY 250
           D  +++W                KG  +  D+        + + SDD+TV++++Y
Sbjct: 162 DHKVKVWSLGQSTPNFTLHTGQEKGVNYV-DYYPLPDKPYMITSSDDTTVKIFDY 215

>Scas_707.22
          Length = 730

 Score = 53.1 bits (126), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 60/260 (23%), Positives = 114/260 (43%), Gaps = 42/260 (16%)

Query: 48  TSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSVSFRPHSSILAAGSFDSTISIWGKE 107
           T + DR++++ + ++  F  ++EL  S H+  V ++ +     I+ +GS D ++ IW   
Sbjct: 371 TGADDRQLRIYDARSKKF--LKEL--SGHEGGVWALKYD-ADGIIVSGSTDRSVRIW--- 422

Query: 108 EDADPQDDFPETELLAIIEGHENEVKA---VSWSHSGYYLASCSRDKSVWIWEA------ 158
                  D        + +GH + V+    V++ +  Y + + SRD ++ +W+       
Sbjct: 423 -------DIKRGCCTHVFKGHTSTVRCLEIVTYKNMKY-IVTGSRDNTLHVWKLIKEEKF 474

Query: 159 -DELGEEYEC-------LSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDADDWE 210
             EL   Y         + VL+ H   V+ +  H   +++ S SYD+ + +W  D    +
Sbjct: 475 DGELPMVYNTPEENPYFVGVLRGHMASVRTISGHG--NIVISGSYDNNLMVW--DIAQMK 530

Query: 211 CAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNYVEEEENGEDVWAQEAILPNV 270
           C  VL GH   ++ + ++      R  S S DST++VW+      NG       +  P  
Sbjct: 531 CLYVLIGHTDRIYSTIYDHKRQ--RCISASMDSTIKVWDLDNIWNNGNCTIITNSATP-- 586

Query: 271 HSRAVYSVSWSLDGYIASVG 290
               +     +L G+ A VG
Sbjct: 587 -CTKITGSMLTLQGHTALVG 605

 Score = 52.0 bits (123), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 49/208 (23%), Positives = 97/208 (46%), Gaps = 23/208 (11%)

Query: 22  SLELLKSLKLHTDKLWSIDC-SKGLMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSV 80
           S + LK L  H   +W++   + G++ + S+DR +++ ++K      V +     H  +V
Sbjct: 385 SKKFLKELSGHEGGVWALKYDADGIIVSGSTDRSVRIWDIKRGCCTHVFK----GHTSTV 440

Query: 81  RSVSFRPHSSI--LAAGSFDSTISIWG--KEEDADPQDDF----PETE--LLAIIEGHEN 130
           R +    + ++  +  GS D+T+ +W   KEE  D +       PE     + ++ GH  
Sbjct: 441 RCLEIVTYKNMKYIVTGSRDNTLHVWKLIKEEKFDGELPMVYNTPEENPYFVGVLRGHMA 500

Query: 131 EVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLL 190
            V+ +S    G  + S S D ++ +W+  ++    +CL VL  H   +   ++  +    
Sbjct: 501 SVRTISGH--GNIVISGSYDNNLMVWDIAQM----KCLYVLIGHTDRIYSTIYDHKRQRC 554

Query: 191 ASSSYDDTIRLWKEDA--DDWECAAVLN 216
            S+S D TI++W  D   ++  C  + N
Sbjct: 555 ISASMDSTIKVWDLDNIWNNGNCTIITN 582

>Scas_695.15
          Length = 327

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 63/289 (21%), Positives = 114/289 (39%), Gaps = 57/289 (19%)

Query: 21  MSLELLKSLKLHTDKLW---SIDCSKGLMATSSSDRKIKLVNLKNM----DFQLVEELDD 73
           MS+ L+ +   HT + W   +  CS+ +  + S   ++++ N K +     +Q V   D 
Sbjct: 21  MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLAAAGYQNVRLYDI 80

Query: 74  ST-----------HKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQD---DFPET 119
            T           HK +V SVSF+  +  +   S D TI +W     + P++   + P  
Sbjct: 81  RTTNPNAVATFEGHKGNVTSVSFQQDNKWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVN 140

Query: 120 ELLA------------------------------IIEGHENEVKAVSWSHSGYYLASCSR 149
           E++                               I +     ++++S +  G  L + + 
Sbjct: 141 EVVIHPNQGELISCDRDGTIKIWDLGENQCTHQLIPDDDNTSLQSLSVASDGSMLVAANN 200

Query: 150 DKSVWIWEADEL--GEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWK--ED 205
               ++WE          + ++    H   +  VV  S++  +A+ S D T ++W   E 
Sbjct: 201 KGDCYVWEMPNHTDASNLKPINKFSAHKDYITRVVLSSDVKHMATCSADRTAKIWSVGET 260

Query: 206 ADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNYVEEE 254
            DD+     L+GH+  VW   F  S  S  L + S D  VR+W+    E
Sbjct: 261 EDDFNLETTLDGHQRWVWDCAF--SADSAYLVTASSDHYVRLWDLSTRE 307

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 47/187 (25%), Positives = 83/187 (44%), Gaps = 13/187 (6%)

Query: 39  IDCSKGLMATSSSDRKIKLVNL--KNMDFQLVEELDDSTHKKSVRSVSFRPHSSILAAGS 96
           I  ++G + +   D  IK+ +L       QL+ + DD+T   S++S+S     S+L A +
Sbjct: 144 IHPNQGELISCDRDGTIKIWDLGENQCTHQLIPD-DDNT---SLQSLSVASDGSMLVAAN 199

Query: 97  FDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIW 156
                 +W      D  +  P  +  A    H++ +  V  S    ++A+CS D++  IW
Sbjct: 200 NKGDCYVWEMPNHTDASNLKPINKFSA----HKDYITRVVLSSDVKHMATCSADRTAKIW 255

Query: 157 EADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDADDWECAAVLN 216
              E  +++   + L  H + V    + ++   L ++S D  +RLW  D    E      
Sbjct: 256 SVGETEDDFNLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLW--DLSTREIVRQYG 313

Query: 217 G-HKGTV 222
           G HKG V
Sbjct: 314 GHHKGAV 320

>AGL024W [4287] [Homologous to ScYFL009W (CDC4) - SH; ScYER066W -
           NSH] complement(667539..669809) [2271 bp, 756 aa]
          Length = 756

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 57/225 (25%), Positives = 95/225 (42%), Gaps = 45/225 (20%)

Query: 91  ILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSW-SHSGY-YLASCS 148
           IL +GS D T+ IW          +    +   +  GH + V+ +    H G  Y+ + S
Sbjct: 420 ILVSGSTDRTVRIW----------NVKAGKCTHVFRGHTSTVRCLDVVEHGGIKYVVTGS 469

Query: 149 RDKSVWIWE-ADELGEEYEC---------------LSVLQEHAQDVKHVVWHSEMHLLAS 192
           RD ++ +W+  D    +Y                 + VL+ H   V+ V  H   +++ S
Sbjct: 470 RDNTLHVWKLPDPNSPDYNPNAMRQFNSIEDNPFFVGVLRGHMASVRTVSGHG--NIVVS 527

Query: 193 SSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNYVE 252
            SYD  + +W  D    +   VL GH   ++ + ++      R  S S D+TV+VW+  +
Sbjct: 528 GSYDHNLMVW--DIAKMKLLYVLTGHTDRIYSTLYDHKRK--RCISASMDTTVKVWDLSD 583

Query: 253 EEENGEDVWAQEAILPNVHSRAVYSVSWS---LDGYIASVGSDGL 294
              NG         +  ++S +   VS S   L G+ A VG  GL
Sbjct: 584 INNNGP--------VSQINSTSALKVSGSVRTLCGHTALVGLLGL 620

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 60/127 (47%), Gaps = 14/127 (11%)

Query: 125 IEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVW- 183
           ++GH  +V    +   G Y+ + + DK + +++AD   E+++   V  E        VW 
Sbjct: 362 LDGHRTKV-VTCFQFEGNYIITGADDKRINVYDADR--EQFKLELVGHEGG------VWA 412

Query: 184 --HSEMHLLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSD 241
             ++   +L S S D T+R+W   A   +C  V  GH  TV C D  +      + + S 
Sbjct: 413 LKYAGDEILVSGSTDRTVRIWNVKAG--KCTHVFRGHTSTVRCLDVVEHGGIKYVVTGSR 470

Query: 242 DSTVRVW 248
           D+T+ VW
Sbjct: 471 DNTLHVW 477

 Score = 42.0 bits (97), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 64/146 (43%), Gaps = 26/146 (17%)

Query: 76  HKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAV 135
           H  SVR+VS   H +I+ +GS+D  + +W          D  + +LL ++ GH + + + 
Sbjct: 511 HMASVRTVS--GHGNIVVSGSYDHNLMVW----------DIAKMKLLYVLTGHTDRIYST 558

Query: 136 SWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHA----QDVKHVVWHSEM---- 187
            + H      S S D +V +W+  ++        +    A      V+ +  H+ +    
Sbjct: 559 LYDHKRKRCISASMDTTVKVWDLSDINNNGPVSQINSTSALKVSGSVRTLCGHTALVGLL 618

Query: 188 ----HLLASSSYDDTIRLWKEDADDW 209
                 L S++ D ++R W  DA D+
Sbjct: 619 GLSDKYLVSAAADGSLRGW--DASDY 642

>KLLA0C16643g complement(1457590..1458498) highly similar to
           sp|Q04491 Saccharomyces cerevisiae YLR208w SEC13 protein
           transport protein, start by similarity
          Length = 302

 Score = 51.6 bits (122), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 48/163 (29%), Positives = 71/163 (43%), Gaps = 11/163 (6%)

Query: 121 LLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKH 180
           ++ I   H   +      + G  LA+CS D +V I+E +  GE ++ +  LQ H   V  
Sbjct: 1   MVTINNAHSELIHDAVLDYYGKRLATCSSDHTVKIFEVE--GETHKLVDTLQGHEGPVWQ 58

Query: 181 VVW-HSEMH-LLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLAS 238
           V W H +   +LAS SYD  + +WKE    W   A    H  +V    +   E    L +
Sbjct: 59  VDWAHPKFGVILASCSYDGKVLIWKEVNGRWSQIAAHEVHSASVNSIQWAPHEYGPLLLA 118

Query: 239 CSDDSTVRVWNYVEEEENGEDVWAQEAILPNVHSRAVYSVSWS 281
            S D  V V   VE +ENG        I+ + HS    +  W+
Sbjct: 119 ASSDGKVSV---VEFKENG----TTSPIIIDAHSIGANTACWA 154

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 36/107 (33%), Positives = 57/107 (53%), Gaps = 10/107 (9%)

Query: 190 LASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWN 249
           LA+ S D T+++++ + +  +    L GH+G VW  D+   +  + LASCS D  V +W 
Sbjct: 24  LATCSSDHTVKIFEVEGETHKLVDTLQGHEGPVWQVDWAHPKFGVILASCSYDGKVLIW- 82

Query: 250 YVEEEENGEDVWAQEAILPNVHSRAVYSVSWSLDGY---IASVGSDG 293
              +E NG   W+Q A    VHS +V S+ W+   Y   + +  SDG
Sbjct: 83  ---KEVNGR--WSQIAA-HEVHSASVNSIQWAPHEYGPLLLAASSDG 123

 Score = 47.8 bits (112), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 64/269 (23%), Positives = 107/269 (39%), Gaps = 41/269 (15%)

Query: 46  MATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSV--SFRPHSSILAAGSFDSTISI 103
           +AT SSD  +K+  ++    +LV+ L    H+  V  V  +      ILA+ S+D  + I
Sbjct: 24  LATCSSDHTVKIFEVEGETHKLVDTLQG--HEGPVWQVDWAHPKFGVILASCSYDGKVLI 81

Query: 104 WGKEEDADPQDDFPETELLAIIEGHENEVKAVSWS--HSGYYLASCSRDKSVWIWEADE- 160
           W +      Q        +A  E H   V ++ W+    G  L + S D  V + E  E 
Sbjct: 82  WKEVNGRWSQ--------IAAHEVHSASVNSIQWAPHEYGPLLLAASSDGKVSVVEFKEN 133

Query: 161 ------------LGEEYEC---LSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWK-- 203
                       +G    C    ++ Q+  Q         ++    +   D+ +++WK  
Sbjct: 134 GTTSPIIIDAHSIGANTACWAPATLQQQSNQGTSGSASPQQVRRFVTGGADNLVKIWKYN 193

Query: 204 EDADDWECAAVLNGHKGTVWCSDFEKSESSLR---LASCSDDSTVRVWNYVEEEENGEDV 260
            DA  +     L GH    W  D   S + L    LAS S D T  +W     +++ ED 
Sbjct: 194 SDAATYLLEHTLEGHSD--WVRDVAWSPTVLSRSYLASVSQDRTCIIWT----QDSKEDT 247

Query: 261 WAQEAILPNVHSRAVYSVSWSLDGYIASV 289
           W +  +  +     ++  SWSL G I ++
Sbjct: 248 WKKTLLKEDKFPDVLWRASWSLSGNILAL 276

 Score = 47.4 bits (111), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 62/128 (48%), Gaps = 13/128 (10%)

Query: 92  LAAGSFDSTISIWGKEEDADPQDDFPETELLA-IIEGHENEVKAVSWSH---SGYYLASC 147
              G  D+ + IW    DA        T LL   +EGH + V+ V+WS    S  YLAS 
Sbjct: 178 FVTGGADNLVKIWKYNSDA-------ATYLLEHTLEGHSDWVRDVAWSPTVLSRSYLASV 230

Query: 148 SRDKSVWIWEADELGEEYECLSVLQEHAQDVK-HVVWHSEMHLLASSSYDDTIRLWKEDA 206
           S+D++  IW  D   + ++   + ++   DV     W    ++LA S  D+T+ LWKE+ 
Sbjct: 231 SQDRTCIIWTQDSKEDTWKKTLLKEDKFPDVLWRASWSLSGNILALSCGDNTVTLWKENL 290

Query: 207 D-DWECAA 213
           +  WE A 
Sbjct: 291 EGKWEPAG 298

>Scas_603.5
          Length = 589

 Score = 52.0 bits (123), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 63/229 (27%), Positives = 97/229 (42%), Gaps = 27/229 (11%)

Query: 31  LHTDKLWSID---CSKGLMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSVSFRP 87
           ++TD +  +D    +K L      +  IK+ +L+  D   V +LDD  H  SV  +   P
Sbjct: 292 VYTDTVTCLDFDLSTKMLYTAGKYNTSIKVWDLETND--QVMDLDD--HIASVTCMQLHP 347

Query: 88  HSSILAAGSFDSTISIWGKEEDADPQDDFPET----ELLAIIEGHENEVKAVSWSHSGYY 143
            S  L  GS D+T+ +W  +    PQ     T      +   E H  E+ +VS+ +   Y
Sbjct: 348 DSKTLITGSKDATLKLW--DLGLAPQTSLDSTSNIDSCINTFEAHTAEITSVSYDNE--Y 403

Query: 144 LASCSRDKSVWIWEADELGEEYECLSVLQEH-----AQDVKHVVWHSEMHLLASSSYDDT 198
           L S SRDKS+  W+    G   + L     H      +D       S    LA+ S D  
Sbjct: 404 LLSASRDKSIRQWDL-TTGNCVQTLEATLSHNSGTNIKDSTVEALQSVGAALATGSKDGI 462

Query: 199 IRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRV 247
           IRLW  D    +    L  H+G +    F+    S ++ + S D+ + V
Sbjct: 463 IRLW--DLRSGKVVRTLLKHQGPITSLQFD----STKIITGSTDANISV 505

>Scas_673.11
          Length = 434

 Score = 51.6 bits (122), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 39/183 (21%), Positives = 82/183 (44%), Gaps = 21/183 (11%)

Query: 76  HKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAV 135
           H  SV +++  P   ++  G  D+   +W               +    +EGH   V A 
Sbjct: 68  HTDSVFTIAHHPTLPLVVTGGGDNVAHLWTSHSQP--------PKFAGTLEGHTESVVAS 119

Query: 136 SWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVW---HSEMH-LLA 191
           +++H G +L +      + + ++++ G ++   S LQE    V+ VVW   H  +  + A
Sbjct: 120 AFTHDGQFLVTADMTGKIMVHKSNKSGSQWSLTSTLQE----VEEVVWLKCHPVISGVFA 175

Query: 192 SSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCS-----DFEKSESSLRLASCSDDSTVR 246
             + D ++  ++ + +D     +++G      C+     + ++ E+ L L +CS DS++ 
Sbjct: 176 FGATDGSVWCYQINDNDGSVEQLMSGFIHQQDCTMGEFINIDQGENVLELVTCSVDSSIV 235

Query: 247 VWN 249
            WN
Sbjct: 236 GWN 238

 Score = 28.5 bits (62), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 14/60 (23%), Positives = 25/60 (41%)

Query: 168 LSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDF 227
           ++   +H   V  +  H  + L+ +   D+   LW   +   + A  L GH  +V  S F
Sbjct: 62  VAYFDKHTDSVFTIAHHPTLPLVVTGGGDNVAHLWTSHSQPPKFAGTLEGHTESVVASAF 121

>YKL213C (DOA1) [3062] chr11 complement(31961..34108) Protein
           required in ubiquitin proteolysis and found complexed
           with Cdc48p, has WD (WD-40) repeats [2148 bp, 715 aa]
          Length = 715

 Score = 51.2 bits (121), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 57/223 (25%), Positives = 103/223 (46%), Gaps = 39/223 (17%)

Query: 76  HKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEV--- 132
           H+ +V S+SF+    ++ +GS+D T  +W             E  L+  ++ H   V   
Sbjct: 98  HQGNVCSLSFQ--DGVVISGSWDKTAKVW------------KEGSLVYNLQAHNASVWDA 143

Query: 133 KAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLAS 192
           K VS+S + +  AS   DK++ +W+ D++ + +  +     H   V+H+    + H ++ 
Sbjct: 144 KVVSFSENKFLTASA--DKTIKLWQNDKVIKTFSGI-----HNDVVRHLAVVDDGHFISC 196

Query: 193 SSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNYVE 252
           S+ D  I+L   D    +      GH+  V+C     +     + SC +D TVR+W+   
Sbjct: 197 SN-DGLIKLV--DMHTGDVLRTYEGHESFVYCIKLLPNGD---IVSCGEDRTVRIWS--- 247

Query: 253 EEENGEDVWAQEAILPNVHSRAVYSVSWSLDGYIASVGSDGLL 295
            +ENG     Q   LP +   +++SV    +G I    SD L+
Sbjct: 248 -KENGS--LKQVITLPAI---SIWSVDCMSNGDIIVGSSDNLV 284

>KLLA0F27511g 2546533..2548404 similar to sp|P39014 Saccharomyces
           cerevisiae YIL046w MET30 involved in regulation of
           sulfur assimilation genes and cell cycle progression,
           start by similarity
          Length = 623

 Score = 50.8 bits (120), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 46/174 (26%), Positives = 74/174 (42%), Gaps = 25/174 (14%)

Query: 76  HKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAV 135
           H   V S+ F  +  +L  GS+DST++IW          D     L+  + GH + VK +
Sbjct: 311 HMDGVLSLKF--NHRLLFTGSYDSTVAIW----------DTKSGNLIRRLTGHTDGVKGI 358

Query: 136 SWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSY 195
            +       AS  +   VW +          C+S  + H   V  V   S   ++ S+S 
Sbjct: 359 YFDDQKMITASLDKTIRVWNYITG------SCISTYRGHQDSVLSV--DSYKKIIVSASA 410

Query: 196 DDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWN 249
           D T+++W  ++        L GH  T W +  +    S    S SDD T+R+W+
Sbjct: 411 DKTVKVWHVES---RTCYTLRGH--TEWVNCVKLHPKSFTCYSSSDDKTLRMWD 459

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/226 (20%), Positives = 94/226 (41%), Gaps = 33/226 (14%)

Query: 26  LKSLKLHTDKLWSIDCSKGLMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSVSF 85
           + + + H D + S+D  K ++ ++S+D+ +K+ ++++     +       H + V  V  
Sbjct: 385 ISTYRGHQDSVLSVDSYKKIIVSASADKTVKVWHVESRTCYTLR-----GHTEWVNCVKL 439

Query: 86  RPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLA 145
            P S    + S D T+ +W          D      + +  GH  +V+ V    +     
Sbjct: 440 HPKSFTCYSSSDDKTLRMW----------DIRTNSCIKVFRGHVGQVQKV-IPLTIKDTE 488

Query: 146 SCSRDKSVWIWEADELGEEY--ECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWK 203
           +   D+ +      EL E++  +C  +   + +   H         L S S D+TI+LW 
Sbjct: 489 NLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTH---------LLSCSLDNTIKLW- 538

Query: 204 EDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWN 249
            +     C     GH   VW    + +  + R+ S S D +++VW+
Sbjct: 539 -EVSSGRCIRTQFGHVEGVW----DIAADNFRIVSGSHDKSIKVWD 579

 Score = 33.5 bits (75), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 30/64 (46%), Gaps = 6/64 (9%)

Query: 188 HLLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRV 247
            LL + SYD T+ +W  D         L GH   V    F+      ++ + S D T+RV
Sbjct: 323 RLLFTGSYDSTVAIW--DTKSGNLIRRLTGHTDGVKGIYFDDQ----KMITASLDKTIRV 376

Query: 248 WNYV 251
           WNY+
Sbjct: 377 WNYI 380

>CAGL0B00748g 65727..68165 similar to sp|P25569 Saccharomyces
           cerevisiae YCL039w, hypothetical start
          Length = 812

 Score = 50.8 bits (120), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 68/122 (55%), Gaps = 11/122 (9%)

Query: 5   KHNLYTFSHKHTRLQRMSLELLKSLKLHTDKLWSIDCSK------GLMATSSSDRKIKLV 58
           K+NL       +  Q+++ E  K+L  H+D++W +  S        + A +++DRKI + 
Sbjct: 328 KYNL--LQDNTSNFQKIAFENEKTLTQHSDEVWYLQFSPDGRYLASVSADATTDRKIYIY 385

Query: 59  NLKNMDFQLVEELDDSTHKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPE 118
           +++N DFQ+ + L  S + + +  +SF P S +L +  F++ ++I+    + +P D  PE
Sbjct: 386 DVQN-DFQVYKIL--SGNSQCILYLSFSPDSKLLVSCPFNAIVNIYSIHAEGEPIDINPE 442

Query: 119 TE 120
           ++
Sbjct: 443 SD 444

 Score = 32.0 bits (71), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 17/79 (21%), Positives = 42/79 (53%), Gaps = 7/79 (8%)

Query: 128 HENEVKAVSWSHSGYYLASCS----RDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVW 183
           H +EV  + +S  G YLAS S     D+ ++I+   ++  +++   +L  ++Q + ++ +
Sbjct: 353 HSDEVWYLQFSPDGRYLASVSADATTDRKIYIY---DVQNDFQVYKILSGNSQCILYLSF 409

Query: 184 HSEMHLLASSSYDDTIRLW 202
             +  LL S  ++  + ++
Sbjct: 410 SPDSKLLVSCPFNAIVNIY 428

>Scas_720.83d
          Length = 915

 Score = 50.8 bits (120), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 45/181 (24%), Positives = 70/181 (38%), Gaps = 50/181 (27%)

Query: 126 EGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHS 185
           +GH +   ++++S  G  + + + D  + +W+         CL+  QEH   V  V +  
Sbjct: 340 QGHFDATNSLTYSPDGSRVVTAAEDGKIKVWDV----VSGFCLATFQEHTSSVTQVQFAK 395

Query: 186 EMHLLASSSYDDTIRLW------------KEDADDWECAAV------------------- 214
              +L SSS D T+R W              +   + C AV                   
Sbjct: 396 RGQVLFSSSLDGTVRAWDLIRYRNFRTFTAAERIQFNCLAVDPSGEVVCAGSLDNFDIHV 455

Query: 215 -----------LNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNYVEEEENGE--DVW 261
                      L+GH+G V C  F +  S L  AS S D TVRVW+     +  E  DV+
Sbjct: 456 WSVQTGQLLDTLSGHEGPVSCLAFSQENSVL--ASASWDKTVRVWSIFGRSQQVEPFDVY 513

Query: 262 A 262
           +
Sbjct: 514 S 514

 Score = 38.5 bits (88), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 27/125 (21%), Positives = 59/125 (47%), Gaps = 9/125 (7%)

Query: 135 VSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQ-----EHAQDVKHVVWHSEMHL 189
           V +S  G   A  +  + + IW+  +  E+ +    ++      H QD+  + W  +   
Sbjct: 102 VKFSPDGKLFA-LATGRFLQIWKTPDATEDRQFAPFVRYRVHAGHFQDILSLTWSLDSRF 160

Query: 190 LASSSYDDTIRLWKEDADDWECAAV-LNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVW 248
           + S+S D T R+W  D+++ + A++   GH+  V  + F   +   ++ + S D  + VW
Sbjct: 161 IISTSKDLTARIWSIDSEEKDLASMTFAGHRDYVMGAFFSADQE--KIYTVSKDGALFVW 218

Query: 249 NYVEE 253
            + ++
Sbjct: 219 EFTKK 223

 Score = 37.0 bits (84), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 42/177 (23%), Positives = 72/177 (40%), Gaps = 16/177 (9%)

Query: 32  HTDKLWSIDCSK--GLMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSVSFRPHS 89
           H   + +ID +K   L+ +   D +  L N     F+    L     K+    V F P  
Sbjct: 54  HRKNIATIDLNKQGTLLISVDEDGRAILTN-----FKAKTVLHHFNFKEKCYQVKFSPDG 108

Query: 90  SI--LAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLASC 147
            +  LA G F   + IW K  DA     F       +  GH  ++ +++WS    ++ S 
Sbjct: 109 KLFALATGRF---LQIW-KTPDATEDRQFAPFVRYRVHAGHFQDILSLTWSLDSRFIIST 164

Query: 148 SRDKSVWIWEADELGEEYECLSV-LQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWK 203
           S+D +  IW  D   EE +  S+    H   V    + ++   + + S D  + +W+
Sbjct: 165 SKDLTARIWSIDS--EEKDLASMTFAGHRDYVMGAFFSADQEKIYTVSKDGALFVWE 219

 Score = 35.8 bits (81), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 38/85 (44%), Gaps = 11/85 (12%)

Query: 87  PHSSILAAGSFDST-ISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLA 145
           P   ++ AGS D+  I +W  +            +LL  + GHE  V  +++S     LA
Sbjct: 438 PSGEVVCAGSLDNFDIHVWSVQTG----------QLLDTLSGHEGPVSCLAFSQENSVLA 487

Query: 146 SCSRDKSVWIWEADELGEEYECLSV 170
           S S DK+V +W      ++ E   V
Sbjct: 488 SASWDKTVRVWSIFGRSQQVEPFDV 512

 Score = 33.9 bits (76), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 37/174 (21%), Positives = 62/174 (35%), Gaps = 54/174 (31%)

Query: 71  LDDSTHKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHEN 130
           L    H  +  S+++ P  S +   + D  I +W          D      LA  + H +
Sbjct: 337 LKQQGHFDATNSLTYSPDGSRVVTAAEDGKIKVW----------DVVSGFCLATFQEHTS 386

Query: 131 EVKAVSWSHSGYYLASCSRDKSVWIWE------------ADELGEEYECLSV-------- 170
            V  V ++  G  L S S D +V  W+            A+ +  ++ CL+V        
Sbjct: 387 SVTQVQFAKRGQVLFSSSLDGTVRAWDLIRYRNFRTFTAAERI--QFNCLAVDPSGEVVC 444

Query: 171 ----------------------LQEHAQDVKHVVWHSEMHLLASSSYDDTIRLW 202
                                 L  H   V  + +  E  +LAS+S+D T+R+W
Sbjct: 445 AGSLDNFDIHVWSVQTGQLLDTLSGHEGPVSCLAFSQENSVLASASWDKTVRVW 498

>CAGL0H03729g 342948..343859 highly similar to sp|P41318
           Saccharomyces cerevisiae YNL006w LST8, start by
           similarity
          Length = 303

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 61/258 (23%), Positives = 114/258 (44%), Gaps = 38/258 (14%)

Query: 43  KGLMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSVSFRPHSSILAAGSFDSTIS 102
           K L+A ++  + I+L ++K  +   V   +   H+ +V SVSF+  +  +   S D TI 
Sbjct: 44  KKLLA-AAGHQNIRLYDIKTSNSNPVASFEG--HRGNVTSVSFQQDNKWMVTSSEDGTIK 100

Query: 103 IWGKEEDADPQD---DFPETELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEAD 159
           +W     + P++   + P  E+  +I  ++ E            L SC RD ++ IW   
Sbjct: 101 VWDIRSPSVPRNYKHNAPVNEV--VIHPNQGE------------LISCDRDGNIRIW--- 143

Query: 160 ELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWK----EDADDWECAAVL 215
           +LGE      +  E    ++ +   S+  +L +++      +W+     DA + + A   
Sbjct: 144 DLGENQCTHQLTPEDDVPLQSLSVASDGSMLVAANNKGNCYVWEMPNHTDASNLKPATKF 203

Query: 216 NGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNYVEEEENGEDVWAQEAILPNVHSRAV 275
             H    + +    S     +A+CS D T R+W+        ED +  E+ L + H R V
Sbjct: 204 KAHPS--YITRVLLSSDVKHMATCSADHTARIWSV-------EDNFNLESTL-DGHQRWV 253

Query: 276 YSVSWSLD-GYIASVGSD 292
           +  ++S D  Y+ +  SD
Sbjct: 254 WDCAFSADSAYLVTASSD 271

>Sklu_2160.3 YGL137W, Contig c2160 2536-4818 reverse complement
          Length = 760

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 37/155 (23%), Positives = 70/155 (45%), Gaps = 24/155 (15%)

Query: 76  HKKSVRSVSFRPH-SSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKA 134
           H+  V  V+F P   +  A+   D T+ IW   + +      P   + A      +E + 
Sbjct: 21  HEHFVMCVAFNPKDPNTFASACLDHTVKIWSLGQQS------PNFTMTA------HETRG 68

Query: 135 VSWS-----HSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHL 189
           V++          YL + S D+SV IW+     +   C++ L+ H  +V + ++H  + +
Sbjct: 69  VNFVDYYPLQDKPYLITSSDDRSVKIWDY----QTKSCVATLEGHMANVSYAIFHPSLPI 124

Query: 190 LASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWC 224
           + S S D T+++W  +A+ ++    LN      WC
Sbjct: 125 IISGSEDGTVKIW--NANTYKLEKTLNLGLERSWC 157

 Score = 45.1 bits (105), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 37/128 (28%), Positives = 60/128 (46%), Gaps = 10/128 (7%)

Query: 125 IEGHENEVKAVSWSHS-GYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVW 183
            EGHE+ V  V+++       AS   D +V IW    LG++    ++     + V  V +
Sbjct: 18  FEGHEHFVMCVAFNPKDPNTFASACLDHTVKIWS---LGQQSPNFTMTAHETRGVNFVDY 74

Query: 184 HS--EMHLLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSD 241
           +   +   L +SS D ++++W  D     C A L GH   V  + F  S   +   S S+
Sbjct: 75  YPLQDKPYLITSSDDRSVKIW--DYQTKSCVATLEGHMANVSYAIFHPSLPII--ISGSE 130

Query: 242 DSTVRVWN 249
           D TV++WN
Sbjct: 131 DGTVKIWN 138

>KLLA0E04741g 428278..429657 similar to sp|P20053 Saccharomyces
           cerevisiae YPR178w PRP4 U4/U6 snRNP 52 KD protein, start
           by similarity
          Length = 459

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 39/153 (25%), Positives = 65/153 (42%), Gaps = 17/153 (11%)

Query: 76  HKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAV 135
           H   V S+SF    S+++    D+   IW          D    + +  ++GH   + +V
Sbjct: 304 HSAEVFSLSFHNDGSLVSTAGLDAIALIW----------DIRSGKNIMSLQGHSKPIYSV 353

Query: 136 SWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEM-HLLASSS 194
            WS +GY LAS S D ++ +W+  + G     L+    H   V  V ++ +    L SS 
Sbjct: 354 DWSQNGYQLASGSGDGTIKVWDIRKKGNVETILA----HNSIVSQVKFNKQNGGYLVSSG 409

Query: 195 YDDTIRLWKEDADDWECAAVLNGHKGTVWCSDF 227
           YD  + ++ +   +W     L GH   V   D 
Sbjct: 410 YDKKVNIFND--GNWIKERSLEGHLDKVMSIDI 440

 Score = 42.0 bits (97), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 54/245 (22%), Positives = 105/245 (42%), Gaps = 41/245 (16%)

Query: 54  KIKLVNLKNMDFQLVEELDDSTHKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQ 113
           K+K  +LK M  Q+++E       K +  ++  P   ++A GS+   +S+          
Sbjct: 165 KLKQFSLKGM--QVIDE-------KPISEINTSPGGDLMACGSWSGNLSLV--------- 206

Query: 114 DDFPETELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQE 173
            D   +++         ++  + WS     +  C+ D  + I+++   G+E   + +L +
Sbjct: 207 -DNSLSKIYCNRSLSGTKISGLDWSVDSKNIFVCTHDGRIVIYDS---GDE-TTVKILYK 261

Query: 174 HAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDADDWECAAVL--NGHKGTVWCSDFEKSE 231
           +      V  H     + S+S+D T  L     D  + A +L   GH   V+   F    
Sbjct: 262 NDARFAQVRCHPCNSFIGSTSFDKTWIL----IDTVKQAPILIQEGHSAEVFSLSFHNDG 317

Query: 232 SSLRLASCSDDSTVRVWNYVEEEENGEDVWAQEAILPNVHSRAVYSVSWSLDGY-IASVG 290
           S +  A    D+   +W+      +G+++ + +      HS+ +YSV WS +GY +AS  
Sbjct: 318 SLVSTAGL--DAIALIWDI----RSGKNIMSLQG-----HSKPIYSVDWSQNGYQLASGS 366

Query: 291 SDGLL 295
            DG +
Sbjct: 367 GDGTI 371

>AAR057W [243] [Homologous to ScYCR057C (PWP2) - SH]
           complement(442821..445589) [2769 bp, 922 aa]
          Length = 922

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 43/184 (23%), Positives = 73/184 (39%), Gaps = 48/184 (26%)

Query: 126 EGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHS 185
           +GH + + A+++S  G  + + + D  + IW+         CL+  +EH   V  V +  
Sbjct: 353 QGHFDALNALAYSPDGARIVTAAEDGKIKIWDI----VSGFCLATFEEHTSSVTSVQFAK 408

Query: 186 EMHLLASSSYDDTIRLW-----------------------KEDADDWECAA--------- 213
              ++ SSS D T++ W                        +   +  CA          
Sbjct: 409 NGQIMFSSSLDGTVKAWDLMRFRNFRTFTATERIQFSCLAADPTGEVVCAGSLDNYDIQV 468

Query: 214 ----------VLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNYVEEEENGEDVWAQ 263
                      L+GH+G V C  F + E+S+ LAS S D T+RVW+     +  E + A 
Sbjct: 469 WSVQTGQLLDTLSGHEGPVSCLSFSR-ENSI-LASASWDKTIRVWSIFGRSQQVEPIEAY 526

Query: 264 EAIL 267
             +L
Sbjct: 527 SDVL 530

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/134 (26%), Positives = 62/134 (46%), Gaps = 16/134 (11%)

Query: 26  LKSLKLHTDKLWSIDCSKG--LMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSV 83
           L + + HT  + S+  +K   +M +SS D  +K  +L  M F+       +T +     +
Sbjct: 391 LATFEEHTSSVTSVQFAKNGQIMFSSSLDGTVKAWDL--MRFRNFRTFT-ATERIQFSCL 447

Query: 84  SFRPHSSILAAGSFDST-ISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGY 142
           +  P   ++ AGS D+  I +W  +            +LL  + GHE  V  +S+S    
Sbjct: 448 AADPTGEVVCAGSLDNYDIQVWSVQTG----------QLLDTLSGHEGPVSCLSFSRENS 497

Query: 143 YLASCSRDKSVWIW 156
            LAS S DK++ +W
Sbjct: 498 ILASASWDKTIRVW 511

 Score = 35.8 bits (81), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 38/172 (22%), Positives = 62/172 (36%), Gaps = 50/172 (29%)

Query: 71  LDDSTHKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHEN 130
           L    H  ++ ++++ P  + +   + D  I IW          D      LA  E H +
Sbjct: 350 LKQQGHFDALNALAYSPDGARIVTAAEDGKIKIW----------DIVSGFCLATFEEHTS 399

Query: 131 EVKAVSWSHSGYYLASCSRDKSVWIWE----------------------ADELGEEY--- 165
            V +V ++ +G  + S S D +V  W+                      AD  GE     
Sbjct: 400 SVTSVQFAKNGQIMFSSSLDGTVKAWDLMRFRNFRTFTATERIQFSCLAADPTGEVVCAG 459

Query: 166 ---------------ECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLW 202
                          + L  L  H   V  + +  E  +LAS+S+D TIR+W
Sbjct: 460 SLDNYDIQVWSVQTGQLLDTLSGHEGPVSCLSFSRENSILASASWDKTIRVW 511

 Score = 29.3 bits (64), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 41/205 (20%), Positives = 83/205 (40%), Gaps = 31/205 (15%)

Query: 3   MIKHNLYTFSHKHTR-LQRMSLELLKSLKLHTDKLWSIDCSKGLMATSSSDRKIKLVNLK 61
           +I +  +TF ++H R + R+ +    +L      L S+D           D +  LVN+K
Sbjct: 58  LIGNKSFTFEYEHRRNIARIDVNAQGTL------LLSVDV----------DGRAILVNIK 101

Query: 62  NMDFQLVEELDDSTHKKSVRSVSFRPHSSI--LAAGSFDSTISIWGKEEDADPQDDFPET 119
             +  ++   +    K  V  V F     +  LA G F   + IW +      +  F   
Sbjct: 102 TRN--VIHHFN---FKDKVNDVKFSTDGKLFALACGRF---LQIW-RTPGVSAERQFAPF 152

Query: 120 ELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSV-LQEHAQDV 178
               +  GH  ++ +++WS    ++ S ++D +  I+  +   EE +  S+    H   V
Sbjct: 153 VRYRVHAGHFADITSLTWSRDSRFIISTAKDMTARIYSVN--AEEKDLASMTFAGHRDYV 210

Query: 179 KHVVWHSEMHLLASSSYDDTIRLWK 203
               + ++   + + S D  +  W+
Sbjct: 211 MGAFFSADQEKIYTVSKDGALFQWE 235

>Kwal_23.6240
          Length = 913

 Score = 49.3 bits (116), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 48/204 (23%), Positives = 76/204 (37%), Gaps = 49/204 (24%)

Query: 126 EGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHS 185
           +GH +   AV++S  G  + + S D  + IW+         CL   QEH   V  + +  
Sbjct: 338 QGHFDATNAVTYSPDGSRVVTASEDGKIKIWDV----VSGFCLVTFQEHTAAVSALAFAK 393

Query: 186 EMHLLASSSYDDTIRLW-----------------------KEDADDWECAA--------- 213
              +L S+S D T+R W                        + + +  CA          
Sbjct: 394 RGQVLFSASLDGTVRAWDLVRYRNFRTFTAAERIQFNCLAADPSGEVVCAGSVDSFAVHV 453

Query: 214 ----------VLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNYVEEEENGEDVWAQ 263
                      L+GH+G V C  F +  S   LAS S D T+R+W+     +  E +   
Sbjct: 454 WSVQTGQLVETLDGHEGPVSCLSFSQENSV--LASASWDKTIRIWSIFGRSQQVEPLEVY 511

Query: 264 EAILP-NVHSRAVYSVSWSLDGYI 286
             +L  +V        + +LDG I
Sbjct: 512 ADVLSLSVRPDGNEVAAATLDGQI 535

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 49/236 (20%), Positives = 96/236 (40%), Gaps = 29/236 (12%)

Query: 25  LLKSLKLHTDKLWSIDCSKGLMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSVS 84
           LL ++    + L+S D ++ +    +      L++ K+  F+         H+K+V+ V+
Sbjct: 10  LLGTVYRQGNILFSEDGTQLISPVGNRVSVFDLIHNKSYTFEY-------EHRKNVQCVA 62

Query: 85  FRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYL 144
             P  ++L +   D    +           +F    +L      E  V  + +S  G   
Sbjct: 63  LNPQGTLLLSVDEDGRAILV----------NFRAKTVLHHFNFKE-PVSDLKFSPDGKVF 111

Query: 145 A-SCSRDKSVWIWEADELGEEYECLSVLQE-----HAQDVKHVVWHSEMHLLASSSYDDT 198
           A +C R   V +W+  ++ E+ +    ++      H  ++  + W  +   L S+S D T
Sbjct: 112 AIACGR--FVQVWKTPDVAEDRQFAPFVRHRVHAGHFSNIISLTWSRDSRFLISTSKDLT 169

Query: 199 IRLWKEDADDWECAAV-LNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNYVEE 253
            R+W  D+ +   A+V   GH+  V  + F   +   R+ + S D  V  W Y   
Sbjct: 170 ARIWSLDSQEKGLASVTFAGHRDYVMGAFFSADQE--RIYTVSKDGAVFQWEYTPR 223

 Score = 38.5 bits (88), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 40/85 (47%), Gaps = 11/85 (12%)

Query: 87  PHSSILAAGSFDS-TISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLA 145
           P   ++ AGS DS  + +W  +            +L+  ++GHE  V  +S+S     LA
Sbjct: 436 PSGEVVCAGSVDSFAVHVWSVQTG----------QLVETLDGHEGPVSCLSFSQENSVLA 485

Query: 146 SCSRDKSVWIWEADELGEEYECLSV 170
           S S DK++ IW      ++ E L V
Sbjct: 486 SASWDKTIRIWSIFGRSQQVEPLEV 510

 Score = 37.4 bits (85), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 41/74 (55%), Gaps = 6/74 (8%)

Query: 66  QLVEELDDSTHKKSVRSVSFRPHSSILAAGSFDSTISIW---GKEEDADPQDDFPETELL 122
           QLVE LD   H+  V  +SF   +S+LA+ S+D TI IW   G+ +  +P + + +   L
Sbjct: 460 QLVETLDG--HEGPVSCLSFSQENSVLASASWDKTIRIWSIFGRSQQVEPLEVYADVLSL 517

Query: 123 AIIEGHENEVKAVS 136
           + +    NEV A +
Sbjct: 518 S-VRPDGNEVAAAT 530

 Score = 36.2 bits (82), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 43/179 (24%), Positives = 69/179 (38%), Gaps = 23/179 (12%)

Query: 77  KKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVS 136
           +  V+ V+F  +S+ L  G  +    ++          + PE  L+  +   +N V  V 
Sbjct: 256 QARVKCVTFHANSNTLVVGFNNGEFRLY----------ELPEFTLIQQLSMGQNAVNTVC 305

Query: 137 WSHSGYYLASCSRDKS---VWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASS 193
            + SG +LA  S       V+ W++    E Y  +   Q H      V +  +   + ++
Sbjct: 306 VNDSGEWLAFGSSKLGQLLVYEWQS----ESY--ILKQQGHFDATNAVTYSPDGSRVVTA 359

Query: 194 SYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNYVE 252
           S D  I++W  D     C      H   V    F K    L  AS   D TVR W+ V 
Sbjct: 360 SEDGKIKIW--DVVSGFCLVTFQEHTAAVSALAFAKRGQVLFSASL--DGTVRAWDLVR 414

 Score = 35.8 bits (81), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 38/160 (23%), Positives = 65/160 (40%), Gaps = 28/160 (17%)

Query: 3   MIKHNLYTFSHKHTR-LQRMSLELLKSLKLHTDKLWSIDCSKGLMATSSSDRKIKLVNLK 61
           +I +  YTF ++H + +Q ++L    +L L  D+                D +  LVN  
Sbjct: 42  LIHNKSYTFEYEHRKNVQCVALNPQGTLLLSVDE----------------DGRAILVN-- 83

Query: 62  NMDFQLVEELDDSTHKKSVRSVSFRPHSSI--LAAGSFDSTISIWGKEEDADPQDDFPET 119
              F+    L     K+ V  + F P   +  +A G F   + +W K  D      F   
Sbjct: 84  ---FRAKTVLHHFNFKEPVSDLKFSPDGKVFAIACGRF---VQVW-KTPDVAEDRQFAPF 136

Query: 120 ELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEAD 159
               +  GH + + +++WS    +L S S+D +  IW  D
Sbjct: 137 VRHRVHAGHFSNIISLTWSRDSRFLISTSKDLTARIWSLD 176

 Score = 34.7 bits (78), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 40/167 (23%), Positives = 72/167 (43%), Gaps = 20/167 (11%)

Query: 37  WSIDCSKGLMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSVSFRPHSSILAAGS 96
           +S D S+  + T+S D KIK+ ++ +  F LV   +   H  +V +++F     +L + S
Sbjct: 349 YSPDGSR--VVTASEDGKIKIWDVVS-GFCLVTFQE---HTAAVSALAFAKRGQVLFSAS 402

Query: 97  FDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLASCSRDK-SVWI 155
            D T+  W         D                +   ++   SG  + + S D  +V +
Sbjct: 403 LDGTVRAW---------DLVRYRNFRTFTAAERIQFNCLAADPSGEVVCAGSVDSFAVHV 453

Query: 156 WEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLW 202
           W      +  + +  L  H   V  + +  E  +LAS+S+D TIR+W
Sbjct: 454 WSV----QTGQLVETLDGHEGPVSCLSFSQENSVLASASWDKTIRIW 496

>Kwal_26.7570
          Length = 218

 Score = 47.8 bits (112), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 39/135 (28%), Positives = 64/135 (47%), Gaps = 6/135 (4%)

Query: 121 LLAIIEGHENEVKAVSWSHS-GYYLASCSRDKSVWIWEADELGEEYEC-LSVLQEHAQDV 178
           L   +EGH   V +++ S +    L S SRDKS+  W+     ++Y   +   + H+  V
Sbjct: 9   LRGTLEGHNGWVTSLATSPAQPNLLLSGSRDKSLITWKLTGDDQQYGVPVRSFRGHSHIV 68

Query: 179 KHVVWHSEMHLLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLAS 238
           +      +     S+S+D T+RLW+      +C     GHK  V     ++  S  ++ S
Sbjct: 69  QDCTVTPDGEYALSASWDKTVRLWELATG--KCIQRFVGHKSDVLSVTIDRRAS--QIVS 124

Query: 239 CSDDSTVRVWNYVEE 253
            S D TV+VWN + E
Sbjct: 125 ASRDKTVKVWNTLGE 139

 Score = 44.3 bits (103), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 40/144 (27%), Positives = 61/144 (42%), Gaps = 13/144 (9%)

Query: 76  HKKSVRSVSFRP-HSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKA 134
           H   V S++  P   ++L +GS D ++  W    D D Q   P    +    GH + V+ 
Sbjct: 16  HNGWVTSLATSPAQPNLLLSGSRDKSLITWKLTGD-DQQYGVP----VRSFRGHSHIVQD 70

Query: 135 VSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSS 194
            + +  G Y  S S DK+V +WE        +C+     H  DV  V        + S+S
Sbjct: 71  CTVTPDGEYALSASWDKTVRLWEL----ATGKCIQRFVGHKSDVLSVTIDRRASQIVSAS 126

Query: 195 YDDTIRLWKEDADDWECAAVLNGH 218
            D T+++W       EC   L GH
Sbjct: 127 RDKTVKVWNTLG---ECMVTLLGH 147

 Score = 34.3 bits (77), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 59/138 (42%), Gaps = 35/138 (25%)

Query: 72  DDSTHKKSVRSVSFRPHSSILA------------AGSFDSTISIWGKEEDADPQDDFPET 119
           DD  +   VRS  FR HS I+             + S+D T+ +W          +    
Sbjct: 50  DDQQYGVPVRS--FRGHSHIVQDCTVTPDGEYALSASWDKTVRLW----------ELATG 97

Query: 120 ELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVK 179
           + +    GH+++V +V+       + S SRDK+V +W  + LG   EC+  L  H     
Sbjct: 98  KCIQRFVGHKSDVLSVTIDRRASQIVSASRDKTVKVW--NTLG---ECMVTLLGHND--- 149

Query: 180 HVVWHSEMHLLASSSYDD 197
              W S++ +  + S +D
Sbjct: 150 ---WVSQVRVAPNESPED 164

>YCR057C (PWP2) [586] chr3 complement(220452..223223) Essential
           protein required for cell separation, has eight WD
           (WD-40) repeats, component of U3 snoRNP (also called
           small subunit processome), which is required for 18S
           rRNA biogenesis [2772 bp, 923 aa]
          Length = 923

 Score = 48.9 bits (115), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 61/258 (23%), Positives = 102/258 (39%), Gaps = 61/258 (23%)

Query: 45  LMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSVSFRPHSSILAAGSFDSTISIW 104
           L+A   +  + +L +L   DF L+++L  S  +  V +VS       LA GS     S  
Sbjct: 274 LLAVGFTSGEFRLYDLP--DFTLIQQL--SMGQNPVNTVSVNQTGEWLAFGS-----SKL 324

Query: 105 GKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEE 164
           G+    + Q    E+ +L   +GH +   ++++S  G  + + S D  + +W+       
Sbjct: 325 GQLLVYEWQS---ESYILKQ-QGHFDSTNSLAYSPDGSRVVTASEDGKIKVWDI----TS 376

Query: 165 YECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLW------------KEDADDWECA 212
             CL+  +EH   V  V +     ++ SSS D T+R W              +   + C 
Sbjct: 377 GFCLATFEEHTSSVTAVQFAKRGQVMFSSSLDGTVRAWDLIRYRNFRTFTGTERIQFNCL 436

Query: 213 AV------------------------------LNGHKGTVWCSDFEKSESSLRLASCSDD 242
           AV                              L+GH+G V C  F +  S   LAS S D
Sbjct: 437 AVDPSGEVVCAGSLDNFDIHVWSVQTGQLLDALSGHEGPVSCLSFSQENSV--LASASWD 494

Query: 243 STVRVWNYVEEEENGEDV 260
            T+R+W+     +  E +
Sbjct: 495 KTIRIWSIFGRSQQVEPI 512

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/126 (22%), Positives = 59/126 (46%), Gaps = 9/126 (7%)

Query: 134 AVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQE-----HAQDVKHVVWHSEMH 188
           AV +S  G   A  S  + + IW+  ++ ++ +    ++      H QD+  + W  +  
Sbjct: 101 AVKFSPDGRLFALAS-GRFLQIWKTPDVNKDRQFAPFVRHRVHAGHFQDITSLTWSQDSR 159

Query: 189 LLASSSYDDTIRLWKEDADDWECAA-VLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRV 247
            + ++S D + ++W  D+++   AA   NGH+  V  + F   +   ++ + S D  V V
Sbjct: 160 FILTTSKDLSAKIWSVDSEEKNLAATTFNGHRDYVMGAFFSHDQE--KIYTVSKDGAVFV 217

Query: 248 WNYVEE 253
           W + + 
Sbjct: 218 WEFTKR 223

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 40/176 (22%), Positives = 72/176 (40%), Gaps = 14/176 (7%)

Query: 32  HTDKLWSIDCSK--GLMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSVSFRPHS 89
           H   + +ID +K   L+ +   D +  LVN K  +      L     K+   +V F P  
Sbjct: 54  HRKNIAAIDLNKQGTLLISIDEDGRAILVNFKARNV-----LHHFNFKEKCSAVKFSPDG 108

Query: 90  SI--LAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLASC 147
            +  LA+G F   + IW K  D +    F       +  GH  ++ +++WS    ++ + 
Sbjct: 109 RLFALASGRF---LQIW-KTPDVNKDRQFAPFVRHRVHAGHFQDITSLTWSQDSRFILTT 164

Query: 148 SRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWK 203
           S+D S  IW  D   E+    +    H   V    +  +   + + S D  + +W+
Sbjct: 165 SKDLSAKIWSVDS-EEKNLAATTFNGHRDYVMGAFFSHDQEKIYTVSKDGAVFVWE 219

 Score = 38.9 bits (89), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 36/151 (23%), Positives = 65/151 (43%), Gaps = 22/151 (14%)

Query: 26  LKSLKLHTDKLWSIDCSK--GLMATSSSDRKIK---LVNLKNMDFQLVEELDDSTHKKSV 80
           L + + HT  + ++  +K   +M +SS D  ++   L+  +N            T +   
Sbjct: 380 LATFEEHTSSVTAVQFAKRGQVMFSSSLDGTVRAWDLIRYRNF------RTFTGTERIQF 433

Query: 81  RSVSFRPHSSILAAGSFDST-ISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSH 139
             ++  P   ++ AGS D+  I +W  +            +LL  + GHE  V  +S+S 
Sbjct: 434 NCLAVDPSGEVVCAGSLDNFDIHVWSVQTG----------QLLDALSGHEGPVSCLSFSQ 483

Query: 140 SGYYLASCSRDKSVWIWEADELGEEYECLSV 170
               LAS S DK++ IW      ++ E + V
Sbjct: 484 ENSVLASASWDKTIRIWSIFGRSQQVEPIEV 514

>CAGL0L03201g complement(366795..368534) some similarities with
           sp|P47025 Saccharomyces cerevisiae YJL112w MDV1 or
           sp|P36130 Saccharomyces cerevisiae YKR036c CAF4 CCR4,
           hypothetical start
          Length = 579

 Score = 48.5 bits (114), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 55/243 (22%), Positives = 114/243 (46%), Gaps = 29/243 (11%)

Query: 24  ELLKSLKLHTDKLWS--IDCSKGLMATSSS-DRKIKLVNLKNMDFQLVEELDDSTHKKSV 80
           +L K+LK H D + S  I+   G+++++++ D +IKL ++     Q +  L  S H+ +V
Sbjct: 271 QLGKTLKCHDDYINSLAINAQLGVLSSTANLDNEIKLWDISTT--QCLGVL--SGHRATV 326

Query: 81  RSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHS 140
            +  F   + +LA+   D+++ +W  +   D   +  +   LA  +GH++ V A+  + +
Sbjct: 327 NTTRFIDDTRLLASAGKDASVKVWDVDNIVDKDGNANDNLCLATFDGHKDSVTAL--ATT 384

Query: 141 GYYLASCSRDKSVWIWE--ADELGEEYECLSVLQEHAQDVKHV----VWHSEM------- 187
           G  + S S DK++  W+  + +  +  +    L+   Q V  +     +++ +       
Sbjct: 385 GNAIVSGSNDKTLRHWDLGSGKCIQSIDLTIALKMVPQSVSKLDITPSFNTPLIGGADCI 444

Query: 188 -HLLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVR 246
            + L + + D  + LW  D         L GH+G +    +  SE    L + S D + R
Sbjct: 445 DNALVTGTKDGIVYLW--DLRIGRVVGSLEGHRGPITSLKYMGSE----LITGSMDKSTR 498

Query: 247 VWN 249
           +W+
Sbjct: 499 IWD 501

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 43/214 (20%), Positives = 94/214 (43%), Gaps = 36/214 (16%)

Query: 45  LMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSVSFRPHSSILAAGSFDSTISIW 104
           + + +++D K+ L+ L+  + Q+  +L     ++   ++  +  SS      F++ I   
Sbjct: 215 ITSENNTDDKVSLLTLEPDNAQIGNKL-----QRYFEAMKLKKKSSGFDIEDFENIIGTK 269

Query: 105 GKEEDADPQDDFPETELLAIIEGHENEVKAVSW-SHSGYYLASCSRDKSVWIWEADELGE 163
           G              +L   ++ H++ + +++  +  G   ++ + D  + +W+      
Sbjct: 270 G--------------QLGKTLKCHDDYINSLAINAQLGVLSSTANLDNEIKLWDI----S 311

Query: 164 EYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWKED--------ADDWECAAVL 215
             +CL VL  H   V    +  +  LLAS+  D ++++W  D        A+D  C A  
Sbjct: 312 TTQCLGVLSGHRATVNTTRFIDDTRLLASAGKDASVKVWDVDNIVDKDGNANDNLCLATF 371

Query: 216 NGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWN 249
           +GHK +V       + +   + S S+D T+R W+
Sbjct: 372 DGHKDSVTA----LATTGNAIVSGSNDKTLRHWD 401

>Kwal_56.24163
          Length = 729

 Score = 48.5 bits (114), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 37/147 (25%), Positives = 66/147 (44%), Gaps = 20/147 (13%)

Query: 82  SVSFRPH-SSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENE-VKAVSWS- 138
            V+F P   S  A+   D T+ IW       P  +F        ++ HE   V  V +  
Sbjct: 2   GVAFNPKDPSTFASACLDHTVKIWSL---GQPTANF-------TLQAHETRGVNYVDYYP 51

Query: 139 -HSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDD 197
                YL + S D++V IW+     +   C++ L+ H  +V + V+H  + ++ S S D 
Sbjct: 52  LQDKPYLITSSDDRTVKIWDY----QTKSCVATLEGHMANVSYAVFHPSLPIILSGSEDG 107

Query: 198 TIRLWKEDADDWECAAVLNGHKGTVWC 224
           T+++W  +++ ++    LN      WC
Sbjct: 108 TLKVW--NSNTYKLEKTLNLGLERSWC 132

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 50/108 (46%), Gaps = 9/108 (8%)

Query: 144 LASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHS--EMHLLASSSYDDTIRL 201
            AS   D +V IW    LG+     ++     + V +V ++   +   L +SS D T+++
Sbjct: 13  FASACLDHTVKIWS---LGQPTANFTLQAHETRGVNYVDYYPLQDKPYLITSSDDRTVKI 69

Query: 202 WKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWN 249
           W  D     C A L GH   V  + F  S   +   S S+D T++VWN
Sbjct: 70  W--DYQTKSCVATLEGHMANVSYAVFHPSLPII--LSGSEDGTLKVWN 113

>YPL183C (YPL183C) [5265] chr16 complement(199494..202535) Protein
           containing five WD domains (WD-40 repeat), which may
           mediate protein-protein interactions, has a region of
           low similarity to a region of S. pombe Tup11p, which is
           a transcriptional repressor functioning redundantly with
           Tup12p [3042 bp, 1013 aa]
          Length = 1013

 Score = 48.5 bits (114), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 61/118 (51%), Gaps = 14/118 (11%)

Query: 85  FRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYL 144
           F P    + AG+    + IW         D F ET++  ++ GHE  +  V+ S++G Y+
Sbjct: 145 FGPDKVYVNAGTVMGGVIIW---------DLFSETKIHNLL-GHEGSIFYVNLSNNGRYV 194

Query: 145 ASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLW 202
           ASCS D+S+ +W+  E G++   LSV   H   + ++++      L S S D T R+W
Sbjct: 195 ASCSDDRSIRLWDL-ETGKQ---LSVGWSHTARIWNLMFFDNDSKLISVSEDCTCRVW 248

>AFL014C [3179] [Homologous to ScYGL116W (CDC20) - SH]
           (409496..411169) [1674 bp, 557 aa]
          Length = 557

 Score = 48.1 bits (113), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 51/204 (25%), Positives = 87/204 (42%), Gaps = 21/204 (10%)

Query: 97  FDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIW 156
            D+ + I  K  +    D   +  +++  E H +EV  + +   G  LAS   D +V IW
Sbjct: 315 LDTVVCIGAKSGEIQVNDVRVKDHIVSTWEKHTSEVCGIKFRQDGLQLASGGNDNTVMIW 374

Query: 157 EADELGEEYECLSVLQEHAQDVKHVVWHSE-MHLLAS--SSYDDTIRLWKEDADDWECAA 213
           +      + E L V + H   VK + WH + ++LLA+   S D  I  W          +
Sbjct: 375 DT----RQDEPLWVKRNHNAAVKAITWHPDVVNLLATGGGSLDRHIHFWNTTTGA-RIGS 429

Query: 214 VLNGHKGTV--WCSDFEKSESSLRLASC--SDDSTVRVWNYVEEEENGEDVWAQEAILPN 269
           +  G + +   W   +E S  +  + +   S D+++ ++NY        D   + A +  
Sbjct: 430 INTGSQVSSLHWGQSYEDSHMNREIVATGGSPDNSISIYNY--------DSKVKVAEITQ 481

Query: 270 VHSRAVYSVSWSLDG-YIASVGSD 292
            H   + S   S DG  IA+VG D
Sbjct: 482 AHESRIVSSQLSPDGTTIATVGGD 505

>AER114W [2619] [Homologous to ScYLR429W (CRN1) - SH]
           complement(850726..850730,850789..852685) [1902 bp, 633
           aa]
          Length = 633

 Score = 48.1 bits (113), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 64/133 (48%), Gaps = 21/133 (15%)

Query: 76  HKKSVRSVSFRPHS-SILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKA 134
           H++ V  V + P +  +LA+ S D T+ +W  E+  +P           I+  H + V +
Sbjct: 139 HQRKVGHVLYHPTAQGVLASSSLDHTVRLWNVEQGTNP-----------IVLTHPDMVTS 187

Query: 135 VSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHA-QDVKHVVWHSEMHLLASS 193
           +S+S+ G YLA+  RDK + +W+      + E +S    H+    + VVW      LA++
Sbjct: 188 MSFSYGGTYLATVCRDKMLRVWDI----RKGEVVSEGMGHSGPKNQRVVWLGNSDRLATT 243

Query: 194 SY----DDTIRLW 202
            +    D  I +W
Sbjct: 244 GFSKLSDRQIAVW 256

>CAGL0G04345g 408842..410977 similar to sp|P47025 Saccharomyces
           cerevisiae YJL112w MDV1, hypothetical start
          Length = 711

 Score = 47.8 bits (112), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 60/242 (24%), Positives = 99/242 (40%), Gaps = 49/242 (20%)

Query: 76  HKKSVRSVSFRPHSSIL-AAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKA 134
           H  ++  + F PH S L  AG  D  + +W          D+ +   +  +EGH   +  
Sbjct: 403 HDDAITCLDFDPHFSTLCTAGYMDHIVKLW----------DYTKKRQIGAMEGHVATISC 452

Query: 135 VSWSHSGYYLASCSRDKSVWIWEADEL------GEEYECLSVLQEHAQDVKHVVWHSEMH 188
           +    +   +A+ S+D +V +W A+++      G   E L  L  H  +V  +  + +  
Sbjct: 453 MQVDKNYNMVATGSKDATVKLWNANDVIGRYEEGNNSEALHTLDAHLDEVSSL--YIDGA 510

Query: 189 LLASSSYDDTIRLWKEDADDWECAAV--LNGHKGTVWCSDFEKS-ESSL----------- 234
            L ++S D TIR W  D    +C  V  +N    + + S F KS E S+           
Sbjct: 511 NLMTASQDKTIRRW--DLYSGKCIQVFDVNFPSLSAYKSSFMKSNEDSMILKTVNTPIIG 568

Query: 235 -------RLASCSDDSTVRVWNYVEEEENGEDVWAQEAILPNVHS---RAVYSVSWSLDG 284
                   LA+ + D  +R+W+       GE V   E  +  + S    A   +S SLDG
Sbjct: 569 SIQSFDAALATGTKDGLIRLWDM----RTGEVVRVLEGHMDAITSLKFDATTIISGSLDG 624

Query: 285 YI 286
            I
Sbjct: 625 TI 626

>KLLA0D04840g 413362..414273 highly similar to sp|P41318
           Saccharomyces cerevisiae YNL006w LST8 required for
           transport of permeases from the golgi to the plasma
           membrane, start by similarity
          Length = 303

 Score = 47.0 bits (110), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 57/243 (23%), Positives = 103/243 (42%), Gaps = 31/243 (12%)

Query: 55  IKLVNLKNMDFQLVEELDDSTHKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQD 114
           ++L ++++ +   V   +   HK +V S++F+  +  + + S D TI +W     +  Q 
Sbjct: 55  VRLYDIRSNNPNPVSSFEG--HKGNVTSIAFQQENRWMVSSSEDGTIKVWDVRSPS-VQR 111

Query: 115 DFPETELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEH 174
           ++     +  +  H N+ +          L SC +D ++ IW   +LGE      +  E 
Sbjct: 112 NYKHNAPVNEVAIHPNQGE----------LISCDQDGNIRIW---DLGENQCTNQLTPED 158

Query: 175 AQDVKHVVWHSEMHLLASSSYDDTIRLWK----EDADDWECAAVLNGHKGTVWCSDFEKS 230
              ++ +   S+  +L + +      +WK     DA   E       H  T + +    S
Sbjct: 159 NTPLQSLSVASDGSMLVAGNNKGNCYVWKMPHHTDASTLEPVTKFKSH--TKYITRVLLS 216

Query: 231 ESSLRLASCSDDSTVRVWNYVEEEENGEDVWAQEAILPNVHSRAVYSVSWSLD-GYIASV 289
                LA+CS D T RVWN        ED +  E  L + H R V+  ++S D  Y+ + 
Sbjct: 217 ADVKHLATCSADHTARVWNI-------EDNFELETTL-DGHQRWVWDCAFSADSAYLVTA 268

Query: 290 GSD 292
            SD
Sbjct: 269 CSD 271

 Score = 35.0 bits (79), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 35/166 (21%), Positives = 64/166 (38%), Gaps = 18/166 (10%)

Query: 89  SSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLASCS 148
           S ILA+  +D TI  W        +           I+  +++V  +  +    YLA+  
Sbjct: 2   SVILASAGYDHTIRFWEALTGVCSR----------TIQHADSQVNRLEITSDKKYLAAAG 51

Query: 149 RDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDADD 208
               + +   D        +S  + H  +V  + +  E   + SSS D TI++W     D
Sbjct: 52  H---LHVRLYDIRSNNPNPVSSFEGHKGNVTSIAFQQENRWMVSSSEDGTIKVW-----D 103

Query: 209 WECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNYVEEE 254
               +V   +K     ++     +   L SC  D  +R+W+  E +
Sbjct: 104 VRSPSVQRNYKHNAPVNEVAIHPNQGELISCDQDGNIRIWDLGENQ 149

>CAGL0M02277g complement(271836..273119) highly similar to sp|Q12417
           Saccharomyces cerevisiae YPL151c PRP46 Pre-mRNA splicing
           factor PRP46, hypothetical start
          Length = 427

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 38/160 (23%), Positives = 69/160 (43%), Gaps = 18/160 (11%)

Query: 92  LAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLASCSRDK 151
            A GS D TI IW          +    +L   ++ H+  V+ ++ S+   Y+ S S DK
Sbjct: 131 FATGSNDKTIKIW----------NLASGKLKVTLKAHDMTVRDLAISNRHPYMFSVSEDK 180

Query: 152 SVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDADDWEC 211
           +V  W+     E+   +     H   V  V  H  + ++ ++  D  +++W  D      
Sbjct: 181 TVKCWDL----EKNTAIRNYHGHLSGVHTVDIHPTVDVVVTAGRDSVVKVW--DIRTRLP 234

Query: 212 AAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNYV 251
              L GHKG +  +         ++ S S D+++R+W+ V
Sbjct: 235 VMTLPGHKGPI--TKVRCLPVDPQVISSSVDASIRLWDLV 272

 Score = 37.0 bits (84), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 48/203 (23%), Positives = 80/203 (39%), Gaps = 23/203 (11%)

Query: 46  MATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSVSFRPHSSILAAGSFDSTISIWG 105
            AT S+D+ IK+ NL +   ++  +     H  +VR ++       + + S D T+  W 
Sbjct: 131 FATGSNDKTIKIWNLASGKLKVTLK----AHDMTVRDLAISNRHPYMFSVSEDKTVKCW- 185

Query: 106 KEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEY 165
                    D  +   +    GH + V  V    +   + +  RD  V +W+        
Sbjct: 186 ---------DLEKNTAIRNYHGHLSGVHTVDIHPTVDVVVTAGRDSVVKVWDI----RTR 232

Query: 166 ECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCS 225
             +  L  H   +  V        + SSS D +IRLW  D    +   VL  H+ TV   
Sbjct: 233 LPVMTLPGHKGPITKVRCLPVDPQVISSSVDASIRLW--DLVAGKSMKVLTHHQRTVRDI 290

Query: 226 DFEKSESSLRLASCSDDSTVRVW 248
               SE S   ++C++D  +R W
Sbjct: 291 SVHPSEFSF-ASACTND--IRSW 310

>Kwal_27.12239
          Length = 316

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 51/184 (27%), Positives = 77/184 (41%), Gaps = 24/184 (13%)

Query: 76  HKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAV 135
           H + +  + + P S  +A  S D TI I            F E   L    GH   V +V
Sbjct: 57  HSRPLSDLCWSPDSQCIATASDDFTIII--------THIVFGELHRLV---GHTAPVTSV 105

Query: 136 SWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHV-VWHSEMHLLASSS 194
            ++  G  L SCS D+S+ IW  D L      L  L  H++ V  + +   +  +L+S S
Sbjct: 106 KYTMKGNLLCSCSMDESIKIW--DILSGTL--LRTLSAHSEPVVSIDLPPFDPSILSSGS 161

Query: 195 YDDTIRLWKEDADDWECAAVLNGHK------GTVWCSDFEKSESSLRLASCSDDSTVRVW 248
           YD  IR++  D     C   L   K      G V  S  + S +   L   S D  +++W
Sbjct: 162 YDGLIRIF--DTATGHCLKTLTYDKDWQSENGVVPISQVKFSRNGKYLLVKSLDGILKIW 219

Query: 249 NYVE 252
           ++V 
Sbjct: 220 DFVR 223

>KLLA0E21263g 1892524..1893813 similar to sp|P40968 Saccharomyces
           cerevisiae YDR364c CDC40 cell division control protein
           singleton, start by similarity
          Length = 429

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 46/182 (25%), Positives = 78/182 (42%), Gaps = 31/182 (17%)

Query: 76  HKKSVRSVSFRPHSS-ILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKA 134
           HK    S+ F P +  +L +G  D+ I +W         D + E ELL   EGH   +K 
Sbjct: 134 HKNGTTSLRFIPKTGHLLLSGGNDNIIKLW---------DFYHERELLRTYEGHSMTIKD 184

Query: 135 VSWSHSGYYLASCSRDKSVWIWEADE--------LGEEYECLSVLQEHAQDVKHVVWHSE 186
           ++++ +G+  AS S DK V IW  ++              C++    H +D   +V    
Sbjct: 185 LNFTDNGHSFASASFDKWVKIWNTEKGIIDKRLRFNSVPNCITF---HPKDKNQLV---- 237

Query: 187 MHLLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVR 246
           + L  S      +RL +   +        + H+G++    +       +L S S+D TVR
Sbjct: 238 VGLSNSEIRHYDLRLSENHGE----VQKYDHHQGSILALKY--FPDGKKLISSSEDKTVR 291

Query: 247 VW 248
           +W
Sbjct: 292 IW 293

 Score = 35.4 bits (80), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 44/88 (50%), Gaps = 5/88 (5%)

Query: 116 FPETELLAIIEGHENEVKAVSW-SHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEH 174
            P+T++ A   GH+N   ++ +   +G+ L S   D  + +W+      E E L   + H
Sbjct: 123 LPKTKI-AEYYGHKNGTTSLRFIPKTGHLLLSGGNDNIIKLWD---FYHERELLRTYEGH 178

Query: 175 AQDVKHVVWHSEMHLLASSSYDDTIRLW 202
           +  +K + +    H  AS+S+D  +++W
Sbjct: 179 SMTIKDLNFTDNGHSFASASFDKWVKIW 206

>YLR429W (CRN1) [3804] chr12 (990773..992728) Coronin, actin-binding
           protein, inhibits ARP2/3-stimulated actin nucleation,
           contains WD (WD-40) repeats [1956 bp, 651 aa]
          Length = 651

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 45/148 (30%), Positives = 67/148 (45%), Gaps = 21/148 (14%)

Query: 122 LAIIEGHENEVKAVSW-SHSGYYLASCSRDKSVWIWE----------ADELGEEYECLSV 170
           + +  GH  +V    +   + + +AS S D  + IW+           DE GE  +   V
Sbjct: 74  VPLFRGHTAQVLDTDFDPFNDHRIASGSDDSKIGIWDIPENYKFHDHVDEDGEPIDIKPV 133

Query: 171 --LQEHAQDVKHVVWHS-EMHLLASSSYDDTIRLWK-EDADDWECAAVLNGHKGTVWCSD 226
             L  HA+ V HV++H    ++LASSS D T++LW  E   D     +   H   V    
Sbjct: 134 KFLTGHARKVGHVLYHPVAENVLASSSGDYTVKLWNVETGKDM----ITLKHPDMVTSMS 189

Query: 227 FEKSESSLRLASCSDDSTVRVWNYVEEE 254
           F  S     LA+ + D  +RVWN  EE+
Sbjct: 190 F--SYDGNYLATVARDKKLRVWNIREEK 215

 Score = 41.6 bits (96), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 59/133 (44%), Gaps = 21/133 (15%)

Query: 76  HKKSVRSVSFRP-HSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKA 134
           H + V  V + P   ++LA+ S D T+ +W  E   D            I   H + V +
Sbjct: 139 HARKVGHVLYHPVAENVLASSSGDYTVKLWNVETGKD-----------MITLKHPDMVTS 187

Query: 135 VSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEH-AQDVKHVVWHSEMHLLASS 193
           +S+S+ G YLA+ +RDK + +W       E + +S    H     + VVW      LA++
Sbjct: 188 MSFSYDGNYLATVARDKKLRVWNI----REEKIVSEGPAHTGAKNQRVVWLGNSDRLATT 243

Query: 194 SY----DDTIRLW 202
            +    D  I +W
Sbjct: 244 GFSKLSDRQIGIW 256

 Score = 37.4 bits (85), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 47/178 (26%), Positives = 75/178 (42%), Gaps = 35/178 (19%)

Query: 134 AVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHS-EMHLLAS 192
           AV+W+ SG          +  +   +E+G+  + + + + H   V    +     H +AS
Sbjct: 48  AVNWNASG--------GGAFAVIPIEEVGKAPDQVPLFRGHTAQVLDTDFDPFNDHRIAS 99

Query: 193 SSYDDTIRLWK------------EDAD--DWECAAVLNGHKGTVWCSDFEKSESSLRLAS 238
            S D  I +W             ED +  D +    L GH   V    +     ++ LAS
Sbjct: 100 GSDDSKIGIWDIPENYKFHDHVDEDGEPIDIKPVKFLTGHARKVGHVLYHPVAENV-LAS 158

Query: 239 CSDDSTVRVWNYVEEEENGEDVWAQEAILPNVHSRAVYSVSWSLDG-YIASVGSDGLL 295
            S D TV++WN     E G+D+   +      H   V S+S+S DG Y+A+V  D  L
Sbjct: 159 SSGDYTVKLWNV----ETGKDMITLK------HPDMVTSMSFSYDGNYLATVARDKKL 206

 Score = 32.3 bits (72), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 61/139 (43%), Gaps = 21/139 (15%)

Query: 76  HKKSVRSVSFRPHSS-ILAAGSFDSTISIWG----------KEEDADPQDDFPETELLAI 124
           H   V    F P +   +A+GS DS I IW            +ED +P D  P    +  
Sbjct: 80  HTAQVLDTDFDPFNDHRIASGSDDSKIGIWDIPENYKFHDHVDEDGEPIDIKP----VKF 135

Query: 125 IEGHENEVKAVSW-SHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVW 183
           + GH  +V  V +   +   LAS S D +V +W   E G++   L    +H   V  + +
Sbjct: 136 LTGHARKVGHVLYHPVAENVLASSSGDYTVKLWNV-ETGKDMITL----KHPDMVTSMSF 190

Query: 184 HSEMHLLASSSYDDTIRLW 202
             + + LA+ + D  +R+W
Sbjct: 191 SYDGNYLATVARDKKLRVW 209

>CAGL0K09284g 914937..917672 highly similar to sp|P25635
           Saccharomyces cerevisiae YCR057c PWP2 periodic
           tryptophan protein, start by similarity
          Length = 911

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/128 (23%), Positives = 61/128 (47%), Gaps = 9/128 (7%)

Query: 134 AVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQ-----EHAQDVKHVVWHSEMH 188
           +V +S  G Y A  +  + + IW+  ++ ++ +    ++      H QD+    W  +  
Sbjct: 101 SVKFSPDGRYFA-LAVGRFLQIWKTPDVSQDRQFAPFVRYRVHAGHFQDITSFTWSHDSR 159

Query: 189 LLASSSYDDTIRLWKEDADDWE-CAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRV 247
            L ++S D T R+W  +++D E  A  L GH+  V  + F  ++   ++ + S D  V  
Sbjct: 160 FLLTTSKDLTSRVWSINSEDKELVATTLAGHRDYVLGAYFNSTQE--KIYTISKDGAVFT 217

Query: 248 WNYVEEEE 255
           W Y+ + +
Sbjct: 218 WEYISKAQ 225

 Score = 45.1 bits (105), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 39/177 (22%), Positives = 68/177 (38%), Gaps = 48/177 (27%)

Query: 126 EGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHS 185
           +GH +   ++++S  G  + + + D  + +W+         CL+  +EH   V  V +  
Sbjct: 338 QGHFDATNSLTYSPDGSRVVTAAEDGKIKVWDV----ASGFCLATFEEHTSAVTAVQFAK 393

Query: 186 EMHLLASSSYDDTIRLW------------KEDADDWECAAV------------------- 214
           +  +L S+S D T+R W              +   + C AV                   
Sbjct: 394 KGQVLFSASLDGTVRAWDLIRYRNFRVFTATERVQFTCLAVEPSGEVVSAGSTDSFDVFV 453

Query: 215 -----------LNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNYVEEEENGEDV 260
                      L+GH+G V C  F  S  +  LAS S D T+R+W+     +  E +
Sbjct: 454 WSVQTGQLLDTLSGHEGPVSCLAF--SMENAVLASASWDKTIRIWSIFGRSQQVEPL 508

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 41/176 (23%), Positives = 69/176 (39%), Gaps = 14/176 (7%)

Query: 32  HTDKLWSIDCSK--GLMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSVSFRPHS 89
           H   + + D +K   L+ +  +D +  LVN K  +      L     K    SV F P  
Sbjct: 54  HRKNIATFDVNKQGTLLLSVDTDGRAILVNFKTRNV-----LHHFNFKDKCYSVKFSPDG 108

Query: 90  SI--LAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLASC 147
               LA G F   + IW K  D      F       +  GH  ++ + +WSH   +L + 
Sbjct: 109 RYFALAVGRF---LQIW-KTPDVSQDRQFAPFVRYRVHAGHFQDITSFTWSHDSRFLLTT 164

Query: 148 SRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWK 203
           S+D +  +W  +   +E    + L  H   V    ++S    + + S D  +  W+
Sbjct: 165 SKDLTSRVWSINSEDKEL-VATTLAGHRDYVLGAYFNSTQEKIYTISKDGAVFTWE 219

 Score = 38.9 bits (89), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 38/167 (22%), Positives = 73/167 (43%), Gaps = 27/167 (16%)

Query: 26  LKSLKLHTDKLWSIDCSKG--LMATSSSDRKIK---LVNLKNMDFQLVEELDDSTHKKSV 80
           L + + HT  + ++  +K   ++ ++S D  ++   L+  +N        +  +T +   
Sbjct: 376 LATFEEHTSAVTAVQFAKKGQVLFSASLDGTVRAWDLIRYRNF------RVFTATERVQF 429

Query: 81  RSVSFRPHSSILAAGSFDST-ISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSH 139
             ++  P   +++AGS DS  + +W  +            +LL  + GHE  V  +++S 
Sbjct: 430 TCLAVEPSGEVVSAGSTDSFDVFVWSVQTG----------QLLDTLSGHEGPVSCLAFSM 479

Query: 140 SGYYLASCSRDKSVWIWEADELGEEYECLSVLQE-----HAQDVKHV 181
               LAS S DK++ IW      ++ E L V  +        D KHV
Sbjct: 480 ENAVLASASWDKTIRIWSIFGRSQQVEPLEVFADILAITITPDGKHV 526

 Score = 38.1 bits (87), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 39/172 (22%), Positives = 60/172 (34%), Gaps = 50/172 (29%)

Query: 71  LDDSTHKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHEN 130
           L    H  +  S+++ P  S +   + D  I +W          D      LA  E H +
Sbjct: 335 LKQQGHFDATNSLTYSPDGSRVVTAAEDGKIKVW----------DVASGFCLATFEEHTS 384

Query: 131 EVKAVSWSHSGYYLASCSRDKSVWIWEADELGE----------EYECLSV---------- 170
            V AV ++  G  L S S D +V  W+                ++ CL+V          
Sbjct: 385 AVTAVQFAKKGQVLFSASLDGTVRAWDLIRYRNFRVFTATERVQFTCLAVEPSGEVVSAG 444

Query: 171 --------------------LQEHAQDVKHVVWHSEMHLLASSSYDDTIRLW 202
                               L  H   V  + +  E  +LAS+S+D TIR+W
Sbjct: 445 STDSFDVFVWSVQTGQLLDTLSGHEGPVSCLAFSMENAVLASASWDKTIRIW 496

 Score = 35.8 bits (81), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 40/180 (22%), Positives = 73/180 (40%), Gaps = 23/180 (12%)

Query: 76  HKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAV 135
           ++  V+  +F  +S++L  G  +    ++          + PE  ++  +   +N V  V
Sbjct: 255 NQAKVKCCTFHINSNLLIVGFSNGEFRLY----------EMPEFVMVQQLSMGQNPVNTV 304

Query: 136 SWSHSGYYLASCSRDKS---VWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLAS 192
           S ++SG +LA  S       V+ W++    E Y  +   Q H      + +  +   + +
Sbjct: 305 SVNNSGEWLAFGSSKLGQLLVYEWQS----ESY--ILKQQGHFDATNSLTYSPDGSRVVT 358

Query: 193 SSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNYVE 252
           ++ D  I++W  D     C A    H   V    F K      L S S D TVR W+ + 
Sbjct: 359 AAEDGKIKVW--DVASGFCLATFEEHTSAVTAVQFAKKGQV--LFSASLDGTVRAWDLIR 414

>Scas_558.3
          Length = 725

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/177 (24%), Positives = 89/177 (50%), Gaps = 28/177 (15%)

Query: 76  HKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEV--- 132
           H  +V ++S++ H S + +GS+D+T  +W                L   +EGH+  V   
Sbjct: 101 HHSNVCALSYK-HMSAIISGSWDTTAKVW------------INGALQWSLEGHQASVWDA 147

Query: 133 KAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLAS 192
           K +S   + +  AS   D++V +W+ ++L + +  +     H+  ++++   S    +A+
Sbjct: 148 KIISVEENTFITASA--DRTVKLWKENKLLKTFSGI-----HSDVIRNIEVLSSGKEIAT 200

Query: 193 SSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWN 249
            S D TI++   D +      VL+GH+  V+  + + S+   +L SC +D ++R+W+
Sbjct: 201 CSNDGTIKISDLDGN---IKQVLSGHESFVY--NVKLSKQGDKLVSCGEDRSLRIWD 252

 Score = 37.7 bits (86), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 45/181 (24%), Positives = 77/181 (42%), Gaps = 23/181 (12%)

Query: 28  SLKLHTDKLWS---IDCSKGLMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSVS 84
           SL+ H   +W    I   +    T+S+DR +KL      + +L++      H   +R++ 
Sbjct: 136 SLEGHQASVWDAKIISVEENTFITASADRTVKLWK----ENKLLKTFS-GIHSDVIRNIE 190

Query: 85  FRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYL 144
                  +A  S D TI I     D D         +  ++ GHE+ V  V  S  G  L
Sbjct: 191 VLSSGKEIATCSNDGTIKI----SDLD-------GNIKQVLSGHESFVYNVKLSKQGDKL 239

Query: 145 ASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWKE 204
            SC  D+S+ IW   ++   +    V++  A  +  V       ++   S D+T+R++ E
Sbjct: 240 VSCGEDRSLRIW---DINNNFNIKQVIKLPAVSIWCVDTLPNGDIVVGCS-DNTVRIFTE 295

Query: 205 D 205
           D
Sbjct: 296 D 296

 Score = 30.8 bits (68), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 26/47 (55%), Gaps = 2/47 (4%)

Query: 165 YECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWK-EDADDWE 210
           Y+  + L  H QDVK +V   +  + AS S D T+RLWK  D   W+
Sbjct: 2   YQLSATLLGHTQDVKDIVVIDDSQV-ASVSRDGTLRLWKHNDNGTWQ 47

>Scas_465.4
          Length = 1002

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/118 (29%), Positives = 57/118 (48%), Gaps = 14/118 (11%)

Query: 85  FRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYL 144
           F P    ++AG+    + IW         D F ET+L  ++ GHE  +   + S +G Y+
Sbjct: 145 FSPEKVYISAGTVMGGVLIW---------DLFLETKLYNLV-GHEGSIFYATISDNGRYI 194

Query: 145 ASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLW 202
            SCS D+S+ +W   + GEE   L     H   + ++ + +    L S S D+T R+W
Sbjct: 195 TSCSDDRSIKLWNL-QTGEE---LCTGWGHTARIWNLKFFNNDTQLISVSEDNTCRVW 248

 Score = 31.2 bits (69), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 26/41 (63%), Gaps = 2/41 (4%)

Query: 215 LNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNYVEEEE 255
           L GH+G+++ +    S++   + SCSDD ++++WN    EE
Sbjct: 175 LVGHEGSIFYATI--SDNGRYITSCSDDRSIKLWNLQTGEE 213

>KLLA0E18986g 1680775..1683747 similar to sgd|S0006104 Saccharomyces
           cerevisiae YPL183c, start by similarity
          Length = 990

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 76/167 (45%), Gaps = 17/167 (10%)

Query: 82  SVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSG 141
           S+    H  ++ AG+  + I +W  E D+  +        +  + GHE  +  V+ S++G
Sbjct: 144 SIKVLRHKVLVNAGTIMNGIIVW--ELDSKKK--------IHTLRGHEGSIFYVTTSNNG 193

Query: 142 YYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRL 201
             LASCS D+S+ IW+        + LS    H   + ++ + ++   L S S D T R+
Sbjct: 194 KLLASCSDDRSIIIWDM----VSGKLLSRAWGHTARIWNLKFFNDDTQLISVSEDCTCRV 249

Query: 202 WKEDADDWECAAVLNGH-KGTVWCSDFEKSESSLRLASCSDDSTVRV 247
           W    D+     +   H    VW  D E  E++L   S  +D  ++V
Sbjct: 250 WNYKNDELTIKDIFESHLTKNVWGVDVE--ETNLIAISGGNDGRLKV 294

 Score = 42.0 bits (97), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 53/112 (47%), Gaps = 14/112 (12%)

Query: 153 VWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDADDWECA 212
           + +WE D   +    +  L+ H   + +V   +   LLAS S D +I +W     D    
Sbjct: 163 IIVWELDSKKK----IHTLRGHEGSIFYVTTSNNGKLLASCSDDRSIIIW-----DMVSG 213

Query: 213 AVLN---GHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNYVEEEENGEDVW 261
            +L+   GH   +W   F   ++  +L S S+D T RVWNY  +E   +D++
Sbjct: 214 KLLSRAWGHTARIWNLKFFNDDT--QLISVSEDCTCRVWNYKNDELTIKDIF 263

 Score = 30.0 bits (66), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 35/198 (17%), Positives = 81/198 (40%), Gaps = 26/198 (13%)

Query: 71  LDDSTHKKSVRSVSFRPHSS------ILAAGSFDSTISIWGKEEDADPQDDFPETELLAI 124
           L + TH + +R +SFR  S+      +   GS D+T+ +     +     +F        
Sbjct: 633 LKNGTHGREIRDISFRKRSNYCKENLLFITGSEDTTVKLSSINSETGAIQNF------WT 686

Query: 125 IEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEA-DELGEEYECLSV----------LQE 173
           ++ H + ++   +    +++ +CS  + +++WE  D+    Y  L            L+ 
Sbjct: 687 LKSHVSGLQRCKFICDNFFI-TCSAREELFLWELNDQFSHPYVNLKQKLIPSMNNPDLRI 745

Query: 174 HAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDADDWECAAVLNGHKGT--VWCSDFEKSE 231
              DV  +   +   ++A+   D ++++W    +      +++G   T  +W   F   +
Sbjct: 746 MDFDVLFLNGDTCDFIMATVYSDSSVKVWHYFNEQNSFTLIIDGRYETCCIWNVAFIPLQ 805

Query: 232 SSLRLASCSDDSTVRVWN 249
           + L+L     D  +  W+
Sbjct: 806 NCLKLLIAPTDGHLITWD 823

>Sklu_2114.2 YDR128W, Contig c2114 598-4020 reverse complement
          Length = 1140

 Score = 46.2 bits (108), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 61/130 (46%), Gaps = 10/130 (7%)

Query: 124 IIEGHENEVKAVSW-SHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVV 182
           I+ GH   +  +++  H    LA+CS D  V  W+       Y   S  +  A  VK   
Sbjct: 109 ILHGHFRAITDINFHPHHPEILATCSVDTYVLAWDMRSPQRPYYSTSEWRAGASQVK--- 165

Query: 183 WHSEMHLLASSSYDDTIRLWKEDADDWECAAV--LNGHKGTVWCSDFEKSESSLRLASCS 240
           W+     + +SS+ D + +W        C  +  L GH+G+V   DF K++ +  + S S
Sbjct: 166 WNFRNSNIMASSHSDHVCIWDLRKG---CTPLYTLQGHEGSVNNIDFNKAKET-EIMSSS 221

Query: 241 DDSTVRVWNY 250
           +D TV+ W+Y
Sbjct: 222 NDGTVKFWDY 231

>Scas_680.11
          Length = 347

 Score = 45.4 bits (106), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 37/121 (30%), Positives = 63/121 (52%), Gaps = 15/121 (12%)

Query: 170 VLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEK 229
           VL  H + +  V ++ E  LL S S D+   +W   + + E    LNGH GT+W  D +K
Sbjct: 5   VLMGHERPLTQVKYNREGDLLFSCSKDNFASVWY--SVNGERLGTLNGHAGTIWSIDVDK 62

Query: 230 SESSLRLASCSDDSTVRVWNYVEEEENGEDVWAQEAILPNVHSRAVYSVSWSLDG-YIAS 288
              +    + S D ++++W      E GE+V++ ++ +P      V +VS+S  G Y+A+
Sbjct: 63  --FTEYCVTGSADYSIKMWKV----ETGENVYSWDSPVP------VKNVSFSPCGNYVAA 110

Query: 289 V 289
           V
Sbjct: 111 V 111

 Score = 32.3 bits (72), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 36/80 (45%), Gaps = 4/80 (5%)

Query: 124 IIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVW 183
           ++ GHE  +  V ++  G  L SCS+D    +W +   GE    L  L  HA  +  +  
Sbjct: 5   VLMGHERPLTQVKYNREGDLLFSCSKDNFASVWYSVN-GER---LGTLNGHAGTIWSIDV 60

Query: 184 HSEMHLLASSSYDDTIRLWK 203
                   + S D +I++WK
Sbjct: 61  DKFTEYCVTGSADYSIKMWK 80

 Score = 30.8 bits (68), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 38/147 (25%), Positives = 66/147 (44%), Gaps = 17/147 (11%)

Query: 24  ELLKSLKLHTDKLWSIDCSKG--LMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVR 81
           E L +L  H   +WSID  K      T S+D  IK+  ++       E +        V+
Sbjct: 43  ERLGTLNGHAGTIWSIDVDKFTEYCVTGSADYSIKMWKVETG-----ENVYSWDSPVPVK 97

Query: 82  SVSFRPHSSILAA-----GSFDSTISIWGKEEDADPQD--DFPETELLAIIEGHENEVKA 134
           +VSF P  + +AA       +  +I+I+  + + +  +  +F E E +  IE  E    A
Sbjct: 98  NVSFSPCGNYVAAVLDNVMKYPGSINIYQLKRNPETNEIIEFVE-EPIHKIETQEGLSAA 156

Query: 135 VS--WSHSGYYLASCSRDKSVWIWEAD 159
           VS  WS  G ++ +  ++  V  ++ D
Sbjct: 157 VSADWSTEGKFIIAAHKEGEVSKYDVD 183

>KLLA0E24508g complement(2175775..2176758) similar to sp|P38123
           Saccharomyces cerevisiae YBR175w, start by similarity
          Length = 327

 Score = 45.1 bits (105), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 47/202 (23%), Positives = 83/202 (41%), Gaps = 32/202 (15%)

Query: 74  STHKKSVRSVSFRPHSSILAAGSFDSTIS----IWGKEEDADPQDDFPETELLAIIEGHE 129
           +THK+ +  + + P S  +A+GS D T+     I+G+               +  + GH 
Sbjct: 66  TTHKECINCLCWSPDSKCIASGSEDFTVEITHIIYGR---------------IRRLMGHT 110

Query: 130 NEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHV-VWHSEMH 188
             V ++ +++ G  L S S D+S+  W           L  +  H+  V  + +   +  
Sbjct: 111 APVISICYNNKGNILCSSSMDESIKEWHV----LSGTALKTMSAHSDAVVSIDIPKFDSS 166

Query: 189 LLASSSYDDTIRLWKEDADDWECAAVLNGHK------GTVWCSDFEKSESSLRLASCSDD 242
           +L+S SYD  IR++  D +   C   L   K      G V  S  + S +   L   S D
Sbjct: 167 ILSSGSYDGLIRIF--DTESGHCLKTLTYDKDWIAEDGVVPISTVKFSRNGKFLLVKSLD 224

Query: 243 STVRVWNYVEEEENGEDVWAQE 264
           + V++W Y         +W  +
Sbjct: 225 NVVKLWEYTRGTVVRTFLWPHQ 246

>ACR017W [1065] [Homologous to ScYEL056W (HAT2) - SH]
           complement(387122..388393) [1272 bp, 423 aa]
          Length = 423

 Score = 45.1 bits (105), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 81/172 (47%), Gaps = 26/172 (15%)

Query: 45  LMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSVSFRPHS-SILAAGSFDSTISI 103
           +  T S D+ ++ V+ K +  + V++L  ++      ++SF  HS ++LAA   DS I +
Sbjct: 245 VFGTVSEDKTLQ-VHDKRVRLEPVKKLPTAS---PFNTLSFSKHSRNLLAAAGVDSQIYL 300

Query: 104 WGKEEDADPQDDFPETELLAIIEGHENEVKAVSWS-HSGYYLASCSRDKSVWIWEADELG 162
           +   + + P         L ++ GH++ V  V +S H+   + S   D+   IW+  ++G
Sbjct: 301 YDMRDMSSP---------LHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIG 351

Query: 163 EEY----------ECLSVLQEHAQDVKHVVWHSEMH-LLASSSYDDTIRLWK 203
            E           E + +   H   V    ++ ++  LLAS+  D+ I+ WK
Sbjct: 352 AEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAWK 403

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 43/180 (23%), Positives = 79/180 (43%), Gaps = 18/180 (10%)

Query: 76  HKKSVRSVSFRPH-SSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKA 134
           HK++   ++F PH S  L +GS D+T+++W  E    P+         +I+  H++ V  
Sbjct: 185 HKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKKPK---------SILTSHDDIVND 235

Query: 135 VSW-SHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASS 193
           V W         + S DK++ + +     E  + L        +      HS  +LLA++
Sbjct: 236 VKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLPTASPF--NTLSFSKHSR-NLLAAA 292

Query: 194 SYDDTIRLWKEDADDWECAA-VLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNYVE 252
             D  I L+  D  D      V++GH+ +V   +F      +  +S SD   + +W+  +
Sbjct: 293 GVDSQIYLY--DMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAI-IWDLTQ 349

>CAGL0K00957g 94828..97209 similar to sp|P42935 Saccharomyces
           cerevisiae YGR200c subunit of elongating RNA polymerase
           II holoenzyme, start by similarity
          Length = 793

 Score = 45.1 bits (105), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 51/196 (26%), Positives = 84/196 (42%), Gaps = 39/196 (19%)

Query: 9   YTFSHKHTRLQRMSLELLKSLKLHTDKLWSIDCSKGLMATSSSDRKIKLVNLKNMDFQLV 68
           Y  SH+++ L R    L  SL        ++  +K L+A   +  KI + +    + +++
Sbjct: 140 YIISHEYS-LPRNVFPLCFSLS-------NVVGNKYLLAIGGTTVKIFIYSFVLSEGKVI 191

Query: 69  EELDDST----HKKSVRSVSFR----PHSSILAAGSFDSTISIWGKEEDA---DPQDDFP 117
           E  + +     H+  V+S+ FR    P   +L +GS D  I IW    +    D +DD  
Sbjct: 192 ENFNLAAELEGHEDWVKSIQFRHQETPGDYLLCSGSQDRYIRIWRIRTNDLIDDSEDDET 251

Query: 118 ETELL--------------------AIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWE 157
           +  LL                    A+I GH++ V ++ W  S   L + + D +V IWE
Sbjct: 252 KLTLLSSKQHKFHISEDLRIGINFEALIIGHDDWVSSLQWHESKLQLLASTADTAVMIWE 311

Query: 158 ADELGEEYECLSVLQE 173
            DE    + C S L E
Sbjct: 312 PDESSGVWVCSSRLGE 327

 Score = 33.5 bits (75), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 48/103 (46%), Gaps = 11/103 (10%)

Query: 78  KSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSW 137
           K  +  S+    ++LA G+    I++W    DAD +       + A ++GHE EV  V +
Sbjct: 15  KQTQVCSYNKARNVLAFGA-GKNIALWNPL-DADCRG------IYATLKGHEAEVTCVKF 66

Query: 138 SHSGYYLASCSRDKSV--WIWEADELGEEYECLSVLQEHAQDV 178
                 L S S D  V  W ++A E  EE EC+  +  ++  +
Sbjct: 67  MPGTDILVSASEDHHVKLWKYKAPE-SEELECIQTITHYSHTI 108

 Score = 29.6 bits (65), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 25/57 (43%), Gaps = 3/57 (5%)

Query: 199 IRLWKE-DADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNYVEEE 254
           I LW   DAD     A L GH+  V C  F        L S S+D  V++W Y   E
Sbjct: 37  IALWNPLDADCRGIYATLKGHEAEVTCVKFMPGTDI--LVSASEDHHVKLWKYKAPE 91

 Score = 28.5 bits (62), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 40/186 (21%), Positives = 73/186 (39%), Gaps = 20/186 (10%)

Query: 76  HKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAV 135
           H+  V  V F P + IL + S D  + +W  +    P+ +  E E +  I  + + + ++
Sbjct: 57  HEAEVTCVKFMPGTDILVSASEDHHVKLWKYKA---PESE--ELECIQTITHYSHTIVSI 111

Query: 136 SWSHSGYYLASCSRDKSVWIWEADE-----LGEEYECLSVLQEHAQDVKHVVWHSEMHLL 190
                   + S     S+W+ E +      +  EY     +      + +VV     +LL
Sbjct: 112 ETLAGLIVIGSAGGLVSIWVPETEGSDTYIISHEYSLPRNVFPLCFSLSNVV--GNKYLL 169

Query: 191 ASSSYDDTIRLWK------EDADDWECAAVLNGHKGTVWCSDFEKSESS--LRLASCSDD 242
           A       I ++       +  +++  AA L GH+  V    F   E+     L S S D
Sbjct: 170 AIGGTTVKIFIYSFVLSEGKVIENFNLAAELEGHEDWVKSIQFRHQETPGDYLLCSGSQD 229

Query: 243 STVRVW 248
             +R+W
Sbjct: 230 RYIRIW 235

>YIR012W (SQT1) [2677] chr9 (378483..379778) Protein that may be
           required for ribosomal assembly, contains WD (WD-40)
           repeats [1296 bp, 431 aa]
          Length = 431

 Score = 44.7 bits (104), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 38/183 (20%), Positives = 77/183 (42%), Gaps = 21/183 (11%)

Query: 76  HKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAV 135
           H  SV ++   P+  ++  G  D+   +W               +    + G+   V + 
Sbjct: 64  HTDSVFAIGHHPNLPLVCTGGGDNLAHLWTSHSQPP--------KFAGTLTGYGESVISC 115

Query: 136 SWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVW---HSEM-HLLA 191
           S++  G +L +      V +    + G +++  S +QE    V+ +VW   H  +    A
Sbjct: 116 SFTSEGGFLVTADMSGKVLVHMGQKGGAQWKLASQMQE----VEEIVWLKTHPTIARTFA 171

Query: 192 SSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCS-----DFEKSESSLRLASCSDDSTVR 246
             + D ++  ++ +  D     +++G      CS     + +K E++L L +CS DST+ 
Sbjct: 172 FGATDGSVWCYQINEQDGSLEQLMSGFVHQQDCSMGEFINTDKGENTLELVTCSLDSTIV 231

Query: 247 VWN 249
            WN
Sbjct: 232 AWN 234

>Scas_719.52
          Length = 628

 Score = 44.7 bits (104), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 49/197 (24%), Positives = 82/197 (41%), Gaps = 34/197 (17%)

Query: 45  LMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSVSF-RPHS-------------S 90
           ++A+SS D KI +  +   D+     LD     K+++ V F   HS             +
Sbjct: 96  IIASSSDDSKIGIWKIPE-DYSFQHYLDPDGEPKNIKPVKFLSGHSRKVGHVLFHPVAEN 154

Query: 91  ILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLASCSRD 150
           +LA+ S D T+ +W  E           T    I   H + V ++S+S+ G +LA+  RD
Sbjct: 155 VLASSSLDYTVKLWNIE-----------TGEAVITLKHPDMVTSMSFSYGGNHLATVCRD 203

Query: 151 KSVWIWEADELGEEYECLSVLQEHA-QDVKHVVWHSEMHLLASSSYDDTIRLWKEDADDW 209
           K + +W+      E + +S    HA    + VVW      LA++ +    RL       W
Sbjct: 204 KKLRVWDI----REGKIVSEGPAHAGAKNQRVVWLGNSDRLATTGFS---RLSDRQIGIW 256

Query: 210 ECAAVLNGHKGTVWCSD 226
           +   +  G  G  +  D
Sbjct: 257 DAFNLEKGDLGGFYTVD 273

 Score = 33.5 bits (75), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 38/123 (30%), Positives = 55/123 (44%), Gaps = 26/123 (21%)

Query: 188 HLLASSSYDDTIRLWKEDAD--------------DWECAAVLNGHKGTVWCSDFEKSESS 233
           H++ASSS D  I +WK   D              + +    L+GH   V    F     +
Sbjct: 95  HIIASSSDDSKIGIWKIPEDYSFQHYLDPDGEPKNIKPVKFLSGHSRKVGHVLFHPVAEN 154

Query: 234 LRLASCSDDSTVRVWNYVEEEENGEDVWAQEAILPNVHSRAVYSVSWSLDG-YIASVGSD 292
           + LAS S D TV++WN     E G      EA++   H   V S+S+S  G ++A+V  D
Sbjct: 155 V-LASSSLDYTVKLWNI----ETG------EAVITLKHPDMVTSMSFSYGGNHLATVCRD 203

Query: 293 GLL 295
             L
Sbjct: 204 KKL 206

>AER448W [2948] [Homologous to ScYKL213C (DOA1) - SH]
           complement(1497416..1499560) [2145 bp, 714 aa]
          Length = 714

 Score = 44.7 bits (104), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 41/161 (25%), Positives = 68/161 (42%), Gaps = 31/161 (19%)

Query: 92  LAAGSFDSTISIW--GKEEDADPQDDFPETELLAIIEGHENEV-KAVSWSHSGYYLASCS 148
           L + S+D T  +W  G EE A              + GH   V  A++  +  +  AS  
Sbjct: 121 LVSSSWDQTARVWREGTEERA--------------LSGHNATVWHALALGYDRFLTASA- 165

Query: 149 RDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDADD 208
            DK++ +W+          L+    H   V+H+    + H  AS S D ++++   D   
Sbjct: 166 -DKTIKLWDG------ARDLATYNVHTDVVRHLALAPDGHHFASCSNDGSVKVHTLDG-- 216

Query: 209 WECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWN 249
            +     +GH+  V+C  +        L SC +D TVRVW+
Sbjct: 217 -KTVRTFDGHESFVYCVKYLPDGG---LVSCGEDKTVRVWD 253

 Score = 38.1 bits (87), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 52/105 (49%), Gaps = 19/105 (18%)

Query: 190 LASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWN 249
           L SSS+D T R+W+E  ++      L+GH  TVW +     +   R  + S D T+++W+
Sbjct: 121 LVSSSWDQTARVWREGTEE----RALSGHNATVWHALALGYD---RFLTASADKTIKLWD 173

Query: 250 YVEEEENGEDVWAQEAILPNVHSRAVYSVSWSLDG-YIASVGSDG 293
                       A++    NVH+  V  ++ + DG + AS  +DG
Sbjct: 174 -----------GARDLATYNVHTDVVRHLALAPDGHHFASCSNDG 207

 Score = 35.0 bits (79), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 25/44 (56%), Gaps = 1/44 (2%)

Query: 165 YECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDADD 208
           YE  S L  H+ DVK VV  S+   +AS S D T+R+W  D  D
Sbjct: 8   YELSSSLLGHSMDVKSVVAISDTQ-IASGSRDGTVRVWTRDTSD 50

>AER280C [2782] [Homologous to ScYML102W (CAC2) - SH]
           (1148956..1150488) [1533 bp, 510 aa]
          Length = 510

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 41/178 (23%), Positives = 77/178 (43%), Gaps = 25/178 (14%)

Query: 46  MATSSSDRKIKLVNLKNMDFQLVEELDD-------STHKKSVRSVSFRPHSSILAAGSFD 98
           + T+  D K ++  L N D +   ++D        + H+++V    F P   +LA    D
Sbjct: 34  LVTAGGDNKARVWQL-NFDSERPGKVDSIDFLSSLTQHEQAVNVARFNPSGDVLATAGDD 92

Query: 99  STISIWGKEE--------DADPQDDFPET-----ELLAIIEGHENEVKAVSWSHSGYYLA 145
             + +W K +        D D   DF E+     +L  +     +E+  ++WS    Y+ 
Sbjct: 93  GLLLLWKKNDTIVKEFGIDDDEFADFKESWCVVEKLRTVSTIGTSEIYDLAWSPCAKYIV 152

Query: 146 SCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWK 203
           +   D  V I++      E  C++ + EH   V+ VVW  +   + S S D ++ ++K
Sbjct: 153 TGCMDNGVRIFDI----AEKTCVAHVVEHNHYVQGVVWDPQNEYIISQSADRSVHIYK 206

>YBR175W (SWD3) [360] chr2 (582365..583312) Component of SET1 and
           COMPASS complex, has several WD (WD-40) repeats and may
           be involved in chromatin remodeling [948 bp, 315 aa]
          Length = 315

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/138 (28%), Positives = 66/138 (47%), Gaps = 13/138 (9%)

Query: 121 LLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKH 180
           LL    GH   V +++++  G  L + S D+S+ IW  D L      +  +  H++ V  
Sbjct: 88  LLHTFIGHTAPVISLTFNRKGNLLFTSSMDESIKIW--DTLNGSL--MKTISAHSEAVVS 143

Query: 181 V-VWHSEMHLLASSSYDDTIRLWKEDADDWECAAVLNGHK------GTVWCSDFEKSESS 233
           V V  ++  +L+S SYD  IR++  DA+   C   L   K      G V  S  + SE++
Sbjct: 144 VDVPMNDSSILSSGSYDGLIRIF--DAETGHCLKTLTYDKDWKRENGVVPISQVKFSENA 201

Query: 234 LRLASCSDDSTVRVWNYV 251
             L   S D  V++W+ +
Sbjct: 202 RYLLVKSLDGVVKIWDCI 219

 Score = 30.8 bits (68), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 50/90 (55%), Gaps = 7/90 (7%)

Query: 21  MSLELLKSLKLHTDKLWSIDCSK--GLMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKK 78
           +S  LL +   HT  + S+  ++   L+ TSS D  IK+ +   ++  L++ +  S H +
Sbjct: 84  LSYGLLHTFIGHTAPVISLTFNRKGNLLFTSSMDESIKIWD--TLNGSLMKTI--SAHSE 139

Query: 79  SVRSVSFRPH-SSILAAGSFDSTISIWGKE 107
           +V SV    + SSIL++GS+D  I I+  E
Sbjct: 140 AVVSVDVPMNDSSILSSGSYDGLIRIFDAE 169

>Kwal_27.10385
          Length = 536

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 37/177 (20%), Positives = 77/177 (43%), Gaps = 23/177 (12%)

Query: 46  MATSSSDRKIKL--VNLKNMDFQLVEELDD----STHKKSVRSVSFRPHSSILAAGSFDS 99
           + T+  D KI++  +N +  +   V+ +D     + H+++V  + F   + +LA    D 
Sbjct: 34  LVTAGGDNKIRVWQLNFEEQNENKVDTIDFLSSLTQHEQAVNVIRFNSRNDVLATAGDDG 93

Query: 100 TISIWGKEEDADPQDDFPETELLAIIE-------------GHENEVKAVSWSHSGYYLAS 146
            + +W + +    +    E E     E                +E+  ++WS    Y+ +
Sbjct: 94  QLLLWKRNDSISKEFGVDEEEFAEFKESWYVWKRLRSSSTAGSSEIYDLAWSPDDNYIVT 153

Query: 147 CSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWK 203
            S D S+ I+E     EE  C++   +H   V+ VVW  +   + S S D ++ +++
Sbjct: 154 GSMDNSLRIFEV----EEGTCVANAADHNHYVQGVVWDPQNEFIFSQSADRSVHVYR 206

 Score = 28.9 bits (63), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 27/156 (17%), Positives = 65/156 (41%), Gaps = 26/156 (16%)

Query: 91  ILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLASCSRD 150
           ++ AG  D+ I +W    +   ++     + L+ +  HE  V  + ++     LA+   D
Sbjct: 34  LVTAGG-DNKIRVWQLNFEEQNENKVDTIDFLSSLTQHEQAVNVIRFNSRNDVLATAGDD 92

Query: 151 KSVWIWEAD-----ELGEEYECLSVLQEH--------------AQDVKHVVWHSEMHLLA 191
             + +W+ +     E G + E  +  +E               + ++  + W  + + + 
Sbjct: 93  GQLLLWKRNDSISKEFGVDEEEFAEFKESWYVWKRLRSSSTAGSSEIYDLAWSPDDNYIV 152

Query: 192 SSSYDDTIRLWKEDADDWECAAVLNGH----KGTVW 223
           + S D+++R++  + ++  C A    H    +G VW
Sbjct: 153 TGSMDNSLRIF--EVEEGTCVANAADHNHYVQGVVW 186

>KLLA0E03982g 371642..372760 similar to sp|P39108 Saccharomyces
           cerevisiae YDR142c PAS7 peroxisomal import protein -
           peroxin singleton, start by similarity
          Length = 372

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 58/253 (22%), Positives = 107/253 (42%), Gaps = 45/253 (17%)

Query: 35  KLWSIDCSKGLMATSSSD--------RKIKLVNLKNMDFQLVEELDDSTHKKSVRSVSFR 86
           KLWS+   + LM  S +D        R   +  ++       E      +K+ +   +F 
Sbjct: 130 KLWSLMRPQSLMTMSPNDTNAASTLSRTSAVAPVRVPMSNQKEHQHADGNKECIYQATFS 189

Query: 87  PH-SSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGY--- 142
           PH  +++   S +S IS++   +   P +  P+ + L    GH    +A++   + Y   
Sbjct: 190 PHDPNLVLCSSGNSFISLY---DLRVPNNGLPQHQFL----GHGG-FEALTCDFNKYRPH 241

Query: 143 YLASCSRDKSVWIWE----ADELGEEYECLSV--LQEHAQDVKHVVW---HSEMHLLASS 193
            +A+   DK + +W+       L + ++ +++  +Q H   V+ V W   HS M  L S+
Sbjct: 242 IIATGGVDKMIKVWDLRMCRKMLSQGHQPININEIQGHELAVRKVTWSPHHSNM--LLST 299

Query: 194 SYDDTIRLWKEDADDWE--------------CAAVLNGHKGTVWCSDFEKSESSLRLASC 239
           SYD T R+W + +DD                C  +   H   V+ +D+    +   +AS 
Sbjct: 300 SYDMTCRVWTDLSDDGHGLTGKTNSIDPAHGCRFIFMEHSEFVFGADWSLWGTPGFVAST 359

Query: 240 SDDSTVRVWNYVE 252
             D  V +WN + 
Sbjct: 360 GWDGQVCIWNGIR 372

>ACL116W [933] [Homologous to ScYGR200C (ELP2) - SH]
           complement(140589..143003) [2415 bp, 804 aa]
          Length = 804

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 58/262 (22%), Positives = 107/262 (40%), Gaps = 45/262 (17%)

Query: 76  HKKSVRSVSFR---PHSSILAAGSFDSTISIWGKEEDADPQDDFP-ETELL--------- 122
           H+  ++ ++FR   P   +LA+G+ D  I +W  + + + +++ P + +LL         
Sbjct: 214 HEDWIKDLAFRSNGPGDWMLASGAQDRYIRLWRIKANNNIEEEDPTKLKLLSNKIYKFQV 273

Query: 123 -----------AIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVL 171
                      A+I GH++ + ++ W  S   L + + D SV +WE DE+   + C S L
Sbjct: 274 TADLHLSINFEALIMGHDDWISSLQWHESKCQLLAATADTSVMLWEPDEISGIWVCASRL 333

Query: 172 QEH-----------AQDVKHVVWHS--EMHLLASSSYDDTIRLW--KEDADDWECAAVLN 216
            E            A      +W +  +   + ++    + R+W  + D   WE    + 
Sbjct: 334 GEFSSKGASTATGSAGGFWSCLWFATGDAEYILANGKTGSWRMWENRGDGGSWEQLPAIT 393

Query: 217 GHKGTVWCSDFEKSESSLRLASCSDDSTVRV---WNYVEEEENGEDVWAQEAILPNVHSR 273
           G   +V  +D   S S   L + S D T R+   W Y  +    +  W  E   P +H  
Sbjct: 394 GPTRSV--TDVAWSPSGSYLLASSLDQTTRLYTRWMYEGDGSRRKHTW-HEFARPQIHGY 450

Query: 274 AVYSVSWSLDGYIASVGSDGLL 295
            +  +    D    S G + +L
Sbjct: 451 DMICLEPISDTQFISAGDEKVL 472

 Score = 31.6 bits (70), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 76/350 (21%), Positives = 135/350 (38%), Gaps = 108/350 (30%)

Query: 28  SLKLHTDKLWSIDC--SKGLMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSVSF 85
           +LK H  ++ S+    ++ L+ ++S+D  I  V   +  ++L + L+    K SV S++ 
Sbjct: 74  TLKAHNAEVTSVKFIGAEKLLVSASADATIN-VWRGDERWELAQTLEGP--KSSVTSLAV 130

Query: 86  RPHSSILAAGSFDSTISIWGKEEDA--------DPQDDFP-------------------- 117
              + ++ AG  D T+S+W + +DA          +   P                    
Sbjct: 131 A--AGLIVAGFADGTLSVWSEHDDAFVLSSQFLIRKGFLPLALALQKLSDGCYMLAVSGT 188

Query: 118 ---------------ETELLAIIEGHENEVKAVSWSHSG---YYLASCSRDKSVWIWE-- 157
                          + EL A +EGHE+ +K +++  +G   + LAS ++D+ + +W   
Sbjct: 189 STDLMVYSVCVAATVDVELSATVEGHEDWIKDLAFRSNGPGDWMLASGAQDRYIRLWRIK 248

Query: 158 --------------------------AD-ELGEEYECLSVLQEHAQDVKHVVWHSEMHLL 190
                                     AD  L   +E L  +  H   +  + WH     L
Sbjct: 249 ANNNIEEEDPTKLKLLSNKIYKFQVTADLHLSINFEAL--IMGHDDWISSLQWHESKCQL 306

Query: 191 ASSSYDDTIRLWKED--ADDWECAAVLN-----------GHKGTVW-CSDFEKSESSLRL 236
            +++ D ++ LW+ D  +  W CA+ L            G  G  W C  F   ++   L
Sbjct: 307 LAATADTSVMLWEPDEISGIWVCASRLGEFSSKGASTATGSAGGFWSCLWFATGDAEYIL 366

Query: 237 ASCSDDSTVRVWNYVEEEENGEDVWAQEAILPNV--HSRAVYSVSWSLDG 284
           A+    S    W   E   +G   W Q   LP +   +R+V  V+WS  G
Sbjct: 367 ANGKTGS----WRMWENRGDGGS-WEQ---LPAITGPTRSVTDVAWSPSG 408

>Scas_721.115*
          Length = 318

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 48/204 (23%), Positives = 79/204 (38%), Gaps = 46/204 (22%)

Query: 72  DDSTHKKSVRSVSFRPHSSILA------------AGSFDSTISIWGKEEDADPQDDFPET 119
           DD      VRS  F+ HS I+             + S+D T+ +W          D    
Sbjct: 50  DDQKFGVPVRS--FKGHSHIVQDCTLTQDGAYALSASWDKTLRLW----------DVATG 97

Query: 120 ELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVK 179
           E      GH+++V +V+       + S SRDK++ +W       + +CL+ L  H     
Sbjct: 98  ETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTIKVWTI-----KGQCLATLLGHND--- 149

Query: 180 HVVWHSEMHLLASSSYDDTIRLWKEDADDWECAAVLN---------GHKGTVWCSDFEKS 230
              W S++ +  +   DD++ +     D    A  LN         GH G V  +    S
Sbjct: 150 ---WVSQVRIAPTDQNDDSVTVISAGNDKMVKAWNLNQFQIEADFVGHNGNV--NTVTAS 204

Query: 231 ESSLRLASCSDDSTVRVWNYVEEE 254
                +AS   D  + +WN  E++
Sbjct: 205 PDGTLIASAGKDGEIMLWNLAEKK 228

>YMR102C (YMR102C) [4060] chr13 complement(469847..472351) Protein
           containing six WD domains (WD-40 repeat), which may
           mediate protein-protein interactions, has moderate
           similarity to S. cerevisiae Ykl121p, which binds
           phosphatidylinositol [2505 bp, 834 aa]
          Length = 834

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/131 (24%), Positives = 63/131 (48%), Gaps = 12/131 (9%)

Query: 168 LSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDF 227
           L + +EH QDV  + W S+ + + S+S D T++LW  D  +     +   H   V C +F
Sbjct: 271 LRLYKEHVQDVLDINW-SKNNFILSASMDKTVKLWHPDRKNSLKTFI---HPDFVTCVEF 326

Query: 228 EKSESSLRLASCSDDSTVRVWNYVEEEENGE----DVWAQEAILPNVHSRAVYSVSWSLD 283
             ++    ++ C D    R+W+ +++E + E    D+     + P       Y++  + +
Sbjct: 327 HPTDDRFFISGCLDHK-CRLWSILDDEVSFEYDCQDLITSVTLSP---EEGKYTIIGTFN 382

Query: 284 GYIASVGSDGL 294
           GY+  + + GL
Sbjct: 383 GYVHILMTRGL 393

>AGR207C [4518] [Homologous to ScYBR175W (SWD3) - SH]
           (1146710..1147672) [963 bp, 320 aa]
          Length = 320

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/187 (25%), Positives = 80/187 (42%), Gaps = 24/187 (12%)

Query: 73  DSTHKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEV 132
           ++TH + +  + + P S+ +A+GS D T+ I              E   L  + GH   V
Sbjct: 51  ETTHTEPINDICWSPDSACVASGSEDFTVEI-----------THLEYGRLHKLRGHSAPV 99

Query: 133 KAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHV-VWHSEMHLLA 191
            +V ++  G  L + S D+S+  W  D L      L  +  H+  V  +     +  +L+
Sbjct: 100 LSVVFNCKGNLLCTASVDESIKQW--DVLSGTL--LKTMSAHSDPVVSIDTPDCDATILS 155

Query: 192 SSSYDDTIRLWKEDADDWECAAVLNGHK------GTVWCSDFEKSESSLRLASCSDDSTV 245
           S SYD  IR++  D +   C   L   K      G V  S  + S +   L   S D  V
Sbjct: 156 SGSYDGLIRIF--DTESGHCLKTLTYDKDWQTDDGVVPISQVKFSRNGKFLLVRSLDGVV 213

Query: 246 RVWNYVE 252
           ++W+++ 
Sbjct: 214 KLWDFIR 220

 Score = 31.2 bits (69), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 23/93 (24%), Positives = 42/93 (45%), Gaps = 11/93 (11%)

Query: 21  MSLELLKSLKLHTDKLWSI---DCSKGLMATSSSDRKIKLVN------LKNMDFQLVEEL 71
           +S  LLK++  H+D + SI   DC   ++++ S D  I++ +      LK + +    + 
Sbjct: 126 LSGTLLKTMSAHSDPVVSIDTPDCDATILSSGSYDGLIRIFDTESGHCLKTLTYDKDWQT 185

Query: 72  DDSTHKKSVRSVSFRPHSSILAAGSFDSTISIW 104
           DD      +  V F  +   L   S D  + +W
Sbjct: 186 DDGV--VPISQVKFSRNGKFLLVRSLDGVVKLW 216

>Scas_571.4
          Length = 601

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/148 (25%), Positives = 70/148 (47%), Gaps = 23/148 (15%)

Query: 61  KNMDFQLVEELDDSTHKKSVRSVSFRPH-SSILAAGSFDSTISIWGKEEDADPQDDFPET 119
           K MD +  + L  S H + V  V F P   ++LA+ S D T+ IW          +  + 
Sbjct: 134 KPMDIRPSKIL--SGHTRKVGHVLFHPRIRNVLASSSLDFTVKIW----------NIKKG 181

Query: 120 ELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEH-AQDV 178
           +++  ++ H + V A+++   G YLA+ +R+K + IW+        + +S  + H     
Sbjct: 182 KVIGTLQ-HSDMVTAMAFDPDGAYLATITRNKKLTIWDI----ASKQIVSQTKSHQGPKN 236

Query: 179 KHVVWHSEMHLLASSSY----DDTIRLW 202
           + VVW     ++A++ +    D  I +W
Sbjct: 237 QRVVWLGYSRIIATTGFSKSMDREIGIW 264

 Score = 33.5 bits (75), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 23/38 (60%), Gaps = 1/38 (2%)

Query: 212 AAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWN 249
            ++  GHKG V  +DF+   +  ++AS SDD  + +WN
Sbjct: 82  VSLFRGHKGQVLDTDFDPF-NDFKIASASDDGKIGIWN 118

>Scas_592.4*
          Length = 318

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 48/204 (23%), Positives = 78/204 (38%), Gaps = 46/204 (22%)

Query: 72  DDSTHKKSVRSVSFRPHSSILA------------AGSFDSTISIWGKEEDADPQDDFPET 119
           DD      VRS  F+ HS I+             + S+D T+ +W          D    
Sbjct: 50  DDQKFGVPVRS--FKGHSHIVQDCTLTQDGAYALSASWDKTLRLW----------DVATG 97

Query: 120 ELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVK 179
           E      GH+++V +V+       + S SRDK++ +W       + +CL+ L  H     
Sbjct: 98  ETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTIKVWTI-----KGQCLATLLGHND--- 149

Query: 180 HVVWHSEMHLLASSSYDDTIRLWKEDADDWECAAVLN---------GHKGTVWCSDFEKS 230
              W S++ +  +   DD + +     D    A  LN         GH G V  +    S
Sbjct: 150 ---WVSQVRIAPTDQNDDAVTVISAGNDKMVKAWNLNQFQIEADFVGHNGNV--NAVTAS 204

Query: 231 ESSLRLASCSDDSTVRVWNYVEEE 254
                +AS   D  + +WN  E++
Sbjct: 205 PDGTLIASAGKDGEIMLWNLAEKK 228

 Score = 32.0 bits (71), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 29/126 (23%), Positives = 44/126 (34%), Gaps = 36/126 (28%)

Query: 76  HKKSVRSVSFRPHSSILAAGSFDSTISIWG-------------------KEEDADPQDD- 115
           HK  V SV+    +S++ +GS D TI +W                    +    D  DD 
Sbjct: 106 HKSDVMSVAIDRKASMIISGSRDKTIKVWTIKGQCLATLLGHNDWVSQVRIAPTDQNDDA 165

Query: 116 ----------------FPETELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEAD 159
                             + ++ A   GH   V AV+ S  G  +AS  +D  + +W   
Sbjct: 166 VTVISAGNDKMVKAWNLNQFQIEADFVGHNGNVNAVTASPDGTLIASAGKDGEIMLWNLA 225

Query: 160 ELGEEY 165
           E    Y
Sbjct: 226 EKKAMY 231

>KLLA0F17237g 1577197..1578768 similar to sp|Q04225 Saccharomyces
           cerevisiae YMR131c RSA2, start by similarity
          Length = 523

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 51/197 (25%), Positives = 87/197 (44%), Gaps = 25/197 (12%)

Query: 119 TELLAIIEGHENEVKAVSWSHS-GYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQD 177
           T+  A    +   ++ + WS +     ASC  D  + IW  D   ++++    ++    D
Sbjct: 323 TDKQAFTVANNKSIEDLQWSRTESTVFASCGIDGYIRIW--DTRSKKHKPAISVKASNTD 380

Query: 178 VKHVVWHSEM-HLLASSSYDDTIRLW------KEDADDWECAAVLNGHKGTVWCSDFEKS 230
           V  + W  ++ +LLAS   D T  +W       ++A      A    HKG +    F   
Sbjct: 381 VNVISWSEKIGYLLASGDDDGTWGVWDLRQFTPQNASTASPVAQYQFHKGAITSISFNPL 440

Query: 231 ESSLRLASCSDDSTVRVWNYVEEEENGEDVWAQEA-------ILPN---VH-SRAVYSVS 279
           + S+ +A  S+D+TV +W+ +  E + E++  Q A       I P    VH  + V  V 
Sbjct: 441 DESI-IAVASEDNTVTLWD-LSVEADDEEIKQQAAETKELQQIPPQLLFVHWQKEVKDVK 498

Query: 280 W--SLDGYIASVGSDGL 294
           W   + G + S G+DGL
Sbjct: 499 WHKQIPGCLVSTGTDGL 515

 Score = 32.0 bits (71), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 37/72 (51%), Gaps = 10/72 (13%)

Query: 76  HKKSVRSVSFRP-HSSILAAGSFDSTISIWGKEEDADPQD---DFPETELLAIIEGH--- 128
           HK ++ S+SF P   SI+A  S D+T+++W    +AD ++      ET+ L  I      
Sbjct: 428 HKGAITSISFNPLDESIIAVASEDNTVTLWDLSVEADDEEIKQQAAETKELQQIPPQLLF 487

Query: 129 ---ENEVKAVSW 137
              + EVK V W
Sbjct: 488 VHWQKEVKDVKW 499

>Scas_692.25
          Length = 488

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 73/304 (24%), Positives = 111/304 (36%), Gaps = 89/304 (29%)

Query: 44  GLMATSSSDRKIKLV--NLKNMDFQLVEELDDSTHKKSVRSVSFRPHSSILAAGSFDSTI 101
            ++ATSS D  IKL   + K   F L   L +  H  S   +  + ++  LA+ S D++I
Sbjct: 202 AIIATSSKDLSIKLFRWSAKENKFLLFRVLMNHEHIVSEVKLFRKLNNIYLASCSRDTSI 261

Query: 102 SIWGKEEDA---------------DPQDDF---------------PETELLAIIEGHENE 131
            IW  E+                 D   DF               P    L+I  GHE  
Sbjct: 262 RIWTAEDGMILNSFHPHNEWVRCLDVSGDFVLSGSQDASLRLTHWPSGNGLSIGIGHEFP 321

Query: 132 VKAVSWSHSGYYLASCSRDKSV----WIWEADELGEEYECLSVLQEHAQDVKHVVWHSEM 187
           +++V      + L   + +K+     ++ +  E+  +YE +S                  
Sbjct: 322 IESVK-----FILPLSTNEKASPTINYLRKPLEIDSDYEKMS-----------------F 359

Query: 188 HLLASSSYDDTIRLWK---------------EDADDWECAAVLNGHKGTVWCSDFEKSES 232
              AS+S D  I++W+                   +++C   L GH    W  D     +
Sbjct: 360 KYCASASRDRLIKIWEIPTPRFVMHRPPVPNSSNSNFKCIMTLKGHAS--WVKDLRIRGN 417

Query: 233 SLRLASCSDDSTVRVWNYVEEEENGEDV--WAQEAILPNVHSRAVYSVSWSLDGYIASVG 290
              L SCSDD T+R WN     ENGE V  W       ++HS  V  +    DG     G
Sbjct: 418 --YLFSCSDDKTIRCWNL----ENGECVKQWT------DLHSGFVTCLDMDPDGGTNDTG 465

Query: 291 SDGL 294
              L
Sbjct: 466 QQSL 469

 Score = 35.0 bits (79), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 39/76 (51%), Gaps = 12/76 (15%)

Query: 89  SSILAAGSFDSTISI--WGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSH--SGYYL 144
           S+I+A  S D +I +  W  +E+        +  L  ++  HE+ V  V      +  YL
Sbjct: 201 SAIIATSSKDLSIKLFRWSAKEN--------KFLLFRVLMNHEHIVSEVKLFRKLNNIYL 252

Query: 145 ASCSRDKSVWIWEADE 160
           ASCSRD S+ IW A++
Sbjct: 253 ASCSRDTSIRIWTAED 268

>KLLA0D02530g complement(212703..214826) gi|5679595|emb|CAB51777.1
           Kluyveromyces lactis CRN1 homologue, start by similarity
          Length = 707

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 57/233 (24%), Positives = 102/233 (43%), Gaps = 39/233 (16%)

Query: 29  LKLHTDKLWSIDCSKG---LMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSVS- 84
            + HT ++   D S     ++A+ S D KI +  +   D+ L E +D+  + K ++ V  
Sbjct: 89  FRGHTAQVLDTDFSPFNDHIVASGSDDGKIGIWEIPE-DYGLHEYVDEEGNPKDLKPVRM 147

Query: 85  ------------FRPHS-SILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENE 131
                       F P + +ILA+ S D T+ IW          D  + E+   ++ H + 
Sbjct: 148 LSGHSRKVGHLLFHPLAENILASSSLDYTVKIW----------DISQEEVKFTLK-HPDM 196

Query: 132 VKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLA 191
           V ++S+S+ G +L + SRDK + +W  D   E+          A++ + VVW  +   +A
Sbjct: 197 VTSMSFSYDGKHLVTVSRDKKLRVW--DVRAEKIVSEGPAHSGAKN-QRVVWLGDTDKVA 253

Query: 192 SSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDST 244
           ++ +    RL       W+   +  G+ G  +  D    +SS  L    DDS 
Sbjct: 254 TTGFS---RLSDRQIGVWDAFNLEKGNLGGFYNVD----QSSGILMPFYDDSN 299

 Score = 29.6 bits (65), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 52/123 (42%), Gaps = 26/123 (21%)

Query: 188 HLLASSSYDDTIRLWKEDAD--------------DWECAAVLNGHKGTVWCSDFEKSESS 233
           H++AS S D  I +W+   D              D +   +L+GH   V    F     +
Sbjct: 107 HIVASGSDDGKIGIWEIPEDYGLHEYVDEEGNPKDLKPVRMLSGHSRKVGHLLFHPLAEN 166

Query: 234 LRLASCSDDSTVRVWNYVEEEENGEDVWAQEAILPNVHSRAVYSVSWSLDG-YIASVGSD 292
           + LAS S D TV++W+  +E          E      H   V S+S+S DG ++ +V  D
Sbjct: 167 I-LASSSLDYTVKIWDISQE----------EVKFTLKHPDMVTSMSFSYDGKHLVTVSRD 215

Query: 293 GLL 295
             L
Sbjct: 216 KKL 218

>Scas_720.45
          Length = 755

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/123 (24%), Positives = 54/123 (43%), Gaps = 16/123 (13%)

Query: 83  VSFRPH-SSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSH-- 139
           V+F P   +  A+G  D T+ +W   + A P           +  G E  V  V +    
Sbjct: 3   VAFNPKDPNTFASGCLDRTVKVWSLGQ-ATPN--------FTLNSGQEKGVNYVDYYPLP 53

Query: 140 SGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTI 199
              YL + S D +  +W+     +   C++ L+ H  +V   V+H  + ++ S S D T+
Sbjct: 54  DKPYLITSSDDLTCKVWDY----QTKSCVATLEGHMANVSFAVFHPTLPIIISGSEDGTL 109

Query: 200 RLW 202
           ++W
Sbjct: 110 KIW 112

 Score = 36.6 bits (83), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 29/108 (26%), Positives = 50/108 (46%), Gaps = 9/108 (8%)

Query: 144 LASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHS--EMHLLASSSYDDTIRL 201
            AS   D++V +W    LG+     ++     + V +V ++   +   L +SS D T ++
Sbjct: 13  FASGCLDRTVKVWS---LGQATPNFTLNSGQEKGVNYVDYYPLPDKPYLITSSDDLTCKV 69

Query: 202 WKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWN 249
           W  D     C A L GH   V  + F  +   +   S S+D T+++WN
Sbjct: 70  W--DYQTKSCVATLEGHMANVSFAVFHPTLPII--ISGSEDGTLKIWN 113

>CAGL0K00275g complement(25300..27447) similar to sp|P36037
           Saccharomyces cerevisiae YKL213c DOA1, hypothetical
           start
          Length = 715

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 51/105 (48%), Gaps = 13/105 (12%)

Query: 144 LASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWK 203
           + + S DKS+ +W   +L ++   +     H   ++H+ + S   + AS S D TI+L  
Sbjct: 154 ILTASADKSIGVWMEGKLIKKLSNI-----HDDVIRHLEYISN-DIFASCSNDGTIKLLN 207

Query: 204 EDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVW 248
            +    E   V  GH+  V+C     +     L SC +DSTVR+W
Sbjct: 208 LEG---EIKNVFEGHESFVYCVKHMNN----TLFSCGEDSTVRIW 245

 Score = 30.4 bits (67), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 32/56 (57%), Gaps = 2/56 (3%)

Query: 165 YECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLW-KEDADDWECAAVLNGHK 219
           Y+  + L+ H+QDVK +   ++ + +AS S D ++R+W +  + DWE   V    K
Sbjct: 2   YQLSATLRGHSQDVKDITAVND-NKIASVSRDGSLRVWTRSSSGDWEDVLVYQSDK 56

 Score = 30.0 bits (66), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 51/228 (22%), Positives = 95/228 (41%), Gaps = 34/228 (14%)

Query: 22  SLELLKSLKLHTDKLWSIDCSKGLMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVR 81
           S + + +L  HT  +  +    GL+ +SS D+  K+ +   + + L        H+ SV 
Sbjct: 91  SADPMYTLVGHTGNVCGLRFQNGLLLSSSWDKTAKIWDNNKLKYDL------RNHEASVW 144

Query: 82  SVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEG-HENEVKAVSWSHS 140
             +      IL A S D +I +W             E +L+  +   H++ ++ + +  +
Sbjct: 145 DSTMVSDDIILTA-SADKSIGVWM------------EGKLIKKLSNIHDDVIRHLEYISN 191

Query: 141 GYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIR 200
             + ASCS D ++ +     L  E E  +V + H   V + V H   + L S   D T+R
Sbjct: 192 DIF-ASCSNDGTIKL-----LNLEGEIKNVFEGHESFV-YCVKHMN-NTLFSCGEDSTVR 243

Query: 201 LWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVW 248
           +W  +        V+     +VW  D   +        C  D+T+R++
Sbjct: 244 IWSING---STKQVIRIPAVSVWNLDLLPNGD---FVICCSDNTIRIF 285

>CAGL0J04818g 455846..457810 highly similar to sp|Q06440
           Saccharomyces cerevisiae YLR429w CRN1, start by
           similarity
          Length = 654

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 57/123 (46%), Gaps = 17/123 (13%)

Query: 144 LASCSRDKSVWIWEA-----------DELGEEYECLSVLQEHAQDVKHVVWHSEMH-LLA 191
           +AS S D  + IW+            +E  ++ E    L  H++ V H+++H     +LA
Sbjct: 97  VASSSDDGKIGIWDIPQDYSILKSGDNEEIKDIEPTKFLTGHSRKVGHILYHPTAKDVLA 156

Query: 192 SSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNYV 251
           SSS D T+R+W  + +  E    L  H   V    F  S     LA+ + D  +RVWN  
Sbjct: 157 SSSLDYTVRIW--NVETGEDIYKLK-HPDMVTSMSF--SYDGTHLATVARDKKLRVWNVR 211

Query: 252 EEE 254
           EE+
Sbjct: 212 EEK 214

 Score = 41.2 bits (95), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 45/175 (25%), Positives = 81/175 (46%), Gaps = 34/175 (19%)

Query: 46  MATSSSDRKIKLVNLKNMDFQLV-----EELDD-------STHKKSVRSVSFRPHSS-IL 92
           +A+SS D KI + ++   D+ ++     EE+ D       + H + V  + + P +  +L
Sbjct: 97  VASSSDDGKIGIWDIP-QDYSILKSGDNEEIKDIEPTKFLTGHSRKVGHILYHPTAKDVL 155

Query: 93  AAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLASCSRDKS 152
           A+ S D T+ IW  E   D         +  +   H + V ++S+S+ G +LA+ +RDK 
Sbjct: 156 ASSSLDYTVRIWNVETGED---------IYKL--KHPDMVTSMSFSYDGTHLATVARDKK 204

Query: 153 VWIWEADELGEEYECLSVLQEHA-QDVKHVVWHSEMHLLASSSY----DDTIRLW 202
           + +W       E + +S    HA    + VVW      LA++ +    D  I +W
Sbjct: 205 LRVWNV----REEKVVSEGAAHAGAKNQRVVWLGNSERLATTGFSKLSDRQIGIW 255

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/122 (31%), Positives = 55/122 (45%), Gaps = 25/122 (20%)

Query: 188 HLLASSSYDDTIRLW-------------KEDADDWECAAVLNGHKGTVWCSDFEKSESSL 234
           + +ASSS D  I +W              E+  D E    L GH   V    +  +   +
Sbjct: 95  NRVASSSDDGKIGIWDIPQDYSILKSGDNEEIKDIEPTKFLTGHSRKVGHILYHPTAKDV 154

Query: 235 RLASCSDDSTVRVWNYVEEEENGEDVWAQEAILPNVHSRAVYSVSWSLDG-YIASVGSDG 293
            LAS S D TVR+WN     E GED++  +      H   V S+S+S DG ++A+V  D 
Sbjct: 155 -LASSSLDYTVRIWNV----ETGEDIYKLK------HPDMVTSMSFSYDGTHLATVARDK 203

Query: 294 LL 295
            L
Sbjct: 204 KL 205

>Kwal_33.15591
          Length = 714

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 47/171 (27%), Positives = 70/171 (40%), Gaps = 27/171 (15%)

Query: 124 IIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVW 183
           ++ GHEN V  ++ S    Y+ S S D +  +W    L  E      L+ H   V  V  
Sbjct: 100 VLIGHENNVCVLNSSQG--YVLSGSWDTTAKVWFQGALKHE------LKGHTASVWDVKM 151

Query: 184 HSEMHLLASSSYDDTIRLWKEDADDWECAAVLNGHKG--TVWCSDFEKSESSLRLASCSD 241
             E+    ++S D TI+LW       E   VL    G  T      +   S  + ASCS+
Sbjct: 152 LPEVGFYMTASADGTIKLW-------EGEKVLKTFTGLHTDVIRHIDIDASGEKFASCSN 204

Query: 242 DSTVRVWNYVEEEENGEDVWAQEAILPNVHSRAVYSVSWSLDGYIASVGSD 292
           D TV++           D+  +       H   VYSV ++ +G + S G D
Sbjct: 205 DGTVKI----------NDMEGKTLKTLVGHESFVYSVKFAPNGDVISCGED 245

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 54/110 (49%), Gaps = 16/110 (14%)

Query: 141 GYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIR 200
           G+Y+ + S D ++ +WE +++ + +  L     H   ++H+   +     AS S D T++
Sbjct: 156 GFYM-TASADGTIKLWEGEKVLKTFTGL-----HTDVIRHIDIDASGEKFASCSNDGTVK 209

Query: 201 LWKEDADDWECAAV--LNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVW 248
           +     +D E   +  L GH+  V+   F  +   +   SC +D TVR+W
Sbjct: 210 I-----NDMEGKTLKTLVGHESFVYSVKFAPNGDVI---SCGEDRTVRIW 251

 Score = 38.5 bits (88), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 60/133 (45%), Gaps = 19/133 (14%)

Query: 29  LKLHTDKLWSIDCSK--GLMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSVSFR 86
           LK HT  +W +      G   T+S+D  IKL      + + V +     H   +R +   
Sbjct: 139 LKGHTASVWDVKMLPEVGFYMTASADGTIKL-----WEGEKVLKTFTGLHTDVIRHIDID 193

Query: 87  PHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLAS 146
                 A+ S D T+ I          +D  E + L  + GHE+ V +V ++ +G  + S
Sbjct: 194 ASGEKFASCSNDGTVKI----------NDM-EGKTLKTLVGHESFVYSVKFAPNGDVI-S 241

Query: 147 CSRDKSVWIWEAD 159
           C  D++V IW+AD
Sbjct: 242 CGEDRTVRIWKAD 254

 Score = 37.4 bits (85), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 51/132 (38%), Gaps = 19/132 (14%)

Query: 76  HKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEG-HENEVKA 134
           H  SV  V   P        S D TI +W  E+            +L    G H + ++ 
Sbjct: 142 HTASVWDVKMLPEVGFYMTASADGTIKLWEGEK------------VLKTFTGLHTDVIRH 189

Query: 135 VSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSS 194
           +    SG   ASCS D +V I +      E + L  L  H   V  V +     ++ S  
Sbjct: 190 IDIDASGEKFASCSNDGTVKINDM-----EGKTLKTLVGHESFVYSVKFAPNGDVI-SCG 243

Query: 195 YDDTIRLWKEDA 206
            D T+R+WK D 
Sbjct: 244 EDRTVRIWKADG 255

 Score = 35.4 bits (80), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 43/171 (25%), Positives = 70/171 (40%), Gaps = 49/171 (28%)

Query: 120 ELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIW--------------EADELGEEY 165
           +L A + GHE +VK+V+  ++   +A+CSRD SV +W              ++DE     
Sbjct: 7   KLSATLSGHEQDVKSVAVLNNDT-VATCSRDGSVRLWKKGHNNLWQDAVVYQSDEFVNSL 65

Query: 166 --------------ECL-----SVLQEHAQDVKHV---------VWHSEMHLLASSSYDD 197
                          CL      +L +  QD + V         V +S    + S S+D 
Sbjct: 66  CYDNTSGLLFCGGQNCLINSVSPLLGDVGQDSEFVLIGHENNVCVLNSSQGYVLSGSWDT 125

Query: 198 TIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVW 248
           T ++W + A   E    L GH  +VW  D +         + S D T+++W
Sbjct: 126 TAKVWFQGALKHE----LKGHTASVW--DVKMLPEVGFYMTASADGTIKLW 170

 Score = 28.9 bits (63), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 29/51 (56%), Gaps = 2/51 (3%)

Query: 165 YECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDADD-WECAAV 214
           Y+  + L  H QDVK V   +    +A+ S D ++RLWK+  ++ W+ A V
Sbjct: 6   YKLSATLSGHEQDVKSVAVLNN-DTVATCSRDGSVRLWKKGHNNLWQDAVV 55

>Kwal_0.212
          Length = 303

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 45/236 (19%), Positives = 99/236 (41%), Gaps = 41/236 (17%)

Query: 54  KIKLVNLKNMDFQLVEELDDSTHKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQ 113
            ++L +++  +   V   +   H+ +V S++F+  +  + + S D TI +W     +  Q
Sbjct: 54  NVRLYDIRTTNPNPVTSFEG--HRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPS-VQ 110

Query: 114 DDFPETELLAIIEGHENE---------------------------------VKAVSWSHS 140
            ++     +  +  H N+                                 ++++S +  
Sbjct: 111 RNYKHQAAVNEVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASD 170

Query: 141 GYYLASCSRDKSVWIWEADELGEEYECLSV--LQEHAQDVKHVVWHSEMHLLASSSYDDT 198
           G  L + +   + ++W+     +      V   + HA+ +  V+  S++  LA+ S D T
Sbjct: 171 GSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHT 230

Query: 199 IRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNYVEEE 254
            R+W  D D+++    L+ H+  VW   F  ++S+  + +CS D  VR+W+    E
Sbjct: 231 ARVWSID-DNFQLETTLDNHQRWVWDCAFS-ADSAYLVTACS-DHYVRLWDLSTRE 283

>KLLA0C08976g 784536..787271 highly similar to sgd|S0000653
           Saccharomyces cerevisiae YCR057c PWP2 periodic
           tryptophan protein, start by similarity
          Length = 911

 Score = 42.4 bits (98), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 39/165 (23%), Positives = 63/165 (38%), Gaps = 48/165 (29%)

Query: 126 EGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHS 185
           +GH + +  + +S  G  + + S +  + IW+         CL+   EHA  V  V +  
Sbjct: 338 QGHFDTLNGLCYSPDGSKIVTASHEGKIKIWDV----ASGFCLATFDEHAGGVSAVEFAK 393

Query: 186 EMHLLASSSYDDTIRLW----------------------------------KEDADD--- 208
           +  +L S+S D T++ W                                   ED+ D   
Sbjct: 394 KGQVLFSASLDGTVKAWDLIRYRNFRTFTATERIQFNSLAVDPSGEVVCAGSEDSFDIFV 453

Query: 209 -----WECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVW 248
                 +    L+GH+G + C  F  S  +  LAS S D T+RVW
Sbjct: 454 WSVQTGQLVDTLSGHEGPISCLSF--SNENGVLASASWDKTIRVW 496

 Score = 37.7 bits (86), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 53/236 (22%), Positives = 97/236 (41%), Gaps = 29/236 (12%)

Query: 25  LLKSLKLHTDKLWSIDCSKGLMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSVS 84
           LL ++    + L+S D SK L    +      L+N  N  F    E     H+K+V  V 
Sbjct: 10  LLGTVYRQGNVLFSQDGSKLLSPVGNRVSVFDLIN--NTAFTFEYE-----HRKNVAVVD 62

Query: 85  FRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYL 144
                ++L       +I + G+   A+    F    +L      E +V  + +S  G   
Sbjct: 63  INKQGTLLL------SIDVDGRGILAN----FKTRNVLHHFNFKE-KVYDLKFSPDGKLF 111

Query: 145 A-SCSRDKSVWIWEADELGEEYECLSVLQ-----EHAQDVKHVVWHSEMHLLASSSYDDT 198
           A +C R   + IW   E  E+ +    ++      H  D+  + W  +   + S+S D T
Sbjct: 112 ALACGR--FLQIWRTPETTEDRQFAPFVRYRIHAGHFSDITSLTWSKDSRFIISTSKDLT 169

Query: 199 IRLWKEDADDWECAA-VLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNYVEE 253
            R+W  ++++   A+    GH+  V  + F  S+   ++ + S D  +  W Y ++
Sbjct: 170 ARIWSVNSEEKNLASTTFAGHRDNVIGAYF--SDDQEKIYTVSKDGALFQWEYTKK 223

 Score = 37.4 bits (85), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 38/166 (22%), Positives = 70/166 (42%), Gaps = 20/166 (12%)

Query: 74  STHKKSVRSVSFRPHSSILAAGSFDST-ISIWGKEEDADPQDDFPETELLAIIEGHENEV 132
           +T +    S++  P   ++ AGS DS  I +W  +            +L+  + GHE  +
Sbjct: 423 ATERIQFNSLAVDPSGEVVCAGSEDSFDIFVWSVQTG----------QLVDTLSGHEGPI 472

Query: 133 KAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLAS 192
             +S+S+    LAS S DK++ +W      ++ E   V      DV  +    +   +A+
Sbjct: 473 SCLSFSNENGVLASASWDKTIRVWSLFGRSQQVEPFEVF----SDVLSISMKPDGQQIAA 528

Query: 193 SSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFE---KSESSLR 235
           S+    I  +  D  + +    ++G +  +     E    SESS R
Sbjct: 529 STLAGQILFF--DVAEGKQVGNIDGKRDIISGRHLEDRFTSESSAR 572

 Score = 35.0 bits (79), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 37/160 (23%), Positives = 68/160 (42%), Gaps = 28/160 (17%)

Query: 3   MIKHNLYTFSHKHTRLQRMSLELLKSLKLHTDKLWSIDC-SKGLMATSSSDRKIKLVNLK 61
           +I +  +TF ++H    R ++ ++   K  T  L SID   +G++A              
Sbjct: 42  LINNTAFTFEYEH----RKNVAVVDINKQGT-LLLSIDVDGRGILA-------------- 82

Query: 62  NMDFQLVEELDDSTHKKSVRSVSFRPHSSI--LAAGSFDSTISIWGKEEDADPQDDFPET 119
             +F+    L     K+ V  + F P   +  LA G F   + IW   E  + +   P  
Sbjct: 83  --NFKTRNVLHHFNFKEKVYDLKFSPDGKLFALACGRF---LQIWRTPETTEDRQFAPFV 137

Query: 120 ELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEAD 159
               I  GH +++ +++WS    ++ S S+D +  IW  +
Sbjct: 138 RY-RIHAGHFSDITSLTWSKDSRFIISTSKDLTARIWSVN 176

 Score = 33.9 bits (76), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 29/128 (22%), Positives = 56/128 (43%), Gaps = 14/128 (10%)

Query: 76  HKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAV 135
           H   V +V F     +L + S D T+  W      + +  F  TE +        +  ++
Sbjct: 382 HAGGVSAVEFAKKGQVLFSASLDGTVKAWDLIRYRNFRT-FTATERI--------QFNSL 432

Query: 136 SWSHSGYYLASCSRDK-SVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSS 194
           +   SG  + + S D   +++W      +  + +  L  H   +  + + +E  +LAS+S
Sbjct: 433 AVDPSGEVVCAGSEDSFDIFVWSV----QTGQLVDTLSGHEGPISCLSFSNENGVLASAS 488

Query: 195 YDDTIRLW 202
           +D TIR+W
Sbjct: 489 WDKTIRVW 496

>Scas_721.7
          Length = 325

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 53/217 (24%), Positives = 87/217 (40%), Gaps = 30/217 (13%)

Query: 49  SSSDRKIKLVNLKNM---DFQL--VEELDDSTHKKSVRSVSFRPHSSILAAGSFDSTISI 103
           S + R I +  L  +   D Q   +  +  ++H   +  V++ P +  LA+ S D TI I
Sbjct: 24  SPNGRLIAVTQLTQILIYDLQTRAIHSIIPTSHVAPISEVAWSPDNQCLASASDDFTIEI 83

Query: 104 WGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGE 163
                             L  + GH   V +++++ SG  L + S D+S+ IW+      
Sbjct: 84  THLTHGC-----------LHRLMGHTAPVISLTYNDSGNLLFTSSMDESIKIWDT----F 128

Query: 164 EYECLSVLQEHAQDVK--HVVWHSEMHLLASSSYDDTIRLWKEDADDWECAAVLNGHK-- 219
               L  +  H++ V    +    +  +LAS S+D  IRL+  D     C   L   K  
Sbjct: 129 HGAILKTISAHSESVVSLSICPDRDSSVLASGSFDGLIRLF--DTRTGHCLKTLTYDKDW 186

Query: 220 ----GTVWCSDFEKSESSLRLASCSDDSTVRVWNYVE 252
               G V  S    S +   L   S D  V++W+ V 
Sbjct: 187 KSDDGVVPISQVRFSPNGKFLLVSSFDGIVKIWDCVR 223

>Scas_718.6*
          Length = 546

 Score = 42.0 bits (97), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 50/261 (19%), Positives = 108/261 (41%), Gaps = 35/261 (13%)

Query: 45  LMATSSSDRKIKLVNLKNMDFQLVEELD--------DSTHKKS--VRSVSFRPHSSILAA 94
           L+A    D   K++     D +++  L+          T +K+  + ++S+ P   ++  
Sbjct: 196 LLAYGQEDSMAKMIEYNKEDKKIISSLELRHPFALSSITGRKTNQITALSWSPDGELIIT 255

Query: 95  GSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVW 154
              +  + +W K+             L  +   H + + ++ W+    +  S   D    
Sbjct: 256 SVENGELRLWNKD-----------GRLQNVFNFHRSPIVSIKWNEDSKHFISLDLDNITI 304

Query: 155 IWEADE--LGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDADDWECA 212
           +W A    + + +E    L+ + + +   +   +   L     + +I ++    DD +  
Sbjct: 305 LWNAINGIILQHFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSILVYS--IDDNKPI 362

Query: 213 AVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNYVEEEENGEDVWAQEAILPNVHS 272
             L GH+GT+ C +F  + S L L S   D ++R+W+   ++EN  + +         HS
Sbjct: 363 GKLLGHQGTISCIEFNVN-SRLLLTSSDSDYSIRIWH--GQKENCCNCFYG-------HS 412

Query: 273 RAVYSVSWSLDGYIASVGSDG 293
           +++ S+SW  D  + S   DG
Sbjct: 413 QSIISLSWINDDLVISASMDG 433

 Score = 28.5 bits (62), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 32/68 (47%), Gaps = 13/68 (19%)

Query: 189 LLASSSYDDTIRLWKEDADDWECAAVLNGHKGTV----WCSDFEKSESSLRLASCSDDST 244
           LL SS  D +IR+W    ++  C     GH  ++    W +D         + S S D +
Sbjct: 384 LLTSSDSDYSIRIWHGQKEN--CCNCFYGHSQSIISLSWINDD-------LVISASMDGS 434

Query: 245 VRVWNYVE 252
           VR+W+ VE
Sbjct: 435 VRIWSVVE 442

>Scas_658.1
          Length = 442

 Score = 42.0 bits (97), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 42/178 (23%), Positives = 77/178 (43%), Gaps = 21/178 (11%)

Query: 76  HKKSVRSVSFRPHS-SILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKA 134
           H     S++F P+S ++L +G  D+ + +W         D + +  LL   +GH   + +
Sbjct: 148 HTNGTTSLTFLPNSGNLLLSGGNDNIVKVW---------DFYHKRNLLRDYKGHSKAINS 198

Query: 135 VSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLA--- 191
           + ++  G    S S D ++ IW+  E G+    L   +    DVK   ++S   ++    
Sbjct: 199 LDFNDDGTNFISSSFDHTIKIWDT-EQGKVKTKLH-FKSTPNDVKFRPFNSSEFIVGFAN 256

Query: 192 SSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWN 249
           S  Y    R+ + D        V + H  ++    F    S  +  S S+D TVR+W+
Sbjct: 257 SKIYHYDTRISENDGR----VQVYDHHMSSILALKFFPDGS--KFISSSEDKTVRIWD 308

>Sklu_2442.2 YNL006W, Contig c2442 3831-4742
          Length = 303

 Score = 41.6 bits (96), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 54/243 (22%), Positives = 103/243 (42%), Gaps = 31/243 (12%)

Query: 55  IKLVNLKNMDFQLVEELDDSTHKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQD 114
           ++L +++  +   V   +   H+ +V S+SF+  +  + + S D TI +W     +  Q 
Sbjct: 55  VRLYDIRTTNPNPVTSFEG--HRGNVTSISFQQDNKWMVSSSEDGTIKVWDVRAPS-VQR 111

Query: 115 DFPETELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEH 174
           ++     +  +  H N+ +          L SC +D ++ IW   +LGE      +  E 
Sbjct: 112 NYKHHAPVNEVVIHPNQGE----------LISCDQDGNIRIW---DLGENQCTHQLTPED 158

Query: 175 AQDVKHVVWHSEMHLLASSSYDDTIRLWK----EDADDWECAAVLNGHKGTVWCSDFEKS 230
              ++ +   S+  +L + +      +W+     DA + +       H  T + +    S
Sbjct: 159 DTPLQSLSIASDGSMLVAGNNKGNCYVWQMPNHTDAANLKPVTKFRSH--TKYITRVLLS 216

Query: 231 ESSLRLASCSDDSTVRVWNYVEEEENGEDVWAQEAILPNVHSRAVYSVSWSLD-GYIASV 289
                LA+CS D T RVW+        ED +  E  L + H R V+  ++S D  Y+ + 
Sbjct: 217 SDVKHLATCSADHTARVWSI-------EDNFKLETTL-DGHQRWVWDCAFSADSAYLVTA 268

Query: 290 GSD 292
            SD
Sbjct: 269 CSD 271

>KLLA0C07425g complement(647673..649007) highly similar to sp|Q12024
           Saccharomyces cerevisiae YOR272w YTM1
           microtubule-interacting protein singleton, start by
           similarity
          Length = 444

 Score = 41.6 bits (96), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 49/217 (22%), Positives = 97/217 (44%), Gaps = 25/217 (11%)

Query: 38  SIDCSKGLMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSVSFRPHSSILAAGSF 97
           S+D     + + S D  ++  NL         E   S H   +R+V +   + +++AG+ 
Sbjct: 108 SLDVGSNYIYSGSYDGIVRTYNLSGK-----VEKQYSGHSGPIRAVHYISSTRLVSAGN- 161

Query: 98  DSTISIWGKEED---ADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVW 154
           D T+ +W  + D   +  +++  + + LAI+EGH+  V ++  S      ASC  D +V 
Sbjct: 162 DRTLRLWKTKNDDLKSIDEEEIEDGKTLAILEGHKAPVVSIDVSKDRILSASC--DNTVS 219

Query: 155 IWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDADDWECAAV 214
           +W  +     Y+ ++V+ +  +D+   V  +       +  D +IR            A+
Sbjct: 220 LWSTN-----YKEMTVI-DPMEDLGGNVSTAAKKRRKLTLKDGSIRRRAP-------LAL 266

Query: 215 LNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNYV 251
              H   V    F+KS+ ++   S S D T++ W+ +
Sbjct: 267 FESHSAPVEAVIFDKSDDTVGY-SVSQDHTIKTWDLI 302

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 31/92 (33%), Positives = 45/92 (48%), Gaps = 18/92 (19%)

Query: 174 HAQDVKHVVWHSEMHLLASSSYDDTIRLWK-----------EDADDWECAAVLNGHKGTV 222
           H+  ++ V + S   L+ S+  D T+RLWK           E+ +D +  A+L GHK  V
Sbjct: 141 HSGPIRAVHYISSTRLV-SAGNDRTLRLWKTKNDDLKSIDEEEIEDGKTLAILEGHKAPV 199

Query: 223 WCSDFEKSESSLRLASCSDDSTVRVW--NYVE 252
              D  K     R+ S S D+TV +W  NY E
Sbjct: 200 VSIDVSKD----RILSASCDNTVSLWSTNYKE 227

 Score = 37.0 bits (84), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 74/293 (25%), Positives = 117/293 (39%), Gaps = 64/293 (21%)

Query: 46  MATSSSDRKIKLVNLKNMDFQLV--EELDDST-------HKKSVRSVSFRPHSSILAAGS 96
           + ++ +DR ++L   KN D + +  EE++D         HK  V S+       IL+A S
Sbjct: 156 LVSAGNDRTLRLWKTKNDDLKSIDEEEIEDGKTLAILEGHKAPVVSIDVS-KDRILSA-S 213

Query: 97  FDSTISIWG---KEEDA-DPQDDFP---------------------ETELLAIIEGHENE 131
            D+T+S+W    KE    DP +D                           LA+ E H   
Sbjct: 214 CDNTVSLWSTNYKEMTVIDPMEDLGGNVSTAAKKRRKLTLKDGSIRRRAPLALFESHSAP 273

Query: 132 VKAVSWSHS----GYYLASCSRDKSVWIWE------ADELGEEYECLSVLQEHAQDVKHV 181
           V+AV +  S    GY   S S+D ++  W+       D     Y  LSV Q         
Sbjct: 274 VEAVIFDKSDDTVGY---SVSQDHTIKTWDLITAKCVDTKTTSYSLLSVAQ--------- 321

Query: 182 VWHSEMHLLA--SSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASC 239
               +++LLA  SS+   T+   + ++        L GHK  V   D    E+   + S 
Sbjct: 322 --LPKLNLLACGSSARHITLHDPRVNSSSKITQQQLVGHKNFVVALD-TCPENEYMICSA 378

Query: 240 SDDSTVRVWNYVEEEENGEDVWAQEAILPNVHSRAVYSVSWSLDGYIASVGSD 292
           S D TV+VW+              + ++  V+ + V++V W+    I S G D
Sbjct: 379 SHDGTVKVWDVRSNTAMYTITREDKNVVKGVNDK-VFAVKWAKGVGIISGGQD 430

>Kwal_47.17827
          Length = 523

 Score = 41.6 bits (96), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 49/197 (24%), Positives = 90/197 (45%), Gaps = 25/197 (12%)

Query: 119 TELLAIIEGHENEVKAVSWSHS-GYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQD 177
           T+  A   G+   ++ + +S +     A+C  D  + IW  D   ++++    ++  + D
Sbjct: 323 TDKTAFSAGNNQSIEDIQFSRTEATVFATCGCDGYIRIW--DTRSKKHKPAISVKASSTD 380

Query: 178 VKHVVWHSEM-HLLASSSYDDTIRLW------KEDADDWECAAVLNGHKGTVWCSDFEKS 230
           V  + W+ ++ +LLAS   + T  +W        +A      A  + HKG +    F   
Sbjct: 381 VNVISWNEKIGYLLASGDDNGTWGVWDLRQFSPNNAASVSPVAQYSFHKGAITSIAFNPL 440

Query: 231 ESSLRLASCSDDSTVRVWNYVEEEENGEDVWAQEA-------ILPN---VH-SRAVYSVS 279
           + S+ +A  S+D+TV +W+ +  E + E++  Q A       I P    VH  + V  V 
Sbjct: 441 DDSI-IAVASEDNTVTLWD-LSVEADDEEIKQQAAETKELQQIPPQLLFVHWQKEVKDVK 498

Query: 280 W--SLDGYIASVGSDGL 294
           W   + G + S G+DGL
Sbjct: 499 WHKQIPGCLVSTGTDGL 515

 Score = 31.2 bits (69), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 38/74 (51%), Gaps = 10/74 (13%)

Query: 74  STHKKSVRSVSFRP-HSSILAAGSFDSTISIWGKEEDADPQD---DFPETELLAIIEGH- 128
           S HK ++ S++F P   SI+A  S D+T+++W    +AD ++      ET+ L  I    
Sbjct: 426 SFHKGAITSIAFNPLDDSIIAVASEDNTVTLWDLSVEADDEEIKQQAAETKELQQIPPQL 485

Query: 129 -----ENEVKAVSW 137
                + EVK V W
Sbjct: 486 LFVHWQKEVKDVKW 499

>AAL009C [178] [Homologous to ScYNL006W (LST8) - SH]
           (325785..326696) [912 bp, 303 aa]
          Length = 303

 Score = 41.2 bits (95), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 56/245 (22%), Positives = 106/245 (43%), Gaps = 35/245 (14%)

Query: 55  IKLVNLKNMDFQLVEELDDSTHKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQD 114
           +++ +++  +   V   +   H+ +V S++F+  +  + + S D TI +W     +  ++
Sbjct: 55  VRMYDIRTTNPNPVTSFEG--HRGNVTSIAFQQDNKWMVSSSEDGTIKVWDVRSPSVQRN 112

Query: 115 ---DFPETELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVL 171
              D P  E+  +I  ++ E            L SC +D ++ IW   +LGE  +C + L
Sbjct: 113 YKHDAPVNEV--VIHPNQGE------------LISCDQDGNIKIW---DLGEN-QCTNQL 154

Query: 172 Q-EHAQDVKHVVWHSEMHLLASSSYDDTIRLWK--EDADDWECAAVLNGHKGTVWCSDFE 228
             E    ++ +   S+  +L + +      +WK     D      V      + + +   
Sbjct: 155 ALEDNTALQSLSIASDGSMLVAGNNKGNCYVWKMPNHTDTASLKPVTKFRSHSKYITRVL 214

Query: 229 KSESSLRLASCSDDSTVRVWNYVEEEENGEDVWAQEAILPNVHSRAVYSVSWSLD-GYIA 287
            S     LA+CS D T RVW+        ED +  E  L + HSR V+  ++S D  Y+ 
Sbjct: 215 LSVDVKHLATCSADHTARVWSV-------EDNFQLETTL-DAHSRWVWDCAFSADSAYLV 266

Query: 288 SVGSD 292
           +  SD
Sbjct: 267 TACSD 271

>CAGL0J03344g complement(322226..323857) highly similar to sp|P40055
           Saccharomyces cerevisiae YER082c, hypothetical start
          Length = 543

 Score = 41.6 bits (96), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 49/98 (50%), Gaps = 12/98 (12%)

Query: 66  QLVEELDDSTHKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAII 125
           Q+V EL   T      S++  P ++++  G  + T+++W            PE  L+ ++
Sbjct: 212 QMVSEL--RTKLGPTTSMTHNPWNAVMHLGHSNGTVTLWS--------PSMPE-PLVKLL 260

Query: 126 EGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGE 163
            G    + +V+   SGYY+A+ S+DKS+ IW+     E
Sbjct: 261 SGR-GPINSVAVDRSGYYMATVSQDKSLKIWDIRNFKE 297

>AER337W [2838] [Homologous to ScYOR272W (YTM1) - SH]
           complement(1256750..1258087) [1338 bp, 445 aa]
          Length = 445

 Score = 41.2 bits (95), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 72/298 (24%), Positives = 107/298 (35%), Gaps = 84/298 (28%)

Query: 74  STHKKSVRSVSFRPHSSILAAGSFDSTISIWG-KEEDADPQDDFPETE---LLAIIEGHE 129
           S H  +VR+V F   S+ L +G  D T+ +W  K +D    D+   TE    LAI+EGH+
Sbjct: 139 SGHTGAVRAVKF-ISSTRLVSGGNDRTLRLWKTKNDDVKHVDELEGTEEAHTLAILEGHQ 197

Query: 130 NEVKAVSWSHSGYYLASCSRDKSVWIWEA-----------DELGEEYEC----------- 167
             V  VS    G  + S S D S+  W             D LG++              
Sbjct: 198 APV--VSVDVQGDRILSASYDNSIGFWSTNHKDMTAVDPMDSLGDKASSAAKKRRKLTMK 255

Query: 168 ---------LSVLQEHAQDVKHVVWHSEMHLLA-SSSYDDTIRLW--------------- 202
                    LS+L+ H   V+ V++ S    +A S S D TI+ W               
Sbjct: 256 DGSVRRRAPLSLLESHKAPVEQVIFASNDSTVAYSVSQDHTIKTWDLVTSRCVDTKSTSY 315

Query: 203 ----------------------------KEDADDWECAAVLNGHKGTVWCSDFEKSESSL 234
                                       + D+        L GHK  V   D    E+  
Sbjct: 316 SLLSMVELPKLRLLACGSSARHITLHDPRADSSAKITQQQLLGHKNFVVALD-TCPENEY 374

Query: 235 RLASCSDDSTVRVWNYVEEEENGEDVWAQEAILPNVHSRAVYSVSWSLDGYIASVGSD 292
            L S S D TV+VW+              +++   ++ + V++V W+    I S G D
Sbjct: 375 MLCSASHDGTVKVWDIRSSSSIYTITREDQSVEKGINDK-VFAVKWAKGVGIISGGQD 431

>YDR364C (CDC40) [1190] chr4 complement(1202831..1204198) Protein
           required for the second catalytic step of mRNA splicing,
           member of WD (WD-40) repeat family [1368 bp, 455 aa]
          Length = 455

 Score = 41.2 bits (95), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 53/222 (23%), Positives = 91/222 (40%), Gaps = 27/222 (12%)

Query: 76  HKKSVRSVSFRPHSS-ILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKA 134
           H +   ++ F P +  ++ +G  D TI IW         D + + E L   +GH   +KA
Sbjct: 161 HPEGTTALKFLPKTGHLILSGGNDHTIKIW---------DFYHDYECLRDFQGHNKPIKA 211

Query: 135 VSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSS 194
           + ++       S S D+SV IW+  E G+    L  L     DV+    +    ++  S+
Sbjct: 212 LRFTEDCQSFLSSSFDRSVKIWDT-ETGKVKTRLH-LNSTPADVESRPTNPHEFIVGLSN 269

Query: 195 -----YDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVW- 248
                YDD +      +++       + H  ++    +    S  +  S S+D TVR+W 
Sbjct: 270 SKILHYDDRV------SENQGLVQTYDHHLSSILALKYFPDGS--KFISSSEDKTVRIWE 321

Query: 249 NYVEEEENGEDVWAQEAI-LPNVHSRAVYSVSWSLDGYIASV 289
           N +          AQ ++   NVH    Y  + S+D  I S 
Sbjct: 322 NQINVPIKQISDTAQHSMPFLNVHPSQNYFCAQSMDNRIYSF 363

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/84 (23%), Positives = 42/84 (50%), Gaps = 4/84 (4%)

Query: 120 ELLAIIEGHENEVKAVSW-SHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDV 178
           +++    GH     A+ +   +G+ + S   D ++ IW+      +YECL   Q H + +
Sbjct: 153 KVIRNYPGHPEGTTALKFLPKTGHLILSGGNDHTIKIWD---FYHDYECLRDFQGHNKPI 209

Query: 179 KHVVWHSEMHLLASSSYDDTIRLW 202
           K + +  +     SSS+D ++++W
Sbjct: 210 KALRFTEDCQSFLSSSFDRSVKIW 233

>CAGL0G00704g 65805..67127 similar to sp|P39706 Saccharomyces
           cerevisiae YAR003w, hypothetical start
          Length = 440

 Score = 41.2 bits (95), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 32/104 (30%), Positives = 50/104 (48%), Gaps = 9/104 (8%)

Query: 60  LKNMDFQLVEELDDSTHKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPET 119
           LK+   +LV  L++  + + +    F P    LA G  +  + I+    D D     P T
Sbjct: 12  LKDYPEKLVHTLENPLNTECLE---FSPGGDYLALGCSNGAVIIY----DMDTLK--PIT 62

Query: 120 ELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGE 163
            L + + GH   V +VSWS  G YL + SRD  + +W+  + GE
Sbjct: 63  MLGSKLGGHVQAVNSVSWSGCGRYLITTSRDWFIKLWDLAKPGE 106

 Score = 34.3 bits (77), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 28/88 (31%), Positives = 42/88 (47%), Gaps = 2/88 (2%)

Query: 115 DFPETELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEH 174
           D+PE +L+  +E   N  + + +S  G YLA    + +V I++ D L       S L  H
Sbjct: 14  DYPE-KLVHTLENPLN-TECLEFSPGGDYLALGCSNGAVIIYDMDTLKPITMLGSKLGGH 71

Query: 175 AQDVKHVVWHSEMHLLASSSYDDTIRLW 202
            Q V  V W      L ++S D  I+LW
Sbjct: 72  VQAVNSVSWSGCGRYLITTSRDWFIKLW 99

>CAGL0C01441g complement(156930..159947) similar to tr|Q08924
           Saccharomyces cerevisiae YPL183c, start by similarity
          Length = 1005

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/156 (25%), Positives = 72/156 (46%), Gaps = 12/156 (7%)

Query: 115 DFPETELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEH 174
           D  + EL+  + GHE  +  +  S     +ASCS D+S+ +W+  E G+E   LS+   H
Sbjct: 165 DLYKEELIHNLTGHEGSIFYIQSSEHNKLIASCSDDRSIRLWDR-ETGKE---LSIGWSH 220

Query: 175 AQDVKHVVWHSEMHLLASSSYDDTIRLWKEDADD-----WECAAVLNGH-KGTVWCSDFE 228
              + ++ + +    L S S D T R+W    +D      + + +  GH    VW  D  
Sbjct: 221 TARIWNLKFFNNDENLVSVSEDCTCRVWNIIPNDISGYELQISNIFEGHLLKNVWGVDV- 279

Query: 229 KSESSLRLASCSDDSTVRVWNYVEEEENGEDVWAQE 264
            ++    +A+  +D  + V +   +  +G++V   E
Sbjct: 280 -NDEKRIIATSGNDGRINVIDLNTDTNSGDEVIGYE 314

>AEL314W [2191] [Homologous to ScYJL112W (MDV1) - SH; ScYKR036C
           (CAF4) - SH] complement(52978..55125) [2148 bp, 715 aa]
          Length = 715

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 57/242 (23%), Positives = 92/242 (38%), Gaps = 67/242 (27%)

Query: 73  DSTHKKSVRSVSFR-PHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENE 131
           DS H+ +V  + F  P  ++ +AG  D TI +W          +  + + +A I GH   
Sbjct: 407 DSAHEDNVTCLDFNLPFGTLCSAGKLDPTIKVW----------NLSKNKHVASITGH--- 453

Query: 132 VKAVSWSHSGYY--LASCSRDKSVWIWEA------DELGEEYECLSVLQEHAQDVKHVVW 183
           +  VS      Y  L +  RD  + +W+       D +  +  C+     H  ++  + +
Sbjct: 454 LATVSCMQMDQYNTLITGGRDALLKMWDIQKAIDNDSIPSDEVCIYTFDSHIDEITALSF 513

Query: 184 HSEMHLLASSSYDDTIRLWKEDADDWECAAVL-----------------------NGHK- 219
             E + L S S D TIR W  D ++ +C   L                       N H  
Sbjct: 514 --EANNLVSGSQDRTIRQW--DLNNGKCVQTLDINFATGGNLSRSMIGSGFLNTNNDHPI 569

Query: 220 -GTVWCSDFEKSESSLRLASCSDDSTVRVWNYVEEEENGEDVWAQEAILPNVHSRAVYSV 278
            G + C D         LA+ + D  VR+W+      +G  V   E      HS AV S+
Sbjct: 570 IGAIQCYD-------AALATGTKDGIVRLWDL----RSGRVVRTLEG-----HSDAVTSL 613

Query: 279 SW 280
            +
Sbjct: 614 QF 615

 Score = 35.8 bits (81), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 39/178 (21%), Positives = 75/178 (42%), Gaps = 28/178 (15%)

Query: 90  SILAAGSFDSTISIWGKEEDADPQDDFPETEL-LAIIEGHENEVKAVSWSHSGYYLASCS 148
           + L  G  D+ + +W  ++  D  D  P  E+ +   + H +E+ A+S+  +   L S S
Sbjct: 466 NTLITGGRDALLKMWDIQKAID-NDSIPSDEVCIYTFDSHIDEITALSFEANN--LVSGS 522

Query: 149 RDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEM-----------------HLLA 191
           +D+++  W+ +  G+  + L +      ++   +  S                     LA
Sbjct: 523 QDRTIRQWDLNN-GKCVQTLDINFATGGNLSRSMIGSGFLNTNNDHPIIGAIQCYDAALA 581

Query: 192 SSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWN 249
           + + D  +RLW  D         L GH   V    F+    SL L + S D+++R+W+
Sbjct: 582 TGTKDGIVRLW--DLRSGRVVRTLEGHSDAVTSLQFD----SLNLVTGSLDNSIRIWD 633

>YGR200C (ELP2) [2150] chr7 complement(899907..902273) 90 kDa
           subunit of elongator and elongating RNA polymerase II
           holoenzyme, has WD (WD-40) repeats [2367 bp, 788 aa]
          Length = 788

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 63/273 (23%), Positives = 102/273 (37%), Gaps = 46/273 (16%)

Query: 66  QLVEELDDSTHKKSVRSVSFR----PHSSILAAGSFDSTISIWGKEEDA---DPQDDFPE 118
           ++V EL+   H+  V+S++FR    P   +L +GS D  I +W    +    D ++D  +
Sbjct: 193 RVVAELEG--HEDWVKSLAFRHQETPGDYLLCSGSQDRYIRLWRIRINDLIDDSEEDSKK 250

Query: 119 TELL--------------------AIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEA 158
             LL                    A+I GH++ + ++ W  S   L + + D S+ +WE 
Sbjct: 251 LTLLSNKQYKFQIDDELRVGINFEALIMGHDDWISSLQWHESRLQLLAATADTSLMVWEP 310

Query: 159 DELGEEYECLSVLQEHAQDVKHV-----------VW--HSEMHLLASSSYDDTIRLWKED 205
           DE    + C   L E +                 +W  H  M    ++    + R+W   
Sbjct: 311 DETSGIWVCSLRLGEMSSKGASTATGSSGGFWSCLWFTHERMDFFLTNGKTGSWRMWAT- 369

Query: 206 ADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRV---WNYVEEEENGEDVWA 262
            D+  C   L     T   +D   S S   L + S D T R+   W Y       E    
Sbjct: 370 KDNIICDQRLGISGATKDVTDIAWSPSGEYLLATSLDQTTRLFAPWIYDASGRKREIATW 429

Query: 263 QEAILPNVHSRAVYSVSWSLDGYIASVGSDGLL 295
            E   P +H   +  V    D    S G + +L
Sbjct: 430 HEFSRPQIHGYDMICVETVTDTRFVSGGDEKIL 462

 Score = 38.5 bits (88), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 68/146 (46%), Gaps = 17/146 (11%)

Query: 91  ILAAGSFDSTISIWGKEEDADPQDDFPETE-LLAIIEGHENEVKAVSWSHSGYYLASCSR 149
           I+A G+   TI++W      DP +  P  + + A ++GHE EV  V +     ++ S S 
Sbjct: 29  IVAFGA-GKTIALW------DPIE--PNNKGVYATLKGHEAEVTCVRFVPDSDFMVSASE 79

Query: 150 DKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDA--D 207
           D  V IW+  +     +C+  +Q +++ +  V   +   L++    D TI +W+++   D
Sbjct: 80  DHHVKIWKFTDYS-HLQCIQTIQHYSKTI--VALSALPSLISVGCADGTISIWRQNIQND 136

Query: 208 DWECAAVLNGHKGTVW--CSDFEKSE 231
           ++  A      KG  +  C    K E
Sbjct: 137 EFGLAHEFTIKKGFFYPLCLSLSKVE 162

 Score = 35.0 bits (79), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 65/283 (22%), Positives = 114/283 (40%), Gaps = 56/283 (19%)

Query: 45  LMATSSSDRKIKLVNLKNMDFQLVEELDDSTH-KKSVRSVSFRPHSSILAAGSFDSTISI 103
            M ++S D  +K+   K  D+  ++ +    H  K++ ++S  P  S+++ G  D TISI
Sbjct: 73  FMVSASEDHHVKI--WKFTDYSHLQCIQTIQHYSKTIVALSALP--SLISVGCADGTISI 128

Query: 104 WGKEEDADPQDDFPETELLAIIEGHENEVKAVSWS---HSGYYLASCSRDKSVWIWE--- 157
           W +       D+F       I +G    +  +S S      Y LA    + +V+I     
Sbjct: 129 WRQNIQ---NDEFGLAHEFTIKKGFFYPL-CLSLSKVEEKKYLLAIGGTNVNVFIASFIL 184

Query: 158 ADELGEEYECLSVLQEHAQDVKHVVW-HSEM---HLLASSSYDDTIRLWKEDADDW---- 209
           +D   E+   ++ L+ H   VK + + H E    +LL S S D  IRLW+   +D     
Sbjct: 185 SDSGIEKCRVVAELEGHEDWVKSLAFRHQETPGDYLLCSGSQDRYIRLWRIRINDLIDDS 244

Query: 210 ---------------------------ECAAVLNGHKGTVWCSDFEKSESSLRLASCSDD 242
                                         A++ GH    W S  +  ES L+L + + D
Sbjct: 245 EEDSKKLTLLSNKQYKFQIDDELRVGINFEALIMGHDD--WISSLQWHESRLQLLAATAD 302

Query: 243 STVRVWNYVEEEENGEDVWAQEAILPNVHSRAVYSVSWSLDGY 285
           +++ VW    E +    +W     L  + S+   + + S  G+
Sbjct: 303 TSLMVW----EPDETSGIWVCSLRLGEMSSKGASTATGSSGGF 341

 Score = 32.3 bits (72), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 39/168 (23%), Positives = 66/168 (39%), Gaps = 13/168 (7%)

Query: 117 PETELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEE--YECLSVLQEH 174
           PE E L    GH  E+  +  S     +AS  R  +V          E   E    L  H
Sbjct: 549 PEVEKLY---GHGFEITCLDISPDQKLIASACRSNNVQNAVIRIFSTENWLEIKPALPFH 605

Query: 175 AQDVKHVVWHSEMHLLASSSYDDTIRLWKEDADDWECAAVLNG---HKGTVWCSDFEKSE 231
           +  +  + +  +   L S   D    LW+ + +D            H   +W +D+   E
Sbjct: 606 SLTITRLKFSKDGKFLLSVCRDRKWALWERNMEDNTFELRFKNEKPHTRIIWDADWAPLE 665

Query: 232 SSLRLASCSDDSTVRVWNYVEEEENGEDVWAQEAILPNVHSRAVYSVS 279
                 + S D TV+VW +  ++E  +D   + +I    H++AV ++S
Sbjct: 666 FGNVFVTASRDKTVKVWRH--QKEPADDYVLEASI---KHTKAVTAIS 708

>CAGL0L09647g 1032740..1034029 highly similar to sp|P35184
           Saccharomyces cerevisiae YIR012w SQT1, start by
           similarity
          Length = 429

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/187 (21%), Positives = 81/187 (43%), Gaps = 25/187 (13%)

Query: 76  HKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAV 135
           H  SV  V+  P   ++A+G  D+ I +W               +    + GH   V A 
Sbjct: 63  HTDSVFVVAHHPSLPLVASGGADNVIHLWTSHSQP--------PKFAGTLSGHTESVIAA 114

Query: 136 SWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVW---HSEMH-LLA 191
            ++  G +L S      + +  + + G +++ +S LQE    V+ ++W   H ++    A
Sbjct: 115 HFTPDGKFLVSADMTGKLLVHASVKGGAQWKLVSELQE----VEEIIWLKVHPKVSGAFA 170

Query: 192 SSSYDDTIRLWKEDADDWECAA--VLNGHKGTVWCS-----DFEKSE--SSLRLASCSDD 242
             + D ++  ++ + +        +++G      C+     + EKSE   +L L +CS D
Sbjct: 171 LGATDGSVWCYQINGEGASATVEQLMSGFSHQSECTMGEFINIEKSEELGTLDLVTCSLD 230

Query: 243 STVRVWN 249
           S++  WN
Sbjct: 231 SSIVSWN 237

 Score = 33.9 bits (76), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 34/80 (42%), Gaps = 9/80 (11%)

Query: 157 EADELGEEYECLSV---------LQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDAD 207
           EA E GE  E + V           +H   V  V  H  + L+AS   D+ I LW   + 
Sbjct: 37  EAMEGGEVEETIEVDLSNNSRTYFDKHTDSVFVVAHHPSLPLVASGGADNVIHLWTSHSQ 96

Query: 208 DWECAAVLNGHKGTVWCSDF 227
             + A  L+GH  +V  + F
Sbjct: 97  PPKFAGTLSGHTESVIAAHF 116

>KLLA0F10791g complement(991642..993279) similar to sp|P26309
           Saccharomyces cerevisiae YGL116w CDC20 cell division
           control protein, hypothetical start
          Length = 545

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 45/177 (25%), Positives = 77/177 (43%), Gaps = 22/177 (12%)

Query: 126 EGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHS 185
           E H+ EV  +S+   G  LAS + D +V IW+     +  + +   + H   VK + WH 
Sbjct: 330 ERHQGEVCGLSFREDGIQLASGANDNTVMIWDTR---QNNDPIWTKRNHKAAVKAISWHP 386

Query: 186 EM-HLLAS--SSYDDTIRLWKEDADDWECAAVLNGHKGTV--WCSDFEK----SESSLRL 236
           E+ +LLA+   S D  I  W     +     +  G + +   W   + K     ++ +  
Sbjct: 387 EITNLLATGGGSLDKHIHFWNTTTGN-RLGTIDTGSQVSSLHWGQSYSKHSGCMDTEIVA 445

Query: 237 ASCSDDSTVRVWNYVEEEENGEDVWAQEAILPNVHSRAVYSVSWSLDG-YIASVGSD 292
              + ++ + ++NY  + +  E    Q+A     H   + S   S DG  IASVG D
Sbjct: 446 TGGTPNNCITIYNYETKFKVAE---IQQA-----HDSRIVSSQLSPDGTTIASVGGD 494

 Score = 35.4 bits (80), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 43/93 (46%), Gaps = 14/93 (15%)

Query: 45  LMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSVSFRPHSSILAAGSFDSTISIW 104
           +  + S + +I  V +KN   Q  E      H+  V  +SFR     LA+G+ D+T+ IW
Sbjct: 306 VTGSKSGEIQINDVRIKNHVVQTWER-----HQGEVCGLSFREDGIQLASGANDNTVMIW 360

Query: 105 GKEEDADPQDDFPETELLAIIEGHENEVKAVSW 137
              ++ DP         +     H+  VKA+SW
Sbjct: 361 DTRQNNDP---------IWTKRNHKAAVKAISW 384

>Sklu_2092.4 YMR131C, Contig c2092 3964-5526
          Length = 520

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 47/189 (24%), Positives = 86/189 (45%), Gaps = 25/189 (13%)

Query: 127 GHENEVKAVSWSHS-GYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHS 185
            +   V+ + WS +     ASC  D  + +W  D   ++++    ++    DV  + W  
Sbjct: 328 ANNQSVEDIQWSRTESTVFASCGCDGYIRVW--DTRSKKHKPAISVKASNTDVNVISWSE 385

Query: 186 EM-HLLASSSYDDTIRLW------KEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLAS 238
           ++ +LLAS   + T  +W        ++++    A  + HKG +    F   + S+ +A 
Sbjct: 386 KIGYLLASGDDNGTWGVWDLRQFSPSNSNNTSPVAQYDFHKGAITSISFNPLDESI-VAV 444

Query: 239 CSDDSTVRVWNYVEEEENGEDVWAQEA-------ILPN---VH-SRAVYSVSW--SLDGY 285
            S+D+TV +W+ +  E + E++  Q A       I P    VH  + V  V W   + G 
Sbjct: 445 ASEDNTVTLWD-LSVEADDEEIKQQAAETKELQQIPPQLLFVHWQKEVKDVKWHRQIPGC 503

Query: 286 IASVGSDGL 294
           + S G+DGL
Sbjct: 504 LVSTGTDGL 512

 Score = 31.6 bits (70), Expect = 1.00,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 37/72 (51%), Gaps = 10/72 (13%)

Query: 76  HKKSVRSVSFRP-HSSILAAGSFDSTISIWGKEEDADPQD---DFPETELLAIIEGH--- 128
           HK ++ S+SF P   SI+A  S D+T+++W    +AD ++      ET+ L  I      
Sbjct: 425 HKGAITSISFNPLDESIVAVASEDNTVTLWDLSVEADDEEIKQQAAETKELQQIPPQLLF 484

Query: 129 ---ENEVKAVSW 137
              + EVK V W
Sbjct: 485 VHWQKEVKDVKW 496

>KLLA0E11143g 983669..985150 similar to sp|Q04199 Saccharomyces
           cerevisiae YML102w CAC2 chromatin assembly complex,
           subunit p60, start by similarity
          Length = 493

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/186 (23%), Positives = 77/186 (41%), Gaps = 21/186 (11%)

Query: 46  MATSSSDRKIKLVNLKNMD----FQLVEELDDST-HKKSVRSVSFRPHSSILAAGSFDST 100
           + TS  D KI++  L   +     + ++ L   T H+++V    F      LA    D  
Sbjct: 35  LFTSGGDNKIRVWQLNESENDGKIETIDFLSSLTQHEQAVNVCRFNKQGDTLATAGDDGL 94

Query: 101 ISIWGKEE--------DADPQDDFPET----ELLAIIEGHENEVKAVSWSHSGYYLASCS 148
           + +W K E        D D   DF E+    + L        E+  +SW+  G  +A  S
Sbjct: 95  LLLWKKNETMVKEFGVDDDEFQDFKESWAVWKRLRSGSASNAEIYDISWNPQGTCIAIAS 154

Query: 149 RDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDADD 208
            D +V ++  D+     + +  + EH   V+ +VW  +   + S S D ++ + K   +D
Sbjct: 155 LDNTVRVFNVDQ----GKVVGHITEHNHYVQGIVWDPQGEFIVSQSADRSLAICKMIYED 210

Query: 209 WECAAV 214
            E   +
Sbjct: 211 NEVKGL 216

>CAGL0A00605g complement(67281..69203) similar to sp|P53197
           Saccharomyces cerevisiae YGL003c CDH1 substrate-specific
           activator of APC-dependent proteolysis, hypothetical
           start
          Length = 640

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/131 (25%), Positives = 61/131 (46%), Gaps = 16/131 (12%)

Query: 76  HKKSVRSVSFRPH-SSILA--AGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEV 132
           HK +V+++++ PH   ILA   G+ D T+ +W         D    +++  ++     + 
Sbjct: 500 HKAAVKAMAWSPHKQGILATGGGTADRTLKMWNVNTSVKLNDVDTGSQVCNMVWSTNTDE 559

Query: 133 KAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLAS 192
              S  +S Y L          IWEA  L    E L++L+ H+  V H+   ++   + S
Sbjct: 560 IVTSHGYSKYNLT---------IWEASNL----EPLAILKGHSFRVLHLTLSADGTTIVS 606

Query: 193 SSYDDTIRLWK 203
            + D+T+R WK
Sbjct: 607 GAGDETLRYWK 617

 Score = 38.1 bits (87), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 52/115 (45%), Gaps = 16/115 (13%)

Query: 91  ILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLASCSRD 150
           IL++GS D TI +      ADP            IE HE E+  + W+ +   LAS   D
Sbjct: 430 ILSSGSRDRTI-LHRDVRMADP--------FFEKIETHEQEICGLKWNTNDNKLASGGND 480

Query: 151 KSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHS-EMHLLAS--SSYDDTIRLW 202
             V++++    G        + EH   VK + W   +  +LA+   + D T+++W
Sbjct: 481 NMVFVYD----GTSRTPFLSINEHKAAVKAMAWSPHKQGILATGGGTADRTLKMW 531

>ACR097W [1144] [Homologous to ScYOR212W (STE4) - SH]
           complement(529784..531187) [1404 bp, 467 aa]
          Length = 467

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 52/230 (22%), Positives = 99/230 (43%), Gaps = 22/230 (9%)

Query: 122 LAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHV 181
           +  ++GH N+V +  WS     + S S+D  + +W+A   G +   + +   H+Q V   
Sbjct: 120 VTTLKGHNNKVSSFRWSSDSRTILSASQDGFMLLWDA-ATGLKSNAIPL---HSQWVLSC 175

Query: 182 VWHSEMHLLASSSYDDTI---RLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLAS 238
                 +L+AS+  D+     R+ ++D       ++  GH  T + S+ E  + +  + +
Sbjct: 176 AICPNGNLVASAGLDNNCTIYRVSRKDRIQQNIVSIFKGH--TCYISEIEFLDDN-SILT 232

Query: 239 CSDDSTVRVWNYVEEEENGEDVWAQEAILPNVHSRAVYSVSWSLDGYI-ASVGSDGLLXX 297
            S D T  +W+  + +   E  +A    L +V S +        +G + AS GSDG L  
Sbjct: 233 ASGDMTCALWDITKSKRINE--FADH--LGDVLSLSAAPTETEGNGNVFASGGSDGYLYI 288

Query: 298 XXXXXXXXXXXXXQQHEAHGIYEINVVKWATVDDSVLLLTGGDDGCANIW 347
                           ++  + + +V K     +   + TG DDGC N++
Sbjct: 289 WDKRVPTSV-------QSFFVSDSDVSKVKFFRNGNTIATGSDDGCTNLY 331

>YER082C (UTP7) [1514] chr5 complement(324268..325932) Component of
           U3 snoRNP (also called small subunit processome), which
           is required for 18S rRNA biogenesis, has one WD (WD-40)
           domain [1665 bp, 554 aa]
          Length = 554

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 41/166 (24%), Positives = 70/166 (42%), Gaps = 24/166 (14%)

Query: 66  QLVEELDDSTHKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAII 125
           QLV EL   T      +++  P ++++  G  + T+S+W       P    P  +LL+  
Sbjct: 223 QLVSEL--RTKAGPTMAMAQNPWNAVMHLGHSNGTVSLW------SPSMPEPLVKLLSA- 273

Query: 126 EGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHS 185
                 V +++   SGYY+A+   D+S+ IW+     + +   S+           V  S
Sbjct: 274 ---RGPVNSIAIDRSGYYMATTGADRSMKIWDIRNFKQLHSVESLPTPGTN-----VSIS 325

Query: 186 EMHLLASSSYDDTIRLWKE----DADDWECAAVLNG--HKGTVWCS 225
           +  LLA S     + LWK+      D   C   + G  H+ T + S
Sbjct: 326 DTGLLALSR-GPHVTLWKDALKLSGDSKPCFGSMGGNPHRNTPYMS 370

>Sklu_1963.2 YBR175W, Contig c1963 4075-5019 reverse complement
          Length = 314

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 46/189 (24%), Positives = 79/189 (41%), Gaps = 30/189 (15%)

Query: 74  STHKKSVRSVSFRPHSSILAAGSFDSTISI----WGKEEDADPQDDFPETELLAIIEGHE 129
           ++H +S+  + + P S  +A  S D TI I    +G+               L  + GH 
Sbjct: 53  TSHVESMSDICWSPDSQCIATASDDFTIEINHITYGR---------------LHRLVGHT 97

Query: 130 NEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHL 189
             V ++ ++  G  L S S D+S+ IW+    G   + +S   E    +   V   +  +
Sbjct: 98  APVLSLVYTSKGNLLCSASMDESIKIWDV-LTGTLLKTISAHSEPVVSIDMPV--CDPSI 154

Query: 190 LASSSYDDTIRLWKEDADDWECAAVLNGHK------GTVWCSDFEKSESSLRLASCSDDS 243
           L+S SYD  IR++  D     C   L   K      G V  S  + S +   L   S D 
Sbjct: 155 LSSGSYDGLIRIF--DTTTGHCLKTLTYDKDWKSENGVVPISQVKFSVNGKYLLVKSLDG 212

Query: 244 TVRVWNYVE 252
            +++W+++ 
Sbjct: 213 VLKIWDFIR 221

>Scas_693.36
          Length = 375

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 46/197 (23%), Positives = 84/197 (42%), Gaps = 33/197 (16%)

Query: 77  KKSVRSVSFRPH-SSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAV 135
           K  +    F PH  ++L   S DS  +I+   +  + Q +F     + ++    N+ +  
Sbjct: 184 KDCIYQSQFSPHDPNLLICCSGDSYTTIFDLRDPYNTQRNFLSHAGMEVLSADFNKYRP- 242

Query: 136 SWSHSGYYLASCSRDKSVWIWEADEL--GEEYECLS-VLQEHAQDVKHVVW---HSEMHL 189
                   LA+   D S+ IW+   L   +   C++ ++  H   V+ VVW   HS+  +
Sbjct: 243 ------NVLATAGVDNSIRIWDFRMLVARDAAICINEIVNAHDLAVRKVVWSPHHSD--I 294

Query: 190 LASSSYDDTIRLW--------------KEDADDWE---CAAVLNGHKGTVWCSDFEKSES 232
           L S+SYD + ++W              K ++ D+    C  ++N H   V+ +D+     
Sbjct: 295 LLSTSYDMSCKIWNDLSYDPIQQRKTGKTNSLDFTGNGCRFIMNQHTEFVFGADWSMWGQ 354

Query: 233 SLRLASCSDDSTVRVWN 249
              +AS   D  V +WN
Sbjct: 355 PGYVASTGWDGNVFIWN 371

>AFL056C [3137] [Homologous to ScYPL183C - SH] (329216..332146)
           [2931 bp, 976 aa]
          Length = 976

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 58/124 (46%), Gaps = 7/124 (5%)

Query: 125 IEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWH 184
           +EGHE  +     S  G  +ASCS D+S+ +W   E GE+   + +   H   +  + + 
Sbjct: 177 LEGHEGSIFCAVVSDDGRLVASCSDDRSIRVWSL-ETGEQ---VGIAWGHTARIWDLRFL 232

Query: 185 SEMHLLASSSYDDTIRLWKEDADDWECAAVLNGHKG-TVWCSDFEKSESSLRLASCSDDS 243
                L S S D T R+W   A+  +  AV + H+  +VW  D +  E  +   +  +D 
Sbjct: 233 RVADKLVSVSEDCTCRVWAVGAERMQEEAVYDVHQTKSVWAVDVQ--EDDMVAVTAGNDG 290

Query: 244 TVRV 247
            +R+
Sbjct: 291 RLRL 294

 Score = 36.6 bits (83), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 29/46 (63%), Gaps = 6/46 (13%)

Query: 215 LNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNYVEEEENGEDV 260
           L GH+G+++C+    S+    +ASCSDD ++RVW+     E GE V
Sbjct: 177 LEGHEGSIFCAVV--SDDGRLVASCSDDRSIRVWSL----ETGEQV 216

>KLLA0E07942g 717476..718648 similar to sp|P20484 Saccharomyces
           cerevisiae YKL021c MAK11 involved in cell growth and
           replication of M1 dsRNA virus singleton, start by
           similarity
          Length = 390

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 60/128 (46%), Gaps = 18/128 (14%)

Query: 140 SGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWH-------SEMHL--- 189
           S  YL S S D+++ I++  +  E    L  L  H   + ++ +         ++ L   
Sbjct: 50  SKRYLVSGSNDENIRIYDLQKRKE----LGTLLGHQGSITNLRFSRGKDADGQDIQLNKW 105

Query: 190 LASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWN 249
           L S+S D  I +W+    DWE    L GH  T   +DF+   S+    S S+D ++R+WN
Sbjct: 106 LLSASEDHKIIVWR--VKDWENFGTLKGH--TARINDFDIHPSNRVAVSVSEDHSIRLWN 161

Query: 250 YVEEEENG 257
            +  ++ G
Sbjct: 162 LMTVKKAG 169

>Kwal_26.8975
          Length = 445

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 46/90 (51%), Gaps = 9/90 (10%)

Query: 76  HKKSVRSVSFRPHSSILAAGSFDSTISIWGKEED------ADPQDDFPETELLAIIEGHE 129
           H  +VR+V +   S+ L +G+ D T+ +W  + D      A  +DD  E + LAI+E H+
Sbjct: 140 HSGAVRAVKY-ISSTRLVSGANDRTLRLWKTKNDELKNNLAAEEDDVEEGKTLAILEAHK 198

Query: 130 NEVKAVSWSHSGYYLASCSRDKSVWIWEAD 159
             V  V+   SG  + S S D S+  W  +
Sbjct: 199 APV--VTVDVSGDRIISGSYDNSIGFWSTN 226

 Score = 32.3 bits (72), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 72/296 (24%), Positives = 113/296 (38%), Gaps = 68/296 (22%)

Query: 46  MATSSSDRKIKLVNLKNMDFQ--LVEELDD----------STHKKSVRSVSFRPHSSILA 93
           + + ++DR ++L   KN + +  L  E DD            HK  V +V       I  
Sbjct: 155 LVSGANDRTLRLWKTKNDELKNNLAAEEDDVEEGKTLAILEAHKAPVVTVDVSGDRII-- 212

Query: 94  AGSFDSTISIWG---KEEDA-DPQDDFPET---------------------ELLAIIEGH 128
           +GS+D++I  W    KE  A DP D                            LA++E H
Sbjct: 213 SGSYDNSIGFWSTNHKEMTAVDPMDALGSNVSSAAKKRRRLALKDGSVRRRSPLALLESH 272

Query: 129 ENEVKAVSWSHS----GYYLASCSRDKSVWIWE------ADELGEEYECLSVLQEHAQDV 178
              V+ V +  +    GY   S S+D ++  W+       D     Y  LS+ Q      
Sbjct: 273 TAPVEEVLFDFADKTVGY---SVSQDHTIKTWDLVTARCVDTKSTSYSLLSLAQ------ 323

Query: 179 KHVVWHSEMHLLA--SSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRL 236
                  +++LLA  SS+   T+   +  +        LNGHK  V   D    E    L
Sbjct: 324 -----LPQLNLLACGSSARHITLHDPRVGSSTKITQQQLNGHKNFVVALD-TCPEMEYML 377

Query: 237 ASCSDDSTVRVWNYVEEEENGEDVWAQEAILPNVHSRAVYSVSWSLDGYIASVGSD 292
            S S D TV+VW+ V        +  +  ++  ++ + V+ V W+    I S G D
Sbjct: 378 CSGSHDGTVKVWD-VRSSAPMYTITREAEVVKGINDK-VFDVKWAKGLGIISGGQD 431

 Score = 31.6 bits (70), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 45/106 (42%), Gaps = 15/106 (14%)

Query: 190 LASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVW- 248
           + S SYD  +R W       +  A   GH G V    +    SS RL S ++D T+R+W 
Sbjct: 115 IVSGSYDGIVRTWNLSGKVEKQYA---GHSGAVRAVKYI---SSTRLVSGANDRTLRLWK 168

Query: 249 -------NYVEEEENGEDVWAQEAILPNVHSRAVYSVSWSLDGYIA 287
                  N +  EE+  +     AIL   H   V +V  S D  I+
Sbjct: 169 TKNDELKNNLAAEEDDVEEGKTLAIL-EAHKAPVVTVDVSGDRIIS 213

 Score = 31.2 bits (69), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 54/118 (45%), Gaps = 5/118 (4%)

Query: 45  LMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSVSFRPHSS-ILAAGSFDSTISI 103
           L+A  SS R I L + +      + +   + HK  V ++   P    +L +GS D T+ +
Sbjct: 329 LLACGSSARHITLHDPRVGSSTKITQQQLNGHKNFVVALDTCPEMEYMLCSGSHDGTVKV 388

Query: 104 WGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADEL 161
           W     A       E E   +++G  ++V  V W+  G  + S  +DK + I + D++
Sbjct: 389 WDVRSSAPMYTITREAE---VVKGINDKVFDVKWAK-GLGIISGGQDKKIQINKGDDI 442

>ACL034W [1015] [Homologous to ScYER082C (KRE31) - SH]
           complement(302396..304048) [1653 bp, 550 aa]
          Length = 550

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 40/139 (28%), Positives = 62/139 (44%), Gaps = 18/139 (12%)

Query: 66  QLVEELDDSTHKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAII 125
           QLV EL   T      S++  P ++++  G  + T+++W       P    P    LA I
Sbjct: 221 QLVAEL--RTKLGPTSSMAQNPWNAVMHLGHNNGTVTLWA------PNMPTP----LARI 268

Query: 126 EGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHS 185
                 V  V+    GYY+A+   DKS+ +W+     +E   +  L   A +VK     S
Sbjct: 269 LTARGPVTGVAVDRQGYYMATTGADKSMRLWDIRNF-KELHSVENLPIPASNVK----IS 323

Query: 186 EMHLLASSSYDDTIRLWKE 204
           +M LLA S     + LWK+
Sbjct: 324 DMGLLAVSR-GPHVTLWKD 341

>YER066W (YER066W) [1497] chr5 (290240..290797) Protein containing
           three WD domains (WD-40 repeat), which may mediate
           protein-protein interactions, has high similarity to a
           region of S. cerevisiae Cdc4p, which is a component of
           the SCF-Cdc4p complex involved in ubiquitin-dependent
           degradation [558 bp, 185 aa]
          Length = 185

 Score = 38.5 bits (88), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 41/85 (48%), Gaps = 5/85 (5%)

Query: 210 ECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNYVEEEENGEDVWAQEAILPN 269
           +C  +L+GH   ++ + ++      R  S S D+T+R+W+      NGE  +A  +  P 
Sbjct: 2   KCLYILSGHTDRIYSTIYDHERK--RCISASMDTTIRIWDLENIRNNGECSYATNSASP- 58

Query: 270 VHSRAVYSVSWSLDGYIASVGSDGL 294
                +    ++L G+ A VG  GL
Sbjct: 59  --CAKILGAMYTLRGHRALVGLLGL 81

 Score = 30.4 bits (67), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 24/101 (23%), Positives = 41/101 (40%), Gaps = 20/101 (19%)

Query: 166 ECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLW--KEDADDWECAAVLNGHKGTVW 223
           +CL +L  H   +   ++  E     S+S D TIR+W  +   ++ EC+   N       
Sbjct: 2   KCLYILSGHTDRIYSTIYDHERKRCISASMDTTIRIWDLENIRNNGECSYATNSASP--- 58

Query: 224 CSDFEKSESSLR---------------LASCSDDSTVRVWN 249
           C+    +  +LR               L S S D ++R W+
Sbjct: 59  CAKILGAMYTLRGHRALVGLLGLSDKFLVSASVDGSIRCWD 99

 Score = 28.5 bits (62), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 12/46 (26%), Positives = 22/46 (47%)

Query: 122 LAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYEC 167
           L I+ GH + + +  + H      S S D ++ IW+ + +    EC
Sbjct: 4   LYILSGHTDRIYSTIYDHERKRCISASMDTTIRIWDLENIRNNGEC 49

>Scas_642.1
          Length = 934

 Score = 39.7 bits (91), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 53/98 (54%), Gaps = 9/98 (9%)

Query: 27  KSLKLHTDKLWSIDCSK------GLMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSV 80
           K+L  +TD++W +  S          A S++DRKI + +++N DFQ+ + L  + +K+ V
Sbjct: 711 KTLVQNTDEIWYLQFSPDGKYLASASADSTTDRKILIYDVEN-DFQVYKIL--AGNKQCV 767

Query: 81  RSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPE 118
             +SF P S  L +  F+ + +I+      +P +  PE
Sbjct: 768 LYLSFSPDSKYLVSCPFNESANIYDIHIKGEPSNINPE 805

 Score = 32.7 bits (73), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 57/122 (46%), Gaps = 19/122 (15%)

Query: 52  DRKIKLVNL---KNMDFQLVEELDDSTHKKSVRSV---SFRPHSSILAAGSFDST----I 101
           ++  K+ NL      DF  +  +++ T  ++   +    F P    LA+ S DST    I
Sbjct: 686 EKTPKIFNLLQDNTTDFNEINFIEEKTLVQNTDEIWYLQFSPDGKYLASASADSTTDRKI 745

Query: 102 SIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADEL 161
            I+      D ++DF   ++  I+ G++  V  +S+S    YL SC  ++S  I++    
Sbjct: 746 LIY------DVENDF---QVYKILAGNKQCVLYLSFSPDSKYLVSCPFNESANIYDIHIK 796

Query: 162 GE 163
           GE
Sbjct: 797 GE 798

>Kwal_55.21450
          Length = 503

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 65/141 (46%), Gaps = 12/141 (8%)

Query: 120 ELLAIIEGHENEVKAVSW-SHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDV 178
           +L+    GH+N   ++     SG+   S   D  V IW+   L  + E L   + H++ V
Sbjct: 201 KLIHTYPGHKNGTNSILLLPKSGHLCLSAGNDNQVKIWD---LYRDRELLRDYRGHSKAV 257

Query: 179 KHVVWHSEMHLLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVW--CSDFEKSESSLRL 236
           + + ++SE     S S+D  I++W     D E   V + +  +    C++F  S S+  +
Sbjct: 258 RGISFNSEGSEFLSVSFDQQIKIW-----DTETGKVRHQYSYSCIPNCAEFRPSNSNEFI 312

Query: 237 ASCSDDSTVRVWNYVEEEENG 257
              S +S +R ++     +NG
Sbjct: 313 VGLS-NSEIRHYDLRTSHKNG 332

 Score = 36.2 bits (82), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 54/253 (21%), Positives = 100/253 (39%), Gaps = 42/253 (16%)

Query: 33  TDKLWSIDCSKGLMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSVSFRPHSSIL 92
           T+ +  +  S  L  ++ +D ++K+ +L   D +L+   D   H K+VR +SF    S  
Sbjct: 213 TNSILLLPKSGHLCLSAGNDNQVKIWDLYR-DRELLR--DYRGHSKAVRGISFNSEGSEF 269

Query: 93  AAGSFDSTISIW----GK--------------EEDADPQDDF-----------------P 117
            + SFD  I IW    GK              E      ++F                  
Sbjct: 270 LSVSFDQQIKIWDTETGKVRHQYSYSCIPNCAEFRPSNSNEFIVGLSNSEIRHYDLRTSH 329

Query: 118 ETELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQD 177
           +  L+ + + H + + A+ +   G    S S DKS+ IWE +++    + +S   +++  
Sbjct: 330 KNGLVQVYDHHLSSIIALKYFPDGSKFVSSSEDKSMRIWE-NQINIPIKQISDTSQYS-- 386

Query: 178 VKHVVWHSEMHLLASSSYDDTIRLWKEDAD-DWECAAVLNGHKGTVWCSDFEKSESSLRL 236
           + ++  H E +  A+ S D+ I  +              +GHK   +   F  S     +
Sbjct: 387 MPYIGIHPEQNYFAAQSMDNAIYAFSMKPKYKRHPKKHFSGHKCAGFGIGFGFSPDGQYI 446

Query: 237 ASCSDDSTVRVWN 249
           AS      V +W+
Sbjct: 447 ASGDTRGRVYIWD 459

 Score = 35.4 bits (80), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 46/105 (43%), Gaps = 18/105 (17%)

Query: 76  HKKSVRSVSFRPHSS--ILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVK 133
           HK    S+   P S    L+AG+ D+ + IW         D + + ELL    GH   V+
Sbjct: 209 HKNGTNSILLLPKSGHLCLSAGN-DNQVKIW---------DLYRDRELLRDYRGHSKAVR 258

Query: 134 AVSWSHSGYYLASCSRDKSVWIWEADELGE-----EYECLSVLQE 173
            +S++  G    S S D+ + IW+  E G+      Y C+    E
Sbjct: 259 GISFNSEGSEFLSVSFDQQIKIWDT-ETGKVRHQYSYSCIPNCAE 302

>Kwal_56.23685
          Length = 1102

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 59/130 (45%), Gaps = 10/130 (7%)

Query: 124 IIEGHENEVKAVSWSHS-GYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVV 182
           ++ GH   +  +++  +    LA+CS D  V  W+       Y   SV    A  VK   
Sbjct: 109 VLHGHSRAITDINFHPTHPEILATCSIDAYVHAWDMRSPRRAYYSASVWSAGASQVK--- 165

Query: 183 WHSEMHLLASSSYDDTIRLWKEDADDWECAA--VLNGHKGTVWCSDFEKSESSLRLASCS 240
           W+ +   + +S++ + + +W        C    VL GH  +V   DF K + +  + S S
Sbjct: 166 WNYKNSNVMASAHSNDVYIWDLRKG---CTPLHVLQGHVNSVNSIDFSKFDET-EIMSSS 221

Query: 241 DDSTVRVWNY 250
           +D TV+ W+Y
Sbjct: 222 NDGTVKFWDY 231

 Score = 36.6 bits (83), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 43/180 (23%), Positives = 75/180 (41%), Gaps = 17/180 (9%)

Query: 34  DKLWSIDCSKGLMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSVSFRP-HSSIL 92
           D  WS   SK     S+S++K  L NL       +E +    H +++  ++F P H  IL
Sbjct: 72  DVQWSPHPSKPSWVISTSNQKALLWNLSRNSSDAIEHVLHG-HSRAITDINFHPTHPEIL 130

Query: 93  AAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLASCSRDKS 152
           A  S D+ +  W       P+  +    + +           V W++    + + +    
Sbjct: 131 ATCSIDAYVHAWDMR---SPRRAYYSASVWSA------GASQVKWNYKNSNVMASAHSND 181

Query: 153 VWIWEADELGEEYECLSVLQEHAQDVKHVVWHS--EMHLLASSSYDDTIRLWKEDADDWE 210
           V+IW+   L +    L VLQ H   V  + +    E  +++SS+ D T++ W     D E
Sbjct: 182 VYIWD---LRKGCTPLHVLQGHVNSVNSIDFSKFDETEIMSSSN-DGTVKFWDYSLSDKE 237

>CAGL0D02090g join(214357..214893,215564..215860) highly similar to
           sp|P38011 Saccharomyces cerevisiae YMR116c ASC1
          Length = 277

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 36/144 (25%), Positives = 59/144 (40%), Gaps = 33/144 (22%)

Query: 70  ELDDSTHKKSVRSVSFRPHSSILA------------AGSFDSTISIWGKEEDADPQDDFP 117
           +L     K  V   SF+ HS I+             +GS+D T+ +W          D  
Sbjct: 46  KLTGDDQKFGVPVKSFKGHSHIVQDCTLTENGAYALSGSWDKTLRLW----------DVA 95

Query: 118 ETELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQD 177
             E      GH+ +V +V+       + S SRDKS+ +W       + +CL+ L      
Sbjct: 96  TGETFQTFVGHKGDVMSVAIDKKASMIISGSRDKSIKVWSI-----KGDCLATL------ 144

Query: 178 VKHVVWHSEMHLLASSSYDDTIRL 201
           + H  W S++ +  SS  DD + +
Sbjct: 145 IGHNDWVSQVRIANSSDDDDKVTV 168

>AER439W [2939] [Homologous to ScYGL213C (SKI8) - SH]
           complement(1476148..1476150,1476201..1477442) [1245 bp,
           414 aa]
          Length = 414

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 43/158 (27%), Positives = 68/158 (43%), Gaps = 28/158 (17%)

Query: 23  LELLKSLKLHTDKLWS-------IDCS-KGLMATSSSDRKIKLVNLKNM-------DFQL 67
           LEL     LH D   +       +D S K L+AT  SD  + +  L  +        F L
Sbjct: 184 LELQPHFTLHGDLPAASPKFATCVDVSVKNLVATGFSDGSVVIAQLSTLRPIYNFEGFGL 243

Query: 68  VEELDDSTHKKSVRSVSFRPHSSILA----AGSFDSTISIWGKEEDADPQDDFP----ET 119
               D+S    +VR++ F P   +LA    +GSF   ++++ + E  +P           
Sbjct: 244 QGTQDNS---NTVRALKFSPLGGLLAVANDSGSF-GCVTLY-ETEYGEPVGSLTVPMHSN 298

Query: 120 ELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWE 157
           +   +   H   V  +S++ SG YLASC  D  V +W+
Sbjct: 299 QQSIVSVAHSGWVFGLSFNSSGEYLASCGYDAKVRVWD 336

>Sklu_2172.6 YLR129W, Contig c2172 11261-12048 reverse complement
          Length = 263

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 37/163 (22%), Positives = 73/163 (44%), Gaps = 21/163 (12%)

Query: 45  LMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSVSFRPHSSILAAGSFDSTISIW 104
           L+A   +D  IK+ +L +    +    + + HK ++  + F P  + L +GS DS I IW
Sbjct: 89  LLAVGYADGVIKIWDLISKTVLI----NFNGHKSAITVLRFDPTGTRLISGSKDSDIIIW 144

Query: 105 GKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEE 164
                     D      L  +  H++ +  + W  +  +L S S+D  + IW+     + 
Sbjct: 145 ----------DLVGEVGLYKLRSHKDSITGI-WCENEDWLISTSKDGLIKIWDL----KT 189

Query: 165 YECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDAD 207
            +C+     H  +   +  H++  L+ ++S +  I++W  D D
Sbjct: 190 QQCVETHMAHTSECWGLAIHND--LVITTSTESQIKIWNLDLD 230

>Sklu_2364.4 YGL003C, Contig c2364 7265-8932 reverse complement
          Length = 555

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 55/237 (23%), Positives = 99/237 (41%), Gaps = 31/237 (13%)

Query: 26  LKSLKLHTDKLWSIDCSKGLMATSSSDRKI--KLVNLKNMDFQLVEELDDSTHKKSVRSV 83
           +++L  H D++  +  +  ++ + S DRKI  + V +    F+ VE     TH + V  +
Sbjct: 326 IRTLSGHMDRVACLSWNNHILTSGSRDRKILHRDVRMPEPYFEQVE-----THTQEVCGL 380

Query: 84  SFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWS-HSGY 142
            +    + LA+G  D+ + ++         D       L + E H   VKA++WS H   
Sbjct: 381 KWNTDENRLASGGNDNVVYVY---------DGTSRKPTLKLAE-HTAAVKAIAWSPHKRG 430

Query: 143 YLAS--CSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMH-LLASSSYDD-T 198
            LA+   + DK + IW  +   +  +      +    V +++W    + L+ S  Y    
Sbjct: 431 ILATGGGTADKKMKIWNVNTSTKLRDI-----DTGSQVCNMIWSKNTNELVTSHGYSRYN 485

Query: 199 IRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNYVEEEE 255
           + LW  D    E  A+L GH   V       S     + S + D T+R W   +  +
Sbjct: 486 LTLW--DYPSMEPVAILKGHSFRVL--HLTLSADGTTVVSGAGDETLRYWKLFDRPK 538

 Score = 30.0 bits (66), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 35/71 (49%), Gaps = 6/71 (8%)

Query: 129 ENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMH 188
           ENE  +++W  +G +LA    +  V I++      + +C+  L  H   V  + W++  H
Sbjct: 291 ENEYTSINWVGAGSHLAVGQGNGLVEIYDI----VKRKCIRTLSGHMDRVACLSWNN--H 344

Query: 189 LLASSSYDDTI 199
           +L S S D  I
Sbjct: 345 ILTSGSRDRKI 355

>CAGL0L06952g complement(780793..781836) highly similar to sp|P40217
           Saccharomyces cerevisiae YMR146c TIF34 translation
           initiation factor eIF3, start by similarity
          Length = 347

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 48/99 (48%), Gaps = 8/99 (8%)

Query: 170 VLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEK 229
           VL  H + +  V ++ E  LL + S D +  +W   +++ E    L+GH G++W  D   
Sbjct: 5   VLMGHERPLTQVKYNREGDLLFTCSKDISASVWY--SNNGERLGTLDGHMGSIWSID--S 60

Query: 230 SESSLRLASCSDDSTVRVWNYVEEEENGEDVWAQEAILP 268
             +SL   + S D T++VW  +    NG+ V      +P
Sbjct: 61  DHTSLYCVTGSADYTIKVWTLM----NGQCVQTWNCPVP 95

 Score = 31.2 bits (69), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 25/101 (24%), Positives = 45/101 (44%), Gaps = 18/101 (17%)

Query: 124 IIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVW 183
           ++ GHE  +  V ++  G  L +CS+D S  +W ++  GE    L  L  H       +W
Sbjct: 5   VLMGHERPLTQVKYNREGDLLFTCSKDISASVWYSNN-GER---LGTLDGHMGS----IW 56

Query: 184 -----HSEMHLLASSSYDDTIRLWK----EDADDWECAAVL 215
                H+ ++ +  S+ D TI++W     +    W C   +
Sbjct: 57  SIDSDHTSLYCVTGSA-DYTIKVWTLMNGQCVQTWNCPVPV 96

>Kwal_26.8628
          Length = 422

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 50/232 (21%), Positives = 99/232 (42%), Gaps = 32/232 (13%)

Query: 125 IEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWH 184
           + GH N++   +WS     + S S+D  + +W+A  LG +   + +    +Q V     +
Sbjct: 82  LNGHNNKISDFAWSSDSRSILSASQDGFMIVWDA-SLGFKKNAIPL---DSQWVLTCAIN 137

Query: 185 SEMHLLASSSYDDTI---RLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSD 241
           S  +L+AS+   ++    R+ +E+    +  ++  GH  T + S  E  E++  + + S 
Sbjct: 138 SSGNLVASAGLTNSCTIYRISQENRVQQQIVSMFKGH--TCYVSQVEFFENN-SIITASG 194

Query: 242 DSTVRVWNYVEEEENGE------DVWAQEAILPNVHSRAVYSVSWSLDGYIASVGSDGLL 295
           D T  +W+  + +   E      DV A    LP  H++    +        AS GSDG +
Sbjct: 195 DMTCALWDIPKAKRIAEFSDHLGDVLALA--LPPPHAQTSSPI-------FASGGSDGYV 245

Query: 296 XXXXXXXXXXXXXXXQQHEAHGIYEINVVKWATVDDSVLLLTGGDDGCANIW 347
                             ++  + E ++      ++   ++TG DDG A ++
Sbjct: 246 YIWDTRARAAA-------QSFFVSESDISTLKFFNNGYAIVTGADDGVARMF 290

>CAGL0F06853g 671942..673108 highly similar to sp|P20484
           Saccharomyces cerevisiae YKL021c MAK11 involved in cell
           growth and replication of M1 dsRNA virus, hypothetical
           start
          Length = 388

 Score = 38.5 bits (88), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 36/134 (26%), Positives = 60/134 (44%), Gaps = 19/134 (14%)

Query: 125 IEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWH 184
            + H   VK +  S    YL S S D+ + I++  +  E    L  L  H   + ++ + 
Sbjct: 37  FQAHSLSVKCLDISKR--YLVSGSNDEHIRIYDLQKRKE----LGTLLAHQGSITNLKFS 90

Query: 185 ---------SEMHLLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLR 235
                    +    L S+S D+ I +W+    DWE    L GH  T   +D +   S+  
Sbjct: 91  KVSDQEPKSTSGKWLLSASEDNKIIVWR--VKDWENFGTLKGH--TARINDMDIHPSNRV 146

Query: 236 LASCSDDSTVRVWN 249
           +AS S+D ++R+WN
Sbjct: 147 VASVSEDHSIRLWN 160

>ADR242C [1983] [Homologous to ScYMR131C (RRB1) - SH]
           (1126443..1128008) [1566 bp, 521 aa]
          Length = 521

 Score = 38.5 bits (88), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 46/182 (25%), Positives = 82/182 (45%), Gaps = 22/182 (12%)

Query: 132 VKAVSWSHS-GYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEM-HL 189
           ++ + WS S     A+C  D  V IW  D   ++++    ++    DV  + W+ ++ +L
Sbjct: 335 IEDIKWSPSENTVFATCGVDGHVRIW--DIRSKKHKPALSVKVSDTDVNVMSWNQKISYL 392

Query: 190 LASSSYDDT-----IRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDST 244
           LA+   + T     +R +          A  + HKG +    F   + S+ +A  S+D+T
Sbjct: 393 LATGDDNGTWGVWDLRQFSNQQGGVSPVAQYDFHKGAITSISFNPLDESI-IAVASEDNT 451

Query: 245 VRVWNYVEEEENGE------DVWAQEAILPN---VH-SRAVYSVSW--SLDGYIASVGSD 292
           V +W+   E ++ E      +V   + I P    VH  + V  V W   + G + S G+D
Sbjct: 452 VTLWDLSVEADDEEIKQQAAEVKELQQIPPQLLFVHWQKEVKDVKWHKQIPGCLVSTGTD 511

Query: 293 GL 294
           GL
Sbjct: 512 GL 513

 Score = 31.6 bits (70), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 24/37 (64%), Gaps = 1/37 (2%)

Query: 76  HKKSVRSVSFRP-HSSILAAGSFDSTISIWGKEEDAD 111
           HK ++ S+SF P   SI+A  S D+T+++W    +AD
Sbjct: 426 HKGAITSISFNPLDESIIAVASEDNTVTLWDLSVEAD 462

>Kwal_33.15475
          Length = 783

 Score = 38.5 bits (88), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 47/186 (25%), Positives = 77/186 (41%), Gaps = 39/186 (20%)

Query: 25  LLKSLKLHTD------KLWSIDCSKGLMATSSSDRKIKLVNLKNMD-----FQLVEELDD 73
           LL S  L T+       L  ++  K L+A   ++ ++ + +    D     FQL  EL+ 
Sbjct: 137 LLHSFNLQTNVYPLCMALKLVEGDKYLLAIGGTNPRVFIYSFTLQDGTLNNFQLAAELEG 196

Query: 74  STHKKSVRSVSF---RPHSSILAAGSFDSTISIW---------GKEED-------ADPQD 114
             H+  V+++ F    P + +LA GS D  I +W           +ED        + Q 
Sbjct: 197 --HEDWVKAMDFYEESPGNMLLATGSQDRYIRLWRIRTNELIDNSDEDEFKLNLLGNKQS 254

Query: 115 DFPETELL-------AIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYEC 167
            F  T  L       A+I GH++ +  + W      L + + D +V +WE D     + C
Sbjct: 255 KFFITPDLKVAINFDALIVGHDDWISCLKWHKERPQLLASTADTAVMVWEPDADSGVWIC 314

Query: 168 LSVLQE 173
            S L E
Sbjct: 315 ASRLGE 320

 Score = 33.5 bits (75), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 31/56 (55%), Gaps = 3/56 (5%)

Query: 170 VLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLW---KEDADDWECAAVLNGHKGTV 222
            L+ H  +V  V +    +L+ SSS D  +RLW   ++D D  +C  V++ HK T+
Sbjct: 51  TLKGHNAEVTCVKFVPGTNLMVSSSEDSQVRLWAFEEKDQDALKCVQVIDHHKHTI 106

 Score = 31.2 bits (69), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 29/61 (47%), Gaps = 3/61 (4%)

Query: 198 TIRLWKE-DADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNYVEEEEN 256
           TI LWK  D         L GH   V C  F    +   + S S+DS VR+W + E++++
Sbjct: 34  TIALWKPLDPAHHGVYRTLKGHNAEVTCVKFVPGTN--LMVSSSEDSQVRLWAFEEKDQD 91

Query: 257 G 257
            
Sbjct: 92  A 92

 Score = 30.0 bits (66), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 46/194 (23%), Positives = 80/194 (41%), Gaps = 36/194 (18%)

Query: 76  HKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIE-GHENEVKA 134
           H  ++  + F   S  L + S D   ++W K    +      E EL    E  H   +  
Sbjct: 597 HNLTITRLRFSSDSESLLSVSRDRQWAVWKKNSATN------EFELTFKNEKAHTRIIWD 650

Query: 135 VSWSHS--GYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVV--------WH 184
             W+ +  G+   + SRDK +  W+  E G++YE     Q+HA  +   V         H
Sbjct: 651 CDWAPTEFGHVFVTASRDKHIKAWKLSEDGQQYE-----QQHALKLAVPVTAISVFPGLH 705

Query: 185 SEMHLLASS---------SYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLR 235
           +   L+A+          +YD+  R + E    +  A  ++  +   W S+ EK    + 
Sbjct: 706 NGKLLVAAGLENGNIQVFTYDNQFRCYSEIDTRFTPADRVSRLR---WSSNQEKGR--IL 760

Query: 236 LASCSDDSTVRVWN 249
           LA  S D ++RV++
Sbjct: 761 LAVTSADHSIRVFS 774

 Score = 29.6 bits (65), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 37/183 (20%), Positives = 67/183 (36%), Gaps = 53/183 (28%)

Query: 125 IEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEE-YECLSVLQEHAQDV----- 178
           ++GH  EV  V +      + S S D  V +W  +E  ++  +C+ V+  H   +     
Sbjct: 52  LKGHNAEVTCVKFVPGTNLMVSSSEDSQVRLWAFEEKDQDALKCVQVIDHHKHTITSLSV 111

Query: 179 ----------------------KHVVWHS-------------------EMHLLASSSYDD 197
                                 + ++ HS                   + +LLA    + 
Sbjct: 112 ISNILSVGCADGSVSLWLTENNQAILLHSFNLQTNVYPLCMALKLVEGDKYLLAIGGTNP 171

Query: 198 TIRLWKEDADD-----WECAAVLNGHKGTVWCSDF-EKSESSLRLASCSDDSTVRVWNYV 251
            + ++     D     ++ AA L GH+  V   DF E+S  ++ LA+ S D  +R+W   
Sbjct: 172 RVFIYSFTLQDGTLNNFQLAAELEGHEDWVKAMDFYEESPGNMLLATGSQDRYIRLWRIR 231

Query: 252 EEE 254
             E
Sbjct: 232 TNE 234

>KLLA0B14410g 1264616..1266736 similar to sp|P36037 Saccharomyces
           cerevisiae YKL213c DOA1 involved in ubiquitin-dependent
           proteolysis, start by similarity
          Length = 706

 Score = 38.5 bits (88), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 33/56 (58%), Gaps = 2/56 (3%)

Query: 165 YECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDAD-DWECAAVLNGHK 219
           Y+  + L+ H QDV+ VV  S   + AS+S D T+R+W  DAD +WE +   +  K
Sbjct: 2   YQLSAQLRGHTQDVRSVVSLSTTQV-ASASRDGTVRIWNLDADGNWEGSIAFSSEK 56

 Score = 38.1 bits (87), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 45/170 (26%), Positives = 69/170 (40%), Gaps = 49/170 (28%)

Query: 120 ELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELG----------EEY---- 165
           +L A + GH  +V++V  S S   +AS SRD +V IW  D  G          E++    
Sbjct: 3   QLSAQLRGHTQDVRSVV-SLSTTQVASASRDGTVRIWNLDADGNWEGSIAFSSEKFVNSL 61

Query: 166 -----ECL--------------SVLQEHAQDVKHVVWH--------SEMHLLASSSYDDT 198
                +C+               +L    + V  +V H         +   L SSS+D T
Sbjct: 62  TYDAKQCVLFCGGQEKIIYGVSPLLALGQEPVYTLVGHEGNICSLSGDFESLVSSSWDKT 121

Query: 199 IRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVW 248
            ++W      WE    L GH  +VW +      S L   + S D+TV++W
Sbjct: 122 AKVWTNGIVKWE----LKGHSASVWDAKLLNDGSVL---TASADTTVKLW 164

 Score = 32.7 bits (73), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 57/128 (44%), Gaps = 18/128 (14%)

Query: 125 IEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWH 184
           ++GH   V      + G  L + S D +V +W+   L + ++ L     H+  V+++   
Sbjct: 134 LKGHSASVWDAKLLNDGSVL-TASADTTVKLWKNGTLAKTFDKL-----HSDVVRNICIL 187

Query: 185 SEMHLLASSSYDDTIRLWKEDADDWECAAVLN---GHKGTVWCSDFEKSESSLRLASCSD 241
            +     S S D T++L   +        +L+   GH+  V+     K   S  + SC +
Sbjct: 188 DDGKHFVSCSNDGTLKLSNLEG------GILHEFIGHESFVYAV---KQLPSGDIVSCGE 238

Query: 242 DSTVRVWN 249
           D TVR+WN
Sbjct: 239 DRTVRIWN 246

>Scas_692.29
          Length = 456

 Score = 38.1 bits (87), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 42/189 (22%), Positives = 87/189 (46%), Gaps = 26/189 (13%)

Query: 74  STHKKSVRSVSFRPHSSILAAGSFDSTISIWGKE---------EDADPQDDFPETELLAI 124
           S H   +R+V F   + +++AG+ D T+ +W  +         ++ D + +  + + LAI
Sbjct: 141 SGHSGPIRAVKFISDTRLVSAGN-DRTLRLWKTKNNDSVVQHFDEEDEEANIEDGKTLAI 199

Query: 125 IEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVL--QEHAQDVKHVV 182
           +EGH+  V ++  S++   L+S S D S+ +W        Y+ ++V+   E   +  + +
Sbjct: 200 LEGHKAPVVSLDVSNTSRILSS-SYDNSIGLWST-----IYKEMTVVDPMEEINNADNKI 253

Query: 183 WHSEMHLLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDD 242
             +       +  D TIR            ++L  H   V  + F+ ++ ++   S S D
Sbjct: 254 STAARKRRKLTLKDGTIRRRAP-------LSLLESHTAPVEQASFDINDDTVGY-SVSQD 305

Query: 243 STVRVWNYV 251
            T++ W+ V
Sbjct: 306 HTIKTWDLV 314

>Scas_442.2*
          Length = 795

 Score = 38.5 bits (88), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 40/160 (25%), Positives = 66/160 (41%), Gaps = 7/160 (4%)

Query: 184 HSEMHLLASSSYDDTIRLWKE-DADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDD 242
           H++ H++A  +   TI LW   D +     A L GH+  V C  F     +  + SCS+D
Sbjct: 24  HAKTHIVAFGA-GQTIALWNPLDENSQGVFATLKGHEAEVTCVKF--ITDTPYMVSCSED 80

Query: 243 STVRVWNYVEEEENGEDVWAQEAILPNVHSRAVYSVSWSLDGYIASVGSDGLLXXXXXXX 302
             V++W          D W     L + +S  V +++  L G IA   +DG +       
Sbjct: 81  HHVKIWKQNPGVAREVDGWTCVQTLDH-YSHTVVALA-VLPGLIAVGCADGKVSLWVQKM 138

Query: 303 XXXXXXXXQQHEAH-GIYEINVVKWATVDDSVLLLTGGDD 341
                   ++ E   G+  + +     +DD  LL  GG +
Sbjct: 139 KEDVFILGEEFEVQKGVLPLALAFSKVIDDKYLLAVGGTN 178

 Score = 38.1 bits (87), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 59/278 (21%), Positives = 101/278 (36%), Gaps = 49/278 (17%)

Query: 65  FQLVEELDDSTHKKSVRSVSFR----PHSSILAAGSFDSTISIWG-------KEEDADPQ 113
            QL  +L+   H+  ++S++FR    P   +L +GS D  I +W        K++D D +
Sbjct: 198 LQLAAKLEG--HEDWIKSLAFRHQETPGDYLLCSGSQDRYIRLWRIRINDLMKKQDEDDE 255

Query: 114 DDFPETELL--------------------AIIEGHENEVKAVSWSHSGYYLASCSRDKSV 153
           D   +  LL                    A+I GH++ + ++ W  +   L + + D ++
Sbjct: 256 DIATKLALLNNKQYKFHVTDALRVCINFEALIMGHDDWISSLQWHETRLQLLASTADTAL 315

Query: 154 WIWEADELGEEYECLSVLQE-----------HAQDVKHVVW--HSEMHLLASSSYDDTIR 200
            +WE DE    + C   L E            A      +W  H     + ++    + R
Sbjct: 316 MVWEPDEASGIWVCGLRLGELSSKGASTATGSAGGFWSCLWFSHQNKDYILTNGKTGSWR 375

Query: 201 LWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRV---WNYVEEEENG 257
           +W  +  +  C   L     T   +D   S     L S S D T R+   W Y  +    
Sbjct: 376 VWTTEEGNTLCDQELGITGATKQVTDIAWSPKGEYLLSTSLDQTTRLFAPWIYNNDGTKR 435

Query: 258 EDVWAQEAILPNVHSRAVYSVSWSLDGYIASVGSDGLL 295
                 E   P +H   +  V         S G + +L
Sbjct: 436 NTATWHEFSRPQIHGYDMICVEPMSGARFVSGGDEKIL 473

 Score = 36.6 bits (83), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 54/116 (46%), Gaps = 14/116 (12%)

Query: 91  ILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLASCSRD 150
           I+A G+   TI++W      +P D+  +  + A ++GHE EV  V +     Y+ SCS D
Sbjct: 29  IVAFGA-GQTIALW------NPLDENSQG-VFATLKGHEAEVTCVKFITDTPYMVSCSED 80

Query: 151 KSVWIWEADE-LGEE---YECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLW 202
             V IW+ +  +  E   + C+  L  ++  V  V       L+A    D  + LW
Sbjct: 81  HHVKIWKQNPGVAREVDGWTCVQTLDHYSHTV--VALAVLPGLIAVGCADGKVSLW 134

 Score = 31.2 bits (69), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 39/172 (22%), Positives = 65/172 (37%), Gaps = 16/172 (9%)

Query: 95  GSFD--STISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLASCSRDKS 152
           GS+D    ++   KE+       +PE E L    GH  E+  +  S  G ++AS  R  +
Sbjct: 535 GSYDMLGELTTPPKEDQLQRHLLWPEIEKLY---GHGYEITCLDVSPDGKFIASACRSNT 591

Query: 153 -----VWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDAD 207
                V I+  D      E    L  H   V  + +  +   L S   D    +W+ D +
Sbjct: 592 PQHAVVRIFNTDNW---LEVKPPLAFHTLTVTKLRFSPDSKYLLSVCRDRQWVVWERDPE 648

Query: 208 DWECA---AVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNYVEEEEN 256
             +          H   +W  D+   E      + S D T+++W + E + N
Sbjct: 649 TDKFTLKYKTAKPHTRIIWDGDWAPLEFGNVFVTGSRDRTIKLWKFDENKSN 700

>ADR264C [2005] [Homologous to ScYMR146C (TIF34) - SH]
           (1158218..1159258) [1041 bp, 346 aa]
          Length = 346

 Score = 37.7 bits (86), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 75/185 (40%), Gaps = 18/185 (9%)

Query: 21  MSLELLKSLKLHTDKLWSIDCSK--GLMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKK 78
           M+ E L +L+ H   +WSID  +      T S+D  +K+  ++  D  +    D  T   
Sbjct: 40  MNGERLGTLEGHNGSIWSIDVDQHTEYAVTGSADFSVKVWRVR--DGSIAHSWDTRT--- 94

Query: 79  SVRSVSFRPHSSILAA-----GSFDSTISIWGKEEDADPQDDFPETELLAIIEGHEN--E 131
            VR V F P    + A      ++   I ++    DA+ Q     + L   I   E    
Sbjct: 95  PVRRVEFSPTGDRVLAVLDNVMNYAGAIVVFSVTRDANNQITGFNSGLSCEILTQEGCAP 154

Query: 132 VKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLA 191
           V   SWS+ G Y+ +  +D  +  +     G   ECL +   H Q V  + +  +     
Sbjct: 155 VLVASWSYDGKYIVAGHQDGKISKYN----GVTGECLEIKDLHKQRVSDIQFSLDRTYFL 210

Query: 192 SSSYD 196
           ++S D
Sbjct: 211 TTSRD 215

 Score = 32.7 bits (73), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 39/79 (49%), Gaps = 4/79 (5%)

Query: 170 VLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEK 229
           +L  H + +  V ++ E  L+ +S  D+   +W   A + E    L GH G++W  D + 
Sbjct: 5   MLMGHERSLTQVKYNREGDLIFTSGKDNVASVWY--AMNGERLGTLEGHNGSIWSIDVD- 61

Query: 230 SESSLRLASCSDDSTVRVW 248
            + +    + S D +V+VW
Sbjct: 62  -QHTEYAVTGSADFSVKVW 79

>Sklu_2167.5 YGL213C, Contig c2167 8275-9186
          Length = 303

 Score = 37.4 bits (85), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 47/190 (24%), Positives = 79/190 (41%), Gaps = 31/190 (16%)

Query: 5   KHNLYTFSHKHTRLQRMSLELLKSLKLHTDKL-------WSIDCS-KGLMATSSSDRKI- 55
           K   Y+   +  + Q   LE    L L  + L        S+D S  GL+AT  SD  + 
Sbjct: 55  KREDYSIEEEKLQQQNEELEFQPHLTLQGEILSSEPNFATSVDVSSNGLIATGFSDGSVV 114

Query: 56  --------KLVNLKNMDFQLVEELDDSTHKKSVRSVSFRPHSSILA----AGSFDSTISI 103
                    + N +    Q +EE     +  +VR V F P   +LA    +GS+   +++
Sbjct: 115 VAQLRTLRPIYNFEGFGIQGIEE-----NSSTVRDVKFSPLGGLLAVANDSGSY-GCVTL 168

Query: 104 WGKEEDADPQDDFPETELLAIIEG---HENEVKAVSWSHSGYYLASCSRDKSVWIWEADE 160
           +  E      +    T       G   H+  V ++S++ +G +LASC  D  V +W+  +
Sbjct: 169 YETEYGERVGNLTVPTHSAQTSVGSFAHDGWVFSLSFNSTGEFLASCGYDSKVRVWDV-K 227

Query: 161 LGEEYECLSV 170
           L E    L++
Sbjct: 228 LKERVSTLNI 237

>Sklu_1048.1 YIR012W, Contig c1048 895-2196
          Length = 433

 Score = 37.7 bits (86), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 38/184 (20%), Positives = 81/184 (44%), Gaps = 24/184 (13%)

Query: 76  HKKSVRSVSFRPHSSILAAGSFDSTISIWGK-EEDADPQDDFPETELLAIIEGHENEVKA 134
           H  S+ ++   P   ++  G  D+  ++W    +        P TE  ++I G       
Sbjct: 75  HTDSIFTIMHHPSLPLVCTGGGDNVANLWTSHSQPPKFAGSLPHTE--SVIGG------- 125

Query: 135 VSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVW---HSEM-HLL 190
             ++  G +L +   +  +   ++ + G +++    LQE    V+ +VW   H  + ++ 
Sbjct: 126 -GFTSDGKFLITGDMNGKILCHKSLKGGAQWKLCGELQE----VEEIVWIKVHPTIPNIF 180

Query: 191 ASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCS-----DFEKSESSLRLASCSDDSTV 245
           A  + D ++  ++ D+       V++G      C+     + E+ E++L L +CS DST+
Sbjct: 181 AFGATDGSVWCYQIDSQSGSLDQVMSGFVHQQDCNMGEFINIEEGENNLTLVTCSLDSTI 240

Query: 246 RVWN 249
             WN
Sbjct: 241 VGWN 244

>KLLA0F10615g 978492..979604 similar to sp|P38328 Saccharomyces
           cerevisiae YBR234c ARC40 ARP2/3 protein complex subunit,
           40 kilodalton singleton, start by similarity
          Length = 370

 Score = 37.7 bits (86), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 43/159 (27%), Positives = 64/159 (40%), Gaps = 12/159 (7%)

Query: 190 LASSSYDDTIRLWK-EDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVW 248
           L + +YD    ++K   A   +  AVL  H  TV   D        R+ +CS D    VW
Sbjct: 26  LLAITYDTDCYVYKVSAAKQPQLVAVLPDHDKTVTAVDISVHG---RIVTCSQDRNAIVW 82

Query: 249 NYVEEEENGEDVWAQEAILPNVHSRAVYSVSWSLDGYIASVGSDGLLXXXXXXXXXXXXX 308
              E   NG   +    +L  ++ RA   VSW+  GY  +VGS   +             
Sbjct: 83  ---EPLSNG--TYKPTLVLLRIN-RAATCVSWASSGYKFAVGSSARIIAVCYYEQENDWW 136

Query: 309 XXQQHEAHGIYEINVVKWATVDDSVLLLTGGDDGCANIW 347
             +  +      IN + W +  + VLL  GG DG A ++
Sbjct: 137 VSKHIKKPIKSTINALSWHS--NCVLLACGGTDGYARVF 173

 Score = 31.2 bits (69), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 34/137 (24%), Positives = 54/137 (39%), Gaps = 10/137 (7%)

Query: 66  QLVEELDDSTHKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAII 125
           QLV  L D  H K+V +V    H  I+   S D    +W    +   +   P   LL I 
Sbjct: 47  QLVAVLPD--HDKTVTAVDISVHGRIVTC-SQDRNAIVWEPLSNGTYK---PTLVLLRI- 99

Query: 126 EGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHS 185
                    VSW+ SGY  A  S  + + +   ++  + +    + +     +  + WHS
Sbjct: 100 ---NRAATCVSWASSGYKFAVGSSARIIAVCYYEQENDWWVSKHIKKPIKSTINALSWHS 156

Query: 186 EMHLLASSSYDDTIRLW 202
              LLA    D   R++
Sbjct: 157 NCVLLACGGTDGYARVF 173

>Kwal_47.17555
          Length = 417

 Score = 37.7 bits (86), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 38/82 (46%), Gaps = 10/82 (12%)

Query: 76  HKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAV 135
           H   +  V F P   +L +GS D  + +W   + ++P+           ++GH + V A+
Sbjct: 147 HYAEITDVKFFPSGEVLLSGSADMQLKVWSTLDGSNPR----------TLKGHTSTVTAL 196

Query: 136 SWSHSGYYLASCSRDKSVWIWE 157
                G  + S S+D S+ +WE
Sbjct: 197 GIIDRGRNVMSSSKDGSLKLWE 218

 Score = 30.4 bits (67), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 37/86 (43%), Gaps = 4/86 (4%)

Query: 118 ETELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQD 177
           + E+   +EGH  E+  V +  SG  L S S D  + +W   +          L+ H   
Sbjct: 137 QAEVTRTLEGHYAEITDVKFFPSGEVLLSGSADMQLKVWSTLDGSNP----RTLKGHTST 192

Query: 178 VKHVVWHSEMHLLASSSYDDTIRLWK 203
           V  +        + SSS D +++LW+
Sbjct: 193 VTALGIIDRGRNVMSSSKDGSLKLWE 218

>YDL195W (SEC31) [678] chr4 (107209..111030) Component (p150) of the
           COPII coat of secretory pathway vesicles involved in
           endoplasmic reticulum to Golgi transport, associated
           with Sec13p, member of WD (WD-40) repeat family [3822
           bp, 1273 aa]
          Length = 1273

 Score = 37.7 bits (86), Expect = 0.012,   Method: Composition-based stats.
 Identities = 40/201 (19%), Positives = 73/201 (36%), Gaps = 42/201 (20%)

Query: 122 LAIIEGH-ENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKH 180
           L+++E H +N  +  + + S         D S+ IW+        + L+  Q H + +  
Sbjct: 212 LSVVEWHPKNSTRVATATGS-------DNDPSILIWDLRNANTPLQTLN--QGHQKGILS 262

Query: 181 VVW-HSEMHLLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASC 239
           + W H + HLL SS  D+T+ LW  ++ +        G+    WC   + +  +  L +C
Sbjct: 263 LDWCHQDEHLLLSSGRDNTVLLWNPESAEQLSQFPARGN----WCFKTKFAPEAPDLFAC 318

Query: 240 SD---------------------------DSTVRVWNYVEEEENGEDVWAQEAILPNVHS 272
           +                            +S    WN V  EE+ E         P  + 
Sbjct: 319 ASFDNKIEVQTLQNLTNTLDEQETETKQQESETDFWNNVSREESKEKPSVFHLQAPTWYG 378

Query: 273 RAVYSVSWSLDGYIASVGSDG 293
               +  W+  G +  +  DG
Sbjct: 379 EPSPAAHWAFGGKLVQITPDG 399

 Score = 29.6 bits (65), Expect = 5.0,   Method: Composition-based stats.
 Identities = 26/129 (20%), Positives = 57/129 (44%), Gaps = 9/129 (6%)

Query: 75  THKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKA 134
           +H K    VS     ++ A  S DS++ +W     AD +      ++       +++   
Sbjct: 16  SHDKIPLLVSGTVSGTVDANFSTDSSLELWSLLA-ADSEKPIASLQV-------DSKFND 67

Query: 135 VSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEM-HLLASS 193
           + WSH+   +A    + S+ ++  +E       ++    H+  VK V ++++  ++LAS 
Sbjct: 68  LDWSHNNKIIAGALDNGSLELYSTNEANNAINSMARFSNHSSSVKTVKFNAKQDNVLASG 127

Query: 194 SYDDTIRLW 202
             +  I +W
Sbjct: 128 GNNGEIFIW 136

>YKL021C (MAK11) [3234] chr11 complement(396987..398393) Protein
           essential for replication of M double-stranded RNA
           (dsRNA) virus, member of the WD (WD-40) repeat family
           [1407 bp, 468 aa]
          Length = 468

 Score = 37.7 bits (86), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 42/159 (26%), Positives = 63/159 (39%), Gaps = 47/159 (29%)

Query: 92  LAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLASCSRDK 151
           L +GS D  I I+          D  + + L  +  H+  + A+ +SH     AS S D 
Sbjct: 119 LVSGSNDEHIRIY----------DLQKRKELGTLLSHQGSITALQFSHP----ASSSEDA 164

Query: 152 SVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDADDWEC 211
           +V                     ++  K+  W      L S+S D  I +W+    DWE 
Sbjct: 165 AV---------------------SKGSKNSKW------LLSASEDHKIMVWR--VKDWET 195

Query: 212 AAVLNGHKGTVWCSDFEKSESSLRLA-SCSDDSTVRVWN 249
              L GH   V   D   +    R+A S SDD ++R+WN
Sbjct: 196 VGTLKGHTARVNDVDIHPTN---RIAISVSDDHSIRLWN 231

>Kwal_27.12667
          Length = 721

 Score = 37.7 bits (86), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 56/138 (40%), Gaps = 24/138 (17%)

Query: 76  HKKSVRSVSFR-PHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKA 134
           H  S+  + F  P  ++  AG  D ++ IW          +  +   +  + GH   V  
Sbjct: 403 HDDSITCLDFDLPFGTMCTAGKLDHSVKIW----------NLSKKTQIGALPGHLASVSC 452

Query: 135 VSWSHSGYYLASCSRDKSVWIWE---ADEL-------GEEYECLSVLQEHAQDVKHVVWH 184
           +    S + L +  RD  + +W+   A+EL       GEE  C+     H  ++     H
Sbjct: 453 MQMEDS-HSLITGGRDALLKLWDIEKAEELYNDGATEGEEELCVHTFDAHVDEI--TALH 509

Query: 185 SEMHLLASSSYDDTIRLW 202
            E + L S S D TIR W
Sbjct: 510 FEGNSLVSGSQDRTIRQW 527

>Scas_712.34
          Length = 399

 Score = 37.4 bits (85), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 41/148 (27%), Positives = 64/148 (43%), Gaps = 18/148 (12%)

Query: 88  HSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLASC 147
           H+ ++A G  + TI +  +     P  +F E   +  IE + N V+AV +S +G  LA  
Sbjct: 196 HNGLIATGFANGTIVV-SQLSTLRPLYNF-EGFGIQGIEQNSNTVRAVKFSPAGSLLAVA 253

Query: 148 SRDKS---VWIWEADELGEEYECLSVL----QEHAQDVKHVVW------HSEMHLLASSS 194
           +   S   V ++E  + GE    L+V     Q   +   H  W      +S    LA+S 
Sbjct: 254 NDSGSFGCVALYET-QFGERIGNLTVPTHSGQSSVESFAHSGWVFALSFNSTGEFLATSG 312

Query: 195 YDDTIRLWKEDADDWECAAVLNGHKGTV 222
           YD  +R+W  D    E    LN   G +
Sbjct: 313 YDSKVRVW--DVKSKERVTTLNITAGDI 338

 Score = 32.7 bits (73), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 36/152 (23%), Positives = 65/152 (42%), Gaps = 24/152 (15%)

Query: 44  GLMATSSSDRKI---------KLVNLKNMDFQLVEELDDSTHKKSVRSVSFRPHSSILA- 93
           GL+AT  ++  I          L N +    Q +E+     +  +VR+V F P  S+LA 
Sbjct: 198 GLIATGFANGTIVVSQLSTLRPLYNFEGFGIQGIEQ-----NSNTVRAVKFSPAGSLLAV 252

Query: 94  ---AGSFDSTISIWGKEEDADPQDDFPETELLAIIE--GHENEVKAVSWSHSGYYLASCS 148
              +GSF        +  +       P     + +E   H   V A+S++ +G +LA+  
Sbjct: 253 ANDSGSFGCVALYETQFGERIGNLTVPTHSGQSSVESFAHSGWVFALSFNSTGEFLATSG 312

Query: 149 RDKSVWIWEADELGEEYECLSVLQEHAQDVKH 180
            D  V +W+     +  E ++ L   A D+++
Sbjct: 313 YDSKVRVWDV----KSKERVTTLNITAGDIEN 340

>Kwal_14.1710
          Length = 574

 Score = 37.7 bits (86), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 47/96 (48%), Gaps = 17/96 (17%)

Query: 45  LMATSSSDRKIKL--VNLKNMDFQLVEELDDSTHKKSVRSVSFRPHSSILAAGSFDSTIS 102
           L+AT S   +I +  V +KN      EE     HK  V  +++RP    LA+GS D+T++
Sbjct: 333 LIATGSKSGEIHINDVRIKNHIVSTWEE-----HKGEVCGIAYRPDGLQLASGSNDNTVA 387

Query: 103 IWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWS 138
           IW      D +   P+     I   H   VKA++WS
Sbjct: 388 IW------DTRTSLPQ----HIKRQHTAAVKALAWS 413

 Score = 34.3 bits (77), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 41/175 (23%), Positives = 74/175 (42%), Gaps = 21/175 (12%)

Query: 126 EGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHS 185
           E H+ EV  +++   G  LAS S D +V IW+      ++    + ++H   VK + W  
Sbjct: 359 EEHKGEVCGIAYRPDGLQLASGSNDNTVAIWDTRTSLPQH----IKRQHTAAVKALAWSP 414

Query: 186 EM-HLLASSS--YDDTIRLWKEDADDWECAAVLNGHKGTV--WCSDFEKSESSLRLASCS 240
           ++ +LLA+     D  I  W          ++  G + +   W   +  +     + +  
Sbjct: 415 DISNLLATGGGQTDKHIHFWNT-TTGARTGSINTGSQVSSLHWGQSYNSNAIQREIVATG 473

Query: 241 --DDSTVRVWNYVEEEENGEDVWAQEAILPNVHSRAVYSVSWSLDGYI-ASVGSD 292
              ++ V ++NY  + +  E V A EA         + S   S DG + A+VG D
Sbjct: 474 GIPENAVSIYNYDTKFKVAEIVHAHEA--------RICSSQLSPDGTVLATVGGD 520

>AER255C [2757] [Homologous to ScYDR364C (CDC40) - SH]
           (1107932..1109335) [1404 bp, 467 aa]
          Length = 467

 Score = 37.4 bits (85), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 44/175 (25%), Positives = 70/175 (40%), Gaps = 17/175 (9%)

Query: 76  HKKSVRSVSF-RPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKA 134
           H +   ++ F R    +  +G  D  + IW         D + E  LL    GH   + A
Sbjct: 173 HDRGTTALEFLRKTGHLFLSGGNDGVLKIW---------DMYHERLLLRDYCGHRKAISA 223

Query: 135 VSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSS 194
            S+SH     AS S DK+V IW+  E G+    LS   +   +       ++  LL   S
Sbjct: 224 TSFSHDNVQFASSSYDKTVKIWDT-ETGDIINRLSF--KATPNCMTFHPQNKEQLLVGFS 280

Query: 195 YDDTIRLWKEDADDWE-CAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVW 248
            D  IR +    D  +    + + H   +    +    S  +  S SDD ++R+W
Sbjct: 281 -DSKIRHFDLRVDKKDGVIQIYDHHLAAINALRYFPDGS--KFISSSDDKSIRIW 332

 Score = 35.4 bits (80), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 33/141 (23%), Positives = 60/141 (42%), Gaps = 12/141 (8%)

Query: 120 ELLAIIEGHENEVKAVSW-SHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDV 178
            +L + +GH+    A+ +   +G+   S   D  + IW+   +  E   L     H + +
Sbjct: 165 RILHVYDGHDRGTTALEFLRKTGHLFLSGGNDGVLKIWD---MYHERLLLRDYCGHRKAI 221

Query: 179 KHVVWHSEMHLLASSSYDDTIRLWKEDADDWECAAVLN--GHKGTVWCSDFEKSESSLRL 236
               +  +    ASSSYD T+++W     D E   ++N    K T  C  F        L
Sbjct: 222 SATSFSHDNVQFASSSYDKTVKIW-----DTETGDIINRLSFKATPNCMTFHPQNKEQLL 276

Query: 237 ASCSDDSTVRVWNYVEEEENG 257
              S DS +R ++   ++++G
Sbjct: 277 VGFS-DSKIRHFDLRVDKKDG 296

 Score = 33.9 bits (76), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 40/210 (19%), Positives = 81/210 (38%), Gaps = 39/210 (18%)

Query: 76  HKKSVRSVSFRPHSSILAAGSFDSTISIWGKEED----------------ADPQDD---- 115
           H+K++ + SF   +   A+ S+D T+ IW  E                    PQ+     
Sbjct: 217 HRKAISATSFSHDNVQFASSSYDKTVKIWDTETGDIINRLSFKATPNCMTFHPQNKEQLL 276

Query: 116 --FPETEL-------------LAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADE 160
             F ++++             + I + H   + A+ +   G    S S DKS+ IWE ++
Sbjct: 277 VGFSDSKIRHFDLRVDKKDGVIQIYDHHLAAINALRYFPDGSKFISSSDDKSIRIWE-NQ 335

Query: 161 LGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDAD-DWECAAVLNGHK 219
           +    + +S   ++      +  H E +  A+ S D++I ++               GHK
Sbjct: 336 INIPIKQISDTDQYP--APWIQLHPEHNQFAAQSMDNSIYVYSMKPKYKRHPRKAFRGHK 393

Query: 220 GTVWCSDFEKSESSLRLASCSDDSTVRVWN 249
              + S F+ +     +A+      + +W+
Sbjct: 394 SAGYNSMFDIAPDGRYVAAGDTSGRLFIWD 423

>Sklu_2291.4 YPL183C, Contig c2291 6003-8996 reverse complement
          Length = 997

 Score = 37.7 bits (86), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 63/143 (44%), Gaps = 17/143 (11%)

Query: 92  LAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLASCSRDK 151
           + AG+    + IW         D F ET++  ++ GHE  +  V+ S +G Y+ SCS D+
Sbjct: 154 INAGTVMGGVFIW---------DLFSETKVHNLL-GHEGSIFYVTLSKNGEYVVSCSDDR 203

Query: 152 SVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLW--KEDADDW 209
           S+ +W      +  E LS    H   +  + +      + S S D T R+W   +  DD 
Sbjct: 204 SIKLWNL----KSGELLSTGWGHTARIWQLKFIDNDTKVVSVSEDCTCRVWDIAKPHDDL 259

Query: 210 ECAAVLNGHK-GTVWCSDFEKSE 231
             + +   H    VW  D E+ E
Sbjct: 260 VQSGIYEVHLIKNVWGVDVEEDE 282

>CAGL0L10890g 1163084..1164457 highly similar to sp|Q12024
           Saccharomyces cerevisiae YOR272w YTM1
           microtubule-interacting protein, start by similarity
          Length = 457

 Score = 37.4 bits (85), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 42/188 (22%), Positives = 88/188 (46%), Gaps = 23/188 (12%)

Query: 74  STHKKSVRSVSFRPHSSILAAGSFDSTISIWGKEED----------ADPQDDFPETELLA 123
           S H  +V++V +  ++ I++AG+ D ++ +W  + D           + +++  + + LA
Sbjct: 141 SGHTGAVKAVKYISNTRIVSAGN-DRSLRLWKTKNDDGSVSNNTGDENDEENIEDGKTLA 199

Query: 124 IIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVW 183
           I+EGH+  V ++  + +   L S S D +V +W    + +E   +  L+E  Q+  + + 
Sbjct: 200 ILEGHKAPVVSLDVASNSRIL-SASYDNTVALWST--IYKEMTAIDHLEE-IQNPNNKIS 255

Query: 184 HSEMHLLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDS 243
            +       +  D TIR            ++L  H G V    F+  ++++   S S D 
Sbjct: 256 TAAKKRRKLTLKDGTIRRRAP-------LSLLESHTGPVEQVIFDHGDNTVGY-SVSQDH 307

Query: 244 TVRVWNYV 251
           T++ W+ V
Sbjct: 308 TIKTWDLV 315

 Score = 37.0 bits (84), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 77/334 (23%), Positives = 123/334 (36%), Gaps = 84/334 (25%)

Query: 21  MSLELLKSLKLHTDKLWSID-CSKGLMATSSSDRKIKLVNLKNMDFQLVEELDDST---- 75
           MS ++ K    HT  + ++   S   + ++ +DR ++L   KN D  +     D      
Sbjct: 132 MSGKVEKQYSGHTGAVKAVKYISNTRIVSAGNDRSLRLWKTKNDDGSVSNNTGDENDEEN 191

Query: 76  ------------HKKSVRSVSFRPHSSILAAGSFDSTISIWGK-----------EEDADP 112
                       HK  V S+    +S IL+A S+D+T+++W             EE  +P
Sbjct: 192 IEDGKTLAILEGHKAPVVSLDVASNSRILSA-SYDNTVALWSTIYKEMTAIDHLEEIQNP 250

Query: 113 QDDFP-----------------ETELLAIIEGHENEVKAVSWSHS----GYYLASCSRDK 151
            +                        L+++E H   V+ V + H     GY   S S+D 
Sbjct: 251 NNKISTAAKKRRKLTLKDGTIRRRAPLSLLESHTGPVEQVIFDHGDNTVGY---SVSQDH 307

Query: 152 SVWIWE------ADELGEEYECLSVLQEHAQD-------VKHVVWHSEMHLLASSSYDDT 198
           ++  W+       D     Y  LS+ Q    +       V+H+  H       SSS   T
Sbjct: 308 TIKTWDLVTARCIDTKTTSYPLLSIAQMPTLNLLACGSSVRHITLHDPR---VSSSAKIT 364

Query: 199 IRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNYVEEEENGE 258
            +              L GHK  V   D   SE+   L S S D TV+VW+ V       
Sbjct: 365 QKQ-------------LVGHKNFVVGLD-TCSENEYLLCSASHDGTVKVWD-VRSTSPMY 409

Query: 259 DVWAQEAILPNVHSRAVYSVSWSLDGYIASVGSD 292
            +  Q+  +    +  V++V W+    I S G D
Sbjct: 410 TITRQDPTVEKGVNDKVFAVKWAKSIGIISGGQD 443

>ADR176W [1917] [Homologous to ScYOR269W (PAC1) - SH]
           complement(1012413..1013798) [1386 bp, 461 aa]
          Length = 461

 Score = 37.4 bits (85), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 53/115 (46%), Gaps = 15/115 (13%)

Query: 89  SSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSG--YYLAS 146
           S +++  S D    IW   ++A         +LL  +  HE+ V    +  SG    LA+
Sbjct: 178 SLLISTTSKDLQCKIWSFTDNA-------AFQLLRTLSSHEHIVSQSCFLRSGSDLLLAT 230

Query: 147 CSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRL 201
           CSRD +V +W+     +   C+   Q H Q V+ +  H +   + + S D TIRL
Sbjct: 231 CSRDLTVKVWDT----KSGWCIKSFQPHNQWVRTLELHGDY--VITGSNDATIRL 279

 Score = 36.2 bits (82), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 36/62 (58%), Gaps = 1/62 (1%)

Query: 189 LLASSSYDDTIRLWK-EDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRV 247
           L++++S D   ++W   D   ++    L+ H+  V  S F +S S L LA+CS D TV+V
Sbjct: 180 LISTTSKDLQCKIWSFTDNAAFQLLRTLSSHEHIVSQSCFLRSGSDLLLATCSRDLTVKV 239

Query: 248 WN 249
           W+
Sbjct: 240 WD 241

 Score = 28.9 bits (63), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 62/259 (23%), Positives = 99/259 (38%), Gaps = 75/259 (28%)

Query: 22  SLELLKSLKLHTDKLWSIDC-----SKGLMATSSSDRKIKLVNLKN----MDFQLVEELD 72
           + +LL++L  H + + S  C     S  L+AT S D  +K+ + K+      FQ      
Sbjct: 200 AFQLLRTLSSH-EHIVSQSCFLRSGSDLLLATCSRDLTVKVWDTKSGWCIKSFQ------ 252

Query: 73  DSTHKKSVRSVSFRPHSSILAAGSFDSTISI--W--GKEEDADPQDDFPETELLAI---- 124
              H + VR++    H   +  GS D+TI +  W  G         +FP   +L I    
Sbjct: 253 --PHNQWVRTLEL--HGDYVITGSNDATIRLSHWPSGNGLSMAVMHEFPIERVLIIPMRA 308

Query: 125 -----IEGHENEVKA------VSWSHSGY-YLASCSRDKSVWIWEADELGEEYECLSVLQ 172
                 E  +++V+         +S  G+ Y  SCSRD  + +W+          L    
Sbjct: 309 NTAQKTEADDDQVELEYRKYDPDYSPLGFKYCISCSRDNLIVLWKIP--------LPKFI 360

Query: 173 EHAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSES 232
            H           + +LL +               ++E   V  GH  T W  D +    
Sbjct: 361 PHRP--------PQPNLLQT---------------NFEKVHVFKGH--TSWVRDIK--VR 393

Query: 233 SLRLASCSDDSTVRVWNYV 251
              L SCSDD ++R W+ V
Sbjct: 394 GRHLFSCSDDRSIRCWDLV 412

>Kwal_26.7655
          Length = 743

 Score = 37.4 bits (85), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 42/85 (49%), Gaps = 5/85 (5%)

Query: 168 LSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDF 227
             + QEH QD+  + W S+   + ++S D T RLW  D      A  +  H   V C+ F
Sbjct: 265 FRIYQEHTQDILDLDW-SKNGFILTTSMDKTARLWHCDRPK---ALKVFTHPDFVTCAKF 320

Query: 228 EKSESSLRLASCSDDSTVRVWNYVE 252
             ++    ++ C D  T+R+W+ ++
Sbjct: 321 HPNDDRFFISGCLDH-TLRLWSILD 344

>CAGL0J03564g 338044..341133 similar to sp|P25365 Saccharomyces
           cerevisiae YCR067c SED4 or sp|P11655 Saccharomyces
           cerevisiae YNR026c SEC12, hypothetical start
          Length = 1029

 Score = 37.4 bits (85), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 55/107 (51%), Gaps = 12/107 (11%)

Query: 8   LYTFSHKHTRLQRMSLELLKSLKLHTD--KLWSIDC-SKG-LMATSSSDRKIKLVNLKNM 63
           L TF     R++  +  +L S K+  D  K+ ++D   KG L+A ++ D  + L+++K +
Sbjct: 237 LTTF-----RIRNTNPTILSSKKVFKDYKKITAMDVDPKGQLIALTTDDNSLALLSVKKL 291

Query: 64  DFQLVEELDDSTHKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDA 110
           +   V +L    HK ++  V+  P    +A GS D T+ I+    DA
Sbjct: 292 N---VIKLFKQVHKDTITRVTVSPGGQYVATGSTDKTVHIFKISPDA 335

>Scas_700.27*
          Length = 433

 Score = 37.0 bits (84), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 26/114 (22%), Positives = 52/114 (45%), Gaps = 15/114 (13%)

Query: 90  SILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLASCSR 149
           +++A    DS + +W         D      ++ +I GH+N +  V        + SCS 
Sbjct: 219 NLIATAGRDSVVRLW---------DIRARVAVMTLI-GHKNPINKVHCLPVDPQIVSCST 268

Query: 150 DKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWK 203
           D ++ +W+        + + V+  H + V+++ +H     ++S S +D IR WK
Sbjct: 269 DATIRLWDI----VAGKSMKVITHHKKSVRNIAFHPTEFSMSSCSAND-IRSWK 317

 Score = 34.7 bits (78), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 34/68 (50%), Gaps = 10/68 (14%)

Query: 187 MHLLASSSYDDTIRLWKEDADDWECAAVLNGHKGT---VWCSDFEKSESSLRLASCSDDS 243
           ++L+A++  D  +RLW  D         L GHK     V C   +      ++ SCS D+
Sbjct: 218 LNLIATAGRDSVVRLW--DIRARVAVMTLIGHKNPINKVHCLPVDP-----QIVSCSTDA 270

Query: 244 TVRVWNYV 251
           T+R+W+ V
Sbjct: 271 TIRLWDIV 278

 Score = 33.9 bits (76), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 42/212 (19%), Positives = 90/212 (42%), Gaps = 29/212 (13%)

Query: 44  GLMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSVSFRPHSSILAAGSFDSTISI 103
            L+AT+  D  ++L +++      V  +    HK  +  V   P    + + S D+TI +
Sbjct: 219 NLIATAGRDSVVRLWDIR----ARVAVMTLIGHKNPINKVHCLPVDPQIVSCSTDATIRL 274

Query: 104 WGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELG- 162
           W          D    + + +I  H+  V+ +++  + + ++SCS +  +  W+  E G 
Sbjct: 275 W----------DIVAGKSMKVITHHKKSVRNIAFHPTEFSMSSCSAN-DIRSWKLPEGGL 323

Query: 163 ------EEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDADDWECAAVLN 216
                 +    ++ L  +  DV  +   S+  +L+   Y    +   +     E    L 
Sbjct: 324 LTNFNSDGLGIINTLSINQDDV--LFAGSDNGMLSFYDYKSGHKY--QSMMTKEIPGSLE 379

Query: 217 GHKGTVWCSDFEKSESSLRLASCSDDSTVRVW 248
             +G + CS F++  + LRL +   D ++++W
Sbjct: 380 SERG-ILCSTFDR--TGLRLLTGETDKSIKIW 408

>Kwal_47.17567
          Length = 590

 Score = 37.4 bits (85), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 53/237 (22%), Positives = 101/237 (42%), Gaps = 31/237 (13%)

Query: 26  LKSLKLHTDKLWSIDCSKGLMATSSSDRKI--KLVNLKNMDFQLVEELDDSTHKKSVRSV 83
           ++++  H D++  +  +  ++ + S DR+I  + V      F+ +      TH + V  +
Sbjct: 361 IRTIPGHIDRVACLSWNNHILTSGSRDRRILHRDVRTPQSSFEEIR-----THNQEVCGL 415

Query: 84  SFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWS-HSGY 142
            +    + LA+G  D+ + ++      D     P  +L    E H   VKA++WS H   
Sbjct: 416 KWNVEDNKLASGGNDNAVFVY------DGTSRLPFLKL----EEHTAAVKAMAWSPHRRG 465

Query: 143 YLASC--SRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMH-LLASSSYDD-T 198
            LA+   + DK + IW      + ++      + A  V +++W    + ++ S  Y    
Sbjct: 466 ILATGGGTADKRLKIWNVKTSVKLHDV-----DTASQVCNMIWSKNTNEIITSHGYSKYN 520

Query: 199 IRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNYVEEEE 255
           + LW  D +  E  A+L GH   V       S     + S + D T+R W   E+ +
Sbjct: 521 LTLW--DGNTLEPMAILKGHSFRVL--HMTLSTDGTTVVSGAGDETLRYWKLFEKSK 573

 Score = 35.4 bits (80), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 44/197 (22%), Positives = 92/197 (46%), Gaps = 27/197 (13%)

Query: 13  HKHTRLQRMSLELLKSLKLHTDKL-WSIDCSKGLMATSSSDRKIKLVN-LKNMDFQLVEE 70
           H+  R  + S E +++       L W+++ +K  +A+  +D  + + +    + F  +EE
Sbjct: 392 HRDVRTPQSSFEEIRTHNQEVCGLKWNVEDNK--LASGGNDNAVFVYDGTSRLPFLKLEE 449

Query: 71  LDDSTHKKSVRSVSFRPHS-SILA--AGSFDSTISIWGKEEDADPQDDFPETELLAII-E 126
                H  +V+++++ PH   ILA   G+ D  + IW  +      D    +++  +I  
Sbjct: 450 -----HTAAVKAMAWSPHRRGILATGGGTADKRLKIWNVKTSVKLHDVDTASQVCNMIWS 504

Query: 127 GHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSE 186
            + NE+   S  +S Y L          +W+ + L    E +++L+ H+  V H+   ++
Sbjct: 505 KNTNEI-ITSHGYSKYNLT---------LWDGNTL----EPMAILKGHSFRVLHMTLSTD 550

Query: 187 MHLLASSSYDDTIRLWK 203
              + S + D+T+R WK
Sbjct: 551 GTTVVSGAGDETLRYWK 567

>Sklu_1513.2 YGL190C, Contig c1513 930-2276
          Length = 448

 Score = 37.0 bits (84), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 52/114 (45%), Gaps = 23/114 (20%)

Query: 112 PQD--DFPETELLA----IIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGE-E 164
           PQD  DF  ++       I+    + + AV + HSG YLA+  R   V ++E +     E
Sbjct: 2   PQDNFDFKFSQCFGDKADIVVTEADIITAVEFDHSGDYLATGDRGGRVVLFERNNSKHCE 61

Query: 165 YECLSVLQEH------------AQDVKHVVW---HSEMHLLASSSYDDTIRLWK 203
           Y+ L+  Q H             + +  + W    ++ H L S++ D TI+LWK
Sbjct: 62  YKFLTEFQSHDAEFDYLKSLEIEEKINQIKWCRPTNQSHFLLSTN-DKTIKLWK 114

>ADR090W [1831] [Homologous to ScYDL195W (SEC31) - SH]
           complement(868744..872445) [3702 bp, 1233 aa]
          Length = 1233

 Score = 37.4 bits (85), Expect = 0.020,   Method: Composition-based stats.
 Identities = 46/202 (22%), Positives = 75/202 (37%), Gaps = 42/202 (20%)

Query: 127 GHENEVKAVSW--SHSGYYLASCSRDKS--VWIWEADELGEEYECLSVLQEHAQDVKHVV 182
           G +N++  V W  S+S     +   D    + +W+        + +S  Q H++ +  + 
Sbjct: 200 GLKNQLAVVEWHPSNSTRVATATGNDNEPVILVWDLRNANMPLQVMS--QGHSKGILSLD 257

Query: 183 W--HSEMHLLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWC--SDFEKSESSLRLAS 238
           W  H E  L+ SS  D+T  LW  +           G+    WC  + F      L  AS
Sbjct: 258 WCKHDE-KLMLSSGRDNTCILWNPEEAQKLTQYPTRGN----WCFKTKFAPEAPDL-FAS 311

Query: 239 CSDDSTVRV--------------------------WNYVEEEENGEDVWAQEAILPNVHS 272
            S D+ ++V                          WN V + E+ E     +   P  HS
Sbjct: 312 ASFDNKIQVQTLQNLANKLDLDETAFKQQESEADFWNNVSQSESKEKPVVTKIQAPAWHS 371

Query: 273 RAVYSVSWSLDGYIASVGSDGL 294
           +   +  W+  G I  + SDGL
Sbjct: 372 KKSPAAHWAFGGKIVRITSDGL 393

>AFR199C [3391] [Homologous to ScYMR116C (ASC1) - SH]
           (799876..800298,800493..801074) [1005 bp, 334 aa]
          Length = 334

 Score = 36.6 bits (83), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 47/199 (23%), Positives = 81/199 (40%), Gaps = 38/199 (19%)

Query: 72  DDSTHKKSVRSVSFRPHSSILA------------AGSFDSTISIWGKEEDADPQDDFPET 119
           +D  +   VRS  F+ HS I+             + S+D T+ +W          D    
Sbjct: 66  EDQQYGVPVRS--FKGHSHIVQDCTVTHDGKYALSASWDKTLRLW----------DLQSG 113

Query: 120 ELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVK 179
           + +    GH+++V +VS       + S SRDK+V +W  + +G   +C+  L  H   V 
Sbjct: 114 KCIKRFVGHKSDVMSVSIDPRATQIVSASRDKTVKVW--NTVG---DCVVTLLGHNDWVS 168

Query: 180 HV-VWHSEMH----LLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSL 234
           +V +  SE       + S+  D  +++W  D   +   A   GH    + +    S    
Sbjct: 169 NVRIAPSEKSDDAVTVISAGMDKVVKVW--DLQSFTIEADFIGHNN--YVTTVTPSPDGS 224

Query: 235 RLASCSDDSTVRVWNYVEE 253
             AS   D  + +WN  E+
Sbjct: 225 IFASAGKDGQIILWNLNEK 243

 Score = 36.2 bits (82), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 49/220 (22%), Positives = 83/220 (37%), Gaps = 27/220 (12%)

Query: 76  HKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAV 135
           HK  V SVS  P ++ + + S D T+ +W    D            +  + GH + V  V
Sbjct: 122 HKSDVMSVSIDPRATQIVSASRDKTVKVWNTVGDC-----------VVTLLGHNDWVSNV 170

Query: 136 SWSHS-----GYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLL 190
             + S        + S   DK V +W+      E + +     H   V  V    +  + 
Sbjct: 171 RIAPSEKSDDAVTVISAGMDKVVKVWDLQSFTIEADFIG----HNNYVTTVTPSPDGSIF 226

Query: 191 ASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNY 250
           AS+  D  I LW  +    + A      K  V+   F  +   L  A+ S    +++++ 
Sbjct: 227 ASAGKDGQIILWNLNE---KTALYTLDAKDEVFAVAFSPNRYWLTAATASG---IKIFD- 279

Query: 251 VEEEENGEDVWAQEAILPNVHSRAVYSVSWSLDGYIASVG 290
           +EE    +D+  + A           S++WS DG     G
Sbjct: 280 LEERTIVDDLKPEFAGYNKAQDPHAVSLAWSADGQTLFAG 319

>Sklu_2318.1 YKL213C, Contig c2318 605-2740 reverse complement
          Length = 711

 Score = 37.0 bits (84), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 24/106 (22%), Positives = 47/106 (44%), Gaps = 11/106 (10%)

Query: 143 YLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLW 202
           +  + S D ++ +W  ++L + +  +     H   ++H+    +    AS S D T+++ 
Sbjct: 151 FFLTASADCTIKLWHGNKLIKTFSGI-----HKDVIRHLDISPDGETFASCSNDGTVKIN 205

Query: 203 KEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVW 248
             D +         GH+  V+   F  +     L SC +D +VRVW
Sbjct: 206 DMDGN---ILKTFTGHESFVYSVKFLPNGD---LVSCGEDRSVRVW 245

 Score = 32.0 bits (71), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 40/169 (23%), Positives = 72/169 (42%), Gaps = 47/169 (27%)

Query: 120 ELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADEL---------GEEY----- 165
           +L A ++GHE +VK+V   +    +ASCSRD +V +W  ++           E++     
Sbjct: 3   KLSADLKGHEQDVKSVVAINDSQ-VASCSRDGTVRVWSNNDGVWNGVIAHNSEKFINSLC 61

Query: 166 --ECLSVLQEHAQD----------------VKHVVWH--------SEMHLLASSSYDDTI 199
             +   +L    QD                V  ++ H        S+ + + SSS+D T 
Sbjct: 62  YDKSSQLLFYGGQDTLVGGISPLATTDEDPVYMLIGHKGNVCSLSSKNNFVISSSWDKTA 121

Query: 200 RLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVW 248
           ++W   +  ++    L GH  +VW + F   +     AS   D T+++W
Sbjct: 122 KVWHNGSAIYD----LVGHSASVWDAKFLPEKDFFLTASA--DCTIKLW 164

 Score = 30.8 bits (68), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 32/130 (24%), Positives = 48/130 (36%), Gaps = 19/130 (14%)

Query: 76  HKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEG-HENEVKA 134
           H  SV    F P        S D TI +W               +L+    G H++ ++ 
Sbjct: 136 HSASVWDAKFLPEKDFFLTASADCTIKLWHG------------NKLIKTFSGIHKDVIRH 183

Query: 135 VSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSS 194
           +  S  G   ASCS D +V I + D        L     H   V  V +     L+ S  
Sbjct: 184 LDISPDGETFASCSNDGTVKINDMDG-----NILKTFTGHESFVYSVKFLPNGDLV-SCG 237

Query: 195 YDDTIRLWKE 204
            D ++R+W +
Sbjct: 238 EDRSVRVWSK 247

 Score = 30.8 bits (68), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 28/55 (50%), Gaps = 1/55 (1%)

Query: 165 YECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDADDWECAAVLNGHK 219
           Y+  + L+ H QDVK VV  ++  + AS S D T+R+W  +   W      N  K
Sbjct: 2   YKLSADLKGHEQDVKSVVAINDSQV-ASCSRDGTVRVWSNNDGVWNGVIAHNSEK 55

 Score = 30.0 bits (66), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 52/217 (23%), Positives = 85/217 (39%), Gaps = 32/217 (14%)

Query: 77  KKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVS 136
           +K + S+ +   S +L  G  D+ +   G        D+ P   L+    GH+  V   S
Sbjct: 54  EKFINSLCYDKSSQLLFYGGQDTLV---GGISPLATTDEDPVYMLI----GHKGNV--CS 104

Query: 137 WSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYD 196
            S    ++ S S DK+  +W           +  L  H+  V    +  E     ++S D
Sbjct: 105 LSSKNNFVISSSWDKTAKVWHNGS------AIYDLVGHSASVWDAKFLPEKDFFLTASAD 158

Query: 197 DTIRLWKEDADDWECAAVLNG-HKGTVWCSDFEKSESSLRLASCSDDSTVRVWNYVEEEE 255
            TI+LW  +    +     +G HK  +   D   S      ASCS+D TV++      + 
Sbjct: 159 CTIKLWHGN----KLIKTFSGIHKDVIRHLDI--SPDGETFASCSNDGTVKI-----NDM 207

Query: 256 NGEDVWAQEAILPNVHSRAVYSVSWSLDGYIASVGSD 292
           +G  +          H   VYSV +  +G + S G D
Sbjct: 208 DGNILKTFTG-----HESFVYSVKFLPNGDLVSCGED 239

>CAGL0B01529g 137174..138283 highly similar to sp|P39108
           Saccharomyces cerevisiae YDR142c PAS7 peroxisomal import
           protein - peroxin, start by similarity
          Length = 369

 Score = 36.6 bits (83), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 38/136 (27%), Positives = 64/136 (47%), Gaps = 26/136 (19%)

Query: 45  LMATSSSDRKIKLVNLKNMD-------FQ---LVEELDDSTHKKSVRSVSFRPH-SSILA 93
           ++ATS  D  I + +++ +        FQ   LV E+ ++ H  +V+ V + PH S IL 
Sbjct: 236 IIATSGVDNSIGIWDIRMLPNSSNQQGFQTGTLVNEIVNA-HDLAVKKVCWSPHHSDILL 294

Query: 94  AGSFDSTISIWGKEEDADPQDDFPETE---------LLAIIEGHENEVKAVSWSHSGY-- 142
           + S+D +  IW   +D   Q++ P  +         LL+  + H   V    WS  G   
Sbjct: 295 STSYDMSCKIW---KDVSVQNNVPTGKTNGSLLSNGLLSNFKHHTEFVFGADWSLWGIPG 351

Query: 143 YLASCSRDKSVWIWEA 158
           Y+A+   D +V+IW  
Sbjct: 352 YVATAGWDSNVFIWNG 367

>Scas_710.33
          Length = 498

 Score = 36.6 bits (83), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 45/97 (46%), Gaps = 18/97 (18%)

Query: 124 IIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGE--EYECLSVLQEH------- 174
           II    + + AV + HSG Y A+  +   V ++E +++ +  EY+ ++  Q H       
Sbjct: 22  IITTEADVITAVEFDHSGDYFATGDKGGRVVLFERNKMAKNCEYKFMTEFQSHDAEFDYL 81

Query: 175 -----AQDVKHVVW---HSEMHLLASSSYDDTIRLWK 203
                 + +  + W       H L S++ D TI+LWK
Sbjct: 82  KSLEIEEKINQIKWLKPAQRAHFLLSTN-DKTIKLWK 117

>ABR101C [693] [Homologous to ScYMR049C (ERB1) - SH]
           (567357..569840) [2484 bp, 827 aa]
          Length = 827

 Score = 36.6 bits (83), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 37/78 (47%), Gaps = 7/78 (8%)

Query: 211 CAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNYVEEEENGEDVWAQEAI-LPN 269
           C+ V  GHKG +     + S   L LA+ SDD TVRVW  +     G +V+    + + N
Sbjct: 455 CSTVYAGHKGKIRTLSIDPS--GLWLATGSDDGTVRVWEIL----TGREVYKATIVDIKN 508

Query: 270 VHSRAVYSVSWSLDGYIA 287
                + +V W+ D  + 
Sbjct: 509 NQDDHIETVEWNPDKTVG 526

 Score = 32.3 bits (72), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 36/66 (54%), Gaps = 2/66 (3%)

Query: 123 AIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQD--VKH 180
            +  GH+ +++ +S   SG +LA+ S D +V +WE     E Y+   V  ++ QD  ++ 
Sbjct: 457 TVYAGHKGKIRTLSIDPSGLWLATGSDDGTVRVWEILTGREVYKATIVDIKNNQDDHIET 516

Query: 181 VVWHSE 186
           V W+ +
Sbjct: 517 VEWNPD 522

 Score = 28.5 bits (62), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 17/29 (58%)

Query: 76  HKKSVRSVSFRPHSSILAAGSFDSTISIW 104
           HK  +R++S  P    LA GS D T+ +W
Sbjct: 462 HKGKIRTLSIDPSGLWLATGSDDGTVRVW 490

>CAGL0J06512g complement(620516..622153) similar to sp|Q04199
           Saccharomyces cerevisiae YML102w CAC2, start by
           similarity
          Length = 545

 Score = 36.6 bits (83), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 34/150 (22%), Positives = 62/150 (41%), Gaps = 24/150 (16%)

Query: 74  STHKKSVRSVSFRPHSSILAAGSFDSTISIWG--KEEDADPQD---DFP----------- 117
           S H+++V  + F    ++LA+   D  + +W    EE    Q    D P           
Sbjct: 77  SLHEQAVNVIRFDHRGNVLASAGDDGQVLLWKLTNEETRKKQQRMGDEPVEGDGWAVWKR 136

Query: 118 ----ETELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQE 173
                 +L  +  G  +E+  +SWS    YL + S D S+ ++  D       C++  ++
Sbjct: 137 LRGTANDLDNMPGGGASEIYDLSWSPDDKYLVTASMDNSLKVFNVD----TGNCVAFAKD 192

Query: 174 HAQDVKHVVWHSEMHLLASSSYDDTIRLWK 203
           H   V+ V W      + S S D +I +++
Sbjct: 193 HNHYVQGVTWDPLNQYIISQSVDRSINIYE 222

>AGL190W [4122] [Homologous to ScYDR142C (PEX7) - SH]
           complement(341382..342494) [1113 bp, 370 aa]
          Length = 370

 Score = 36.2 bits (82), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 54/235 (22%), Positives = 92/235 (39%), Gaps = 58/235 (24%)

Query: 72  DDSTHKKSVRSVSFRPH-SSILAAGSFDSTISIWG-KEEDADPQDDFPETELLAIIEGHE 129
           D + +K  +    F PH  +++ + S +S +S++  ++  A  Q  F     L  +    
Sbjct: 171 DAADNKDCIYQAQFSPHDPNLVMSCSGNSYVSLFDLRQPAASNQQRFIAHSGLEALSCDF 230

Query: 130 NEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYEC-------LSVLQEHAQDVKHVV 182
           N+ +        + +A+   DK V +W+   + +           ++ +Q H+  V+ VV
Sbjct: 231 NKYRP-------HVIATGGVDKMVKVWDLRMVRQTLTTSRTAPVSINEMQGHSLAVRKVV 283

Query: 183 WHSE-MHLLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSD 241
           W     ++L S+SYD T R W + AD          H G    SD ++         CS 
Sbjct: 284 WSPHHSNILLSTSYDMTCRAWHDLAD-----GPGGQHSGRTNNSDPQR--------GCS- 329

Query: 242 DSTVRVWNYVEEEENGEDVWAQEAILPNVHSRAVYSVSWSL---DGYIASVGSDG 293
                   YV  +                HS  V+   WSL    GY+A+ G DG
Sbjct: 330 --------YVFSK----------------HSEFVFGADWSLWGQPGYVATTGWDG 360

>AFL006C [3187] [Homologous to ScYAR003W (SWD1) - SH]
           (425925..427226) [1302 bp, 433 aa]
          Length = 433

 Score = 36.2 bits (82), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 40/82 (48%), Gaps = 6/82 (7%)

Query: 83  VSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGY 142
           + F P    LA G  + ++ I+    D D +   P + L     GH   V++V+WS  G 
Sbjct: 33  LEFSPGGDYLAVGCSNGSLVIY----DMDTKK--PISVLGNHGGGHVRAVQSVAWSQCGR 86

Query: 143 YLASCSRDKSVWIWEADELGEE 164
           YL S SRD  V +W+   +G +
Sbjct: 87  YLWSSSRDWRVKMWDLAAVGRQ 108

>CAGL0M06193g 643917..644867 similar to sp|P38123 Saccharomyces
           cerevisiae YBR175w, start by similarity
          Length = 316

 Score = 35.8 bits (81), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 45/206 (21%), Positives = 88/206 (42%), Gaps = 25/206 (12%)

Query: 53  RKIKLVNLKNMDFQLVEELDDSTHKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADP 112
           R I++   +   +QL E L    H   V  + + P    +A+ S D T+ +  ++     
Sbjct: 32  RGIEVYIYETSGYQLRETLVLE-HAAGVSQICWSPDGKCIASCSDDFTVVVTHRQ----- 85

Query: 113 QDDFPETELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQ 172
                   LL  + GH   V ++ +++ G  L + S D+S+ +W+          +  + 
Sbjct: 86  ------LGLLHRLVGHTAPVISLCYNNKGNLLFTSSMDESIKVWDV----LTGTVMKTMS 135

Query: 173 EHAQDVKHV-VWHSEMHLLASSSYDDTIRLWKEDADDWECAAVLNGHK------GTVWCS 225
            H++ V  + +  ++  +L+S S+D  IR++  D     C   L   K      G V  +
Sbjct: 136 AHSEPVVSIDLSDNDGSILSSGSHDGLIRIF--DTATGHCLKTLTYDKDWQSETGVVPIA 193

Query: 226 DFEKSESSLRLASCSDDSTVRVWNYV 251
             + S ++  L   S D  V++W+ V
Sbjct: 194 KVKFSANTKYLLVKSYDGVVKIWDSV 219

>CAGL0C02937g 290289..291692 similar to sp|P39946 Saccharomyces
           cerevisiae YOR269w PAC1, hypothetical start
          Length = 467

 Score = 36.2 bits (82), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 64/251 (25%), Positives = 105/251 (41%), Gaps = 72/251 (28%)

Query: 23  LELLKSLKLH-----TDKLWSIDCSKGLMATSSSDRKIKL--VNLKNMDFQLVEELDDST 75
           L+L++S   H     + K W  D +  L+A+SS D  +K+  VN    D + ++    S 
Sbjct: 211 LKLIRSFNAHDSTVSSQKTWQKD-NDVLLASSSRDATVKVWRVN----DSRCLQSF--SP 263

Query: 76  HKKSVRSVSFRPHSSILAAGSFDSTISI--W--GKEEDADPQDDFPETELLAIIEGHENE 131
           H + V+S+        + +GS DST+ +  W  G         +FP  E + II   +++
Sbjct: 264 HSEWVKSIDVL--DEYILSGSLDSTLRLTHWPSGNGLSVGTGHEFP-IERVLIIPFSDSK 320

Query: 132 VKAVSWS----HSGY------YLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHV 181
           +    +     HS +      Y AS +RD ++ IWE          L  L+ ++  V   
Sbjct: 321 ICTSPYRDQNEHSAFAPLRFKYCASAARDNTIKIWEVP--------LPQLKPNSAPVP-- 370

Query: 182 VWHSEMHLLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLR---LAS 238
                      S+ + T          ++C   L GH  T W  D +     LR   L S
Sbjct: 371 -----------STTNTT----------FKCVMTLRGH--TSWVKDLK-----LRGDHLFS 402

Query: 239 CSDDSTVRVWN 249
           CSDD T++ W+
Sbjct: 403 CSDDETIKCWD 413

 Score = 28.9 bits (63), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 33/62 (53%), Gaps = 2/62 (3%)

Query: 189 LLASSSYDDTIRLWKEDADDWECAAV--LNGHKGTVWCSDFEKSESSLRLASCSDDSTVR 246
           L++++S D  I ++   ++  E   +   N H  TV      + ++ + LAS S D+TV+
Sbjct: 189 LVSTTSKDAQINVYDHSSNTGELKLIRSFNAHDSTVSSQKTWQKDNDVLLASSSRDATVK 248

Query: 247 VW 248
           VW
Sbjct: 249 VW 250

>Kwal_27.12586
          Length = 509

 Score = 36.2 bits (82), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 28/132 (21%), Positives = 56/132 (42%), Gaps = 9/132 (6%)

Query: 118 ETELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQD 177
           E+  L  + GH   + A  ++     L S S DK++ +W +  L       +    +   
Sbjct: 324 ESRPLGKLNGHSATITAFDFNSENNMLLSGSDDKTLRVWRSGSLSSS----NCFMGNTLG 379

Query: 178 VKHVVWHSEMHLLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLA 237
           +    W  +  ++A +S D ++RLW    +  +  ++++G    ++C     S   L+ A
Sbjct: 380 ITSAFWIDDDKVIA-TSLDGSVRLWSHLTNTLQAISMVDGVP--IFCGSL--SPDKLKFA 434

Query: 238 SCSDDSTVRVWN 249
               D  V V+N
Sbjct: 435 IGKMDGEVTVYN 446

 Score = 28.9 bits (63), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 41/90 (45%), Gaps = 9/90 (10%)

Query: 164 EYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDADDWECAAVLN--GHKGT 221
           E   L  L  H+  +    ++SE ++L S S D T+R+W+  +       + N  G    
Sbjct: 324 ESRPLGKLNGHSATITAFDFNSENNMLLSGSDDKTLRVWRSGSLSSSNCFMGNTLGITSA 383

Query: 222 VWCSDFEKSESSLRLASCSDDSTVRVWNYV 251
            W  D +   +SL       D +VR+W+++
Sbjct: 384 FWIDDDKVIATSL-------DGSVRLWSHL 406

>Scas_706.24
          Length = 460

 Score = 36.2 bits (82), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 45/208 (21%), Positives = 85/208 (40%), Gaps = 13/208 (6%)

Query: 46  MATSSSDRKIKLVNLKNMDFQLVEELDD---STHKKSVRSVSFRPHSSILAAGSFDSTIS 102
            AT S+  +I + N++N     V +L      + K  V   ++ P      A +    + 
Sbjct: 121 FATVSNSNEIFIWNIQNDSSPTVNKLRTLSLPSSKVKVNRCAYDPRGIWFFAATKSDCLY 180

Query: 103 IWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWE-ADEL 161
           I+  +E+       P    +  I    + + ++SW +SG ++    R   + + E +D+ 
Sbjct: 181 IYNVKEEHSMVASLP----VHSISDENDTIYSISWDNSGKFIFIGFRSGKLALLEVSDDT 236

Query: 162 GEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDADDWECAAVLNGHKGT 221
           GE    L ++Q H   +  +        + + S D +  LW  D     C+ +++  +G 
Sbjct: 237 GEMTFKL-IVQAHRSAISVIKMDPVGRFVITGSTDGSCALW--DTSTLTCSLIIDDMEGA 293

Query: 222 VWCSDFEKSESSLRLASCSDDSTVRVWN 249
           V   D +       LA CS D  VR +N
Sbjct: 294 VISMDVD--HLGKILAVCSTDDLVRFYN 319

 Score = 30.8 bits (68), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 53/239 (22%), Positives = 89/239 (37%), Gaps = 38/239 (15%)

Query: 129 ENEVKAVSWSHSGYYLASCSRDKS--VWIWEADELGEEYECLSVLQEHAQD--VKHVVWH 184
            NEV A+ +  SG YLA    D S  VW+ +     +   C  +   +  D  +  + ++
Sbjct: 56  PNEVLALQFHPSGAYLAYGRMDGSLTVWVLQGHSFNKAKNCY-IPDANGNDKVINDLSFN 114

Query: 185 -SEMHLLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDS 243
            SE++  A+ S  + I +W    D       L                S +++  C+ D 
Sbjct: 115 PSELNEFATVSNSNEIFIWNIQNDSSPTVNKLR---------TLSLPSSKVKVNRCAYDP 165

Query: 244 TVRVWNYVEEEE------NGEDVWAQEAILPNVHSRA-----VYSVSWSLDGYIASVGSD 292
              +W +   +       N ++  +  A LP VHS +     +YS+SW   G    +G  
Sbjct: 166 R-GIWFFAATKSDCLYIYNVKEEHSMVASLP-VHSISDENDTIYSISWDNSGKFIFIGFR 223

Query: 293 ----GLLXXXXXXXXXXXXXXXQQHEAHGIYEINVVKWATVDDSVLLLTGGDDGCANIW 347
                LL               Q H +     I+V+K   V     ++TG  DG   +W
Sbjct: 224 SGKLALLEVSDDTGEMTFKLIVQAHRS----AISVIKMDPV--GRFVITGSTDGSCALW 276

 Score = 29.3 bits (64), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 30/143 (20%), Positives = 58/143 (40%), Gaps = 17/143 (11%)

Query: 25  LLKSLKLHT-----DKLWSI--DCSKGLMATSSSDRKIKLVNLKNMDFQLVEELDDSTHK 77
           ++ SL +H+     D ++SI  D S   +       K+ L+ + +   ++  +L    H+
Sbjct: 190 MVASLPVHSISDENDTIYSISWDNSGKFIFIGFRSGKLALLEVSDDTGEMTFKLIVQAHR 249

Query: 78  KSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSW 137
            ++  +   P    +  GS D + ++W          D        II+  E  V ++  
Sbjct: 250 SAISVIKMDPVGRFVITGSTDGSCALW----------DTSTLTCSLIIDDMEGAVISMDV 299

Query: 138 SHSGYYLASCSRDKSVWIWEADE 160
            H G  LA CS D  V  +  ++
Sbjct: 300 DHLGKILAVCSTDDLVRFYNIND 322

>Sklu_2438.4 YER082C, Contig c2438 8089-9810 reverse complement
          Length = 573

 Score = 36.2 bits (82), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 44/98 (44%), Gaps = 12/98 (12%)

Query: 66  QLVEELDDSTHKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAII 125
           QLV EL   T      +++  P ++++  G  + T+++W       P    P   LL+  
Sbjct: 243 QLVAEL--RTKLGPTTAMAQNPWNAVMHLGHSNGTVTLWA------PNMPTPLVRLLSA- 293

Query: 126 EGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGE 163
                 + +V+    GYY+A+   DKS+ IW+     E
Sbjct: 294 ---RGPITSVAIDRQGYYMATTGADKSMKIWDIRNFRE 328

>KLLA0F22000g complement(2044973..2047354) similar to sp|P42935
           Saccharomyces cerevisiae YGR200c ELP2 90 kDa subunit of
           elongator and elongating RNA polymerase II holoenzyme
           singleton, start by similarity
          Length = 793

 Score = 36.2 bits (82), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 55/124 (44%), Gaps = 26/124 (20%)

Query: 76  HKKSVRSVSFR---PHSSILAAGSFDSTISIW---GKEEDADPQDDFPETELL------- 122
           H+  ++S+ FR   P   +LA+GS D  I +W     E+    ++D  +  LL       
Sbjct: 200 HEDWIKSLVFRETVPGDYLLASGSQDRYIRLWRIRTNEKIDTSEEDEKKLTLLSNKIYKF 259

Query: 123 -------------AIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLS 169
                        A+I GH++ + ++ W  +   L + + D +V +WE D +   + C S
Sbjct: 260 DISADVHVAINFEALIMGHDDWISSLQWHKTKLQLLTSTADTAVMVWEPDTISGIWICSS 319

Query: 170 VLQE 173
            L E
Sbjct: 320 RLGE 323

 Score = 35.8 bits (81), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 33/141 (23%), Positives = 57/141 (40%), Gaps = 8/141 (5%)

Query: 121 LLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGE----EYECLSVLQEHAQ 176
           +   ++GH  EV  V +      + S S D  V +W   +L E    E EC+ V++ H  
Sbjct: 48  VFKTLKGHTAEVTCVRFVKGTDMMVSASEDFEVRVWNFPKLREGHMDEVECIQVIKHHKH 107

Query: 177 DVKHVVWHSEMHLLASSSYDDTIRLWKEDADDWECAAVLNGHKGT--VWCSDFEKSESSL 234
            +   V+    +LL     D +I +W    D +      +  KG   +  S  E  ++  
Sbjct: 108 TI--TVFAVLKNLLVVGCADGSISVWSFIEDQYVLQEEFSVQKGVFPLCLSMHEIEKTQF 165

Query: 235 RLASCSDDSTVRVWNYVEEEE 255
            LA    +  V +++ V   E
Sbjct: 166 ILAIGGTNVNVFIYSLVSNSE 186

 Score = 34.7 bits (78), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 37/83 (44%), Gaps = 4/83 (4%)

Query: 198 TIRLWKE-DADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNYVEEEEN 256
           TI LWK  D         L GH   V C  F K      + S S+D  VRVWN+ +  E 
Sbjct: 34  TIALWKSMDTSHHGVFKTLKGHTAEVTCVRFVKGTD--MMVSASEDFEVRVWNFPKLREG 91

Query: 257 GED-VWAQEAILPNVHSRAVYSV 278
             D V   + I  + H+  V++V
Sbjct: 92  HMDEVECIQVIKHHKHTITVFAV 114

>KLLA0A08822g 772565..774313 similar to sp|P53197 Saccharomyces
           cerevisiae YGL003c CDH1 substrate-specific activator of
           APC-dependent proteolysis, start by similarity
          Length = 582

 Score = 35.8 bits (81), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 47/220 (21%), Positives = 96/220 (43%), Gaps = 55/220 (25%)

Query: 26  LKSLKLHTDKLWSIDCSKGLMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSVSF 85
           +++L  H D++  +  +  ++++ S DRKI   +++  +    E++D  TH + V  + +
Sbjct: 353 IRTLSGHVDRVACLSWNNHVLSSGSRDRKILHRDVRAPE-PFFEQID--THSQEVCGLKW 409

Query: 86  RPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWS-HSGYYL 144
             + + LA+G  D+ + ++          D    + +  +E H   VKA++WS H+   L
Sbjct: 410 NVNENKLASGGNDNMVYVY----------DGTLRQPMLSMEEHTAAVKAMAWSPHTRGVL 459

Query: 145 AS--CSRDKSVWIW---EADELGE------------------------------------ 163
           A+   + DK + IW   +A +L E                                    
Sbjct: 460 ATGGGTADKKLKIWNISKAVKLNEVDTGSQLCNMLWSKNTDEIITSHGYSKYNLTLWNYP 519

Query: 164 EYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWK 203
             E ++VL+ H+  V H+   ++   + S + D+T+R WK
Sbjct: 520 TLEPMAVLKGHSFRVLHLTLSADGTTVVSGAGDETLRYWK 559

>CAGL0J03806g 361174..362436 similar to sp|Q12363 Saccharomyces
           cerevisiae YOR230w WTM1 or sp|Q12206 Saccharomyces
           cerevisiae YOR229w WTM2, hypothetical start
          Length = 420

 Score = 35.8 bits (81), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 48/118 (40%), Gaps = 16/118 (13%)

Query: 159 DELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDADD---WECAAVL 215
           D  G+  E L V++     V H V   + H+ AS S D+ IR W     D   W  +   
Sbjct: 194 DNAGKPSEVLRVIRVPGTTVTHSVRFLDNHVFASCSDDNVIRFWDTRTADKPLWSLSDPQ 253

Query: 216 NGH---------KGTVWCSDFEKSESSLRLASCSDDSTVRVWNYVEEEENGEDVWAQE 264
           NG           G ++ + F      L  A   +D+T+ + N     +NGE+   +E
Sbjct: 254 NGSLTAFDVSQLSGNLFATGFSTGVVKLWDARAVEDATLDLSN----RQNGEEPIQKE 307

>KLLA0E11297g complement(994770..996308) similar to sp|P38262
           Saccharomyces cerevisiae YBR103w SIF2 SIR4P interacting
           protein, start by similarity
          Length = 512

 Score = 35.8 bits (81), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 50/233 (21%), Positives = 88/233 (37%), Gaps = 50/233 (21%)

Query: 75  THKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKA 134
           + ++ + SVS+ P   ++  G+    + +W K+            +L  I++ H + + A
Sbjct: 207 SEEEPIISVSWSPDGELVLTGTTSGELRLWNKQ-----------GKLKNILDSHRSPIVA 255

Query: 135 VSWSHSGYYLASCSRDKSVWIW--------------EADELGEEYECLSVLQEHAQDVKH 180
           + W+    +L +      V +W              E D   E  + L +  E  +  K 
Sbjct: 256 MKWNQDCTHLLTTDVSNVVILWSTLTGTQLQHFSFKEGDI--ENEDSLGIDLEWVETDKF 313

Query: 181 VVWHSEMHLLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCS 240
           V+      LL  +  ++            +    L GH  T+   +F KS  SL   S S
Sbjct: 314 VIPGPGGSLLVYTIGNN------------KPLGRLLGHTSTITTLEFNKSNKSL--LSAS 359

Query: 241 DDSTVRVWNYVEEEENGEDVWAQEAILPNVHSRAVYSVSWSLDGYIASVGSDG 293
           DD+T++VW        G    A +      H++ + S  W  D  I S   DG
Sbjct: 360 DDNTIKVW------RGGNSSAANDF---TDHTKTISSAHWINDDLIISTAYDG 403

 Score = 31.6 bits (70), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 18/81 (22%), Positives = 39/81 (48%), Gaps = 5/81 (6%)

Query: 122 LAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHV 181
           L  + GH + +  + ++ S   L S S D ++ +W     G      +   +H + +   
Sbjct: 333 LGRLLGHTSTITTLEFNKSNKSLLSASDDNTIKVWR----GGNSSAANDFTDHTKTISSA 388

Query: 182 VWHSEMHLLASSSYDDTIRLW 202
            W ++  L+ S++YD T+++W
Sbjct: 389 HWIND-DLIISTAYDGTVKVW 408

>YMR116C (ASC1) [4073] chr13
           complement(499455..499877,500151..500687) Ribosomal
           protein of the 40S ribosomal subunit that influences
           translational efficiency and cell size, contains two WD
           (WD-40) repeats [960 bp, 319 aa]
          Length = 319

 Score = 35.4 bits (80), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 43/207 (20%), Positives = 78/207 (37%), Gaps = 51/207 (24%)

Query: 72  DDSTHKKSVRSVSFRPHSSILA------------AGSFDSTISIWGKEEDADPQDDFPET 119
           DD      VRS  F+ HS I+             + S+D T+ +W          D    
Sbjct: 50  DDQKFGVPVRS--FKGHSHIVQDCTLTADGAYALSASWDKTLRLW----------DVATG 97

Query: 120 ELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVK 179
           E      GH+++V +V        + S SRDK++ +W       + +CL+ L  H     
Sbjct: 98  ETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTI-----KGQCLATLLGHND--- 149

Query: 180 HVVWHSEMHLLASSSYDD------------TIRLWKEDADDWECAAVLNGHKGTVWCSDF 227
              W S++ ++ +   DD             ++ W  + + ++  A   GH   +  +  
Sbjct: 150 ---WVSQVRVVPNEKADDDSVTIISAGNDKMVKAW--NLNQFQIEADFIGHNSNI--NTL 202

Query: 228 EKSESSLRLASCSDDSTVRVWNYVEEE 254
             S     +AS   D  + +WN   ++
Sbjct: 203 TASPDGTLIASAGKDGEIMLWNLAAKK 229

>Sklu_2431.8 YBR195C, Contig c2431 12732-14009 reverse complement
          Length = 425

 Score = 35.4 bits (80), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 39/149 (26%), Positives = 69/149 (46%), Gaps = 17/149 (11%)

Query: 16  TRLQRMSLELLKSLKLHTDKLWSIDCS---KGLMATSSSDRKIKLVNLKNMDFQLVEELD 72
           TR Q+  L   K  K H+  + S   +     L+ +  S  ++ L ++++++  L + LD
Sbjct: 280 TRAQKGVLSSTKDTKHHSRGINSSQFNYHNDMLLCSGDSTGRVNLWDIRDLETPL-KSLD 338

Query: 73  DSTHKKSVRSVSFRPH-SSILA-AGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHEN 130
              H  S+    + P+ S+ILA A   D  + +W   ++       P  ELL +  GH  
Sbjct: 339 ---HGSSISKTQWNPNLSTILATADQSDGLVKLWDIAQE-------PGEELLFVHGGHML 388

Query: 131 EVKAVSWS-HSGYYLASCSRDKSVWIWEA 158
            V  +SW+ H  + + S + D SV +W  
Sbjct: 389 GVNDISWNYHDPWLMCSVANDNSVQLWRP 417

>YMR093W (UTP15) [4051] chr13 (454014..455555) Protein component of
           U3 snoRNP (renamed small subunit processome) which is
           required for 18S biogenesis, has WD (WD-40) repeats
           [1542 bp, 513 aa]
          Length = 513

 Score = 35.4 bits (80), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 35/131 (26%), Positives = 56/131 (42%), Gaps = 14/131 (10%)

Query: 74  STHKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDF-PETELLAI-IEGHENE 131
           S  K  V S SFR    +L AG     +S++         D + P T LL+I    H   
Sbjct: 78  SRFKDVVYSASFRSDGKLLCAGDATGLVSVY---------DSYNPRTILLSINASTHPTH 128

Query: 132 VKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLA 191
           V     +     LA+ S D+   +W+     E    L+   ++ + +  +   +  HL+A
Sbjct: 129 VTKFH-TQDNKILATASDDRVTRLWDISNAYEPQLELTGATDYVRTLSFI--PAAPHLVA 185

Query: 192 SSSYDDTIRLW 202
           + SYD  IRL+
Sbjct: 186 TGSYDGLIRLY 196

 Score = 28.9 bits (63), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 37/61 (60%), Gaps = 4/61 (6%)

Query: 45  LMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSVSFRPHSS-ILAAGSFDSTISI 103
           ++AT+S DR  +L ++ N  ++   EL  +T    VR++SF P +  ++A GS+D  I +
Sbjct: 139 ILATASDDRVTRLWDISNA-YEPQLELTGAT--DYVRTLSFIPAAPHLVATGSYDGLIRL 195

Query: 104 W 104
           +
Sbjct: 196 Y 196

>Scas_693.22
          Length = 1145

 Score = 35.8 bits (81), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 31/134 (23%), Positives = 61/134 (45%), Gaps = 6/134 (4%)

Query: 124 IIEGHENEVKAVSWSHSGY-YLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVV 182
           ++ GH   +  ++++      LA+CS D  V  W+       +   S  +  A  VK   
Sbjct: 112 VLHGHSRAITDINFNPENPDILATCSVDTYVHAWDMRSPHRPFYTTSAWRSGASQVK--- 168

Query: 183 WHSEMHLLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDD 242
           W+ +   + +S++ + I +W           ++ GH  +V   DF + +SS  + S S+D
Sbjct: 169 WNYKDSNILASAHSNDIYIWDLRMGSTPLHKLV-GHDSSVNSIDFNRFKSS-EIMSSSND 226

Query: 243 STVRVWNYVEEEEN 256
            TV+ W+  +  +N
Sbjct: 227 GTVKFWDISKGSDN 240

>Scas_605.18
          Length = 424

 Score = 35.4 bits (80), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 52/232 (22%), Positives = 94/232 (40%), Gaps = 30/232 (12%)

Query: 125 IEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWH 184
           ++GH N++    WS     + S S+D  + IW+    G +   + +    +Q V      
Sbjct: 87  LKGHNNKISDFRWSRDSKSILSASQDGFMLIWDTAS-GLKRNAIPL---DSQWVLSCALS 142

Query: 185 SEMHLLASSSYDDTI---RLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSD 241
              +L AS+  ++     R+ KE+       ++  GH  T + SD E  ++S  + + S 
Sbjct: 143 PSGNLAASAGLNNNCTIYRVSKENRVQQNVVSIFKGH--TCYISDIEFLDNS-HIITSSG 199

Query: 242 DSTVRVWNYVEEEENGE------DVWAQEAILPNVHSRAVYSVSWSLDGYIASVGSDGLL 295
           D T  +W+  + +   E      DV A     P+       ++        AS GSDG  
Sbjct: 200 DMTCALWDIPKAKRVREYADHLGDVLALALPPPSADENTGANI-------FASCGSDGY- 251

Query: 296 XXXXXXXXXXXXXXXQQHEAHGIYEINVVKWATVDDSVLLLTGGDDGCANIW 347
                          Q+  A    ++N +++    D   ++TGGDDG  N++
Sbjct: 252 ---TYIWDTRTSAAVQKFFASDT-DVNAIQF--FKDGNSIVTGGDDGVINMF 297

 Score = 29.6 bits (65), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 36/74 (48%), Gaps = 4/74 (5%)

Query: 132 VKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLA 191
           V ++ +S+SG  + +C  D    IW+      + E +  L+ H+  V  V    +   + 
Sbjct: 353 VVSLDFSNSGRLMFACYTDLGCIIWDV----LKAEIVGKLEGHSNRVSSVRTSPDGLGVC 408

Query: 192 SSSYDDTIRLWKED 205
           + S+D T+R+W  +
Sbjct: 409 TGSWDSTMRIWSPN 422

 Score = 29.3 bits (64), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 25/47 (53%)

Query: 115 DFPETELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADEL 161
           D  + E++  +EGH N V +V  S  G  + + S D ++ IW  + +
Sbjct: 378 DVLKAEIVGKLEGHSNRVSSVRTSPDGLGVCTGSWDSTMRIWSPNYM 424

>CAGL0L02761g complement(320826..322085) similar to sp|P18851
           Saccharomyces cerevisiae YOR212w STE4, hypothetical
           start
          Length = 419

 Score = 35.4 bits (80), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 42/180 (23%), Positives = 76/180 (42%), Gaps = 24/180 (13%)

Query: 122 LAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHA-----Q 176
           + I++GH N++    WS     + S S+D  + +W++         L+ L+  A     Q
Sbjct: 78  VGILKGHTNKIADFRWSRDSKLILSASQDGFMIVWDS---------LTGLKRSAIPLDSQ 128

Query: 177 DVKHVVWHSEMHLLASSSYDDTI---RLWKEDADDWECAAVLNGHKGTVWCSDFEKSESS 233
            V          L AS+  ++     R+ +  A      ++  GH G +   +F  SES 
Sbjct: 129 WVLTCALSPSGALAASAGLNNNCTIYRMPRGSAVQQNVTSIFKGHTGYISGVEFV-SES- 186

Query: 234 LRLASCSDDSTVRVWNYVEEEENGEDVWAQEAILPNVHSRAVYSVSWSLDGYIASVGSDG 293
            R+ + S D T  +W+  + +     V      L +V + ++   + S +   AS GSDG
Sbjct: 187 -RVVTSSGDMTCALWDIPKAKR----VREYSDHLGDVLAISIPVTNLSKNNMFASCGSDG 241

>Scas_652.7
          Length = 380

 Score = 35.0 bits (79), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 31/134 (23%), Positives = 62/134 (46%), Gaps = 6/134 (4%)

Query: 118 ETELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQD 177
           + +L+A +  H+  + AV  S  G  + +CS+D++ ++WE    G  Y+   VL    + 
Sbjct: 52  QPKLVATLANHDKTITAVDISIHGR-IVTCSQDRNAYVWEPLSDG-SYKPTLVLLRINRA 109

Query: 178 VKHVVWHSEMHLLASSSYDDTIRL--WKEDADDWECAAVLNGHKGTVWCSDFEKSESSLR 235
              V W    +  A  S    I +  ++++ + W    +    K T+ C  +   E+ + 
Sbjct: 110 ATSVSWAPNGYKFAVGSSARIIAVCYYEQENNWWVSKHIKKPIKSTINCLSWH--ENGVL 167

Query: 236 LASCSDDSTVRVWN 249
           LA+   D  +RV++
Sbjct: 168 LAAGGTDGFIRVFS 181

 Score = 34.7 bits (78), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 47/113 (41%), Gaps = 8/113 (7%)

Query: 235 RLASCSDDSTVRVWNYVEEEENGEDVWAQEAILPNVHSRAVYSVSWSLDGYIASVGSDGL 294
           R+ +CS D    VW     E   +  +    +L  ++ RA  SVSW+ +GY  +VGS   
Sbjct: 76  RIVTCSQDRNAYVW-----EPLSDGSYKPTLVLLRIN-RAATSVSWAPNGYKFAVGSSAR 129

Query: 295 LXXXXXXXXXXXXXXXQQHEAHGIYEINVVKWATVDDSVLLLTGGDDGCANIW 347
           +               +  +      IN + W   ++ VLL  GG DG   ++
Sbjct: 130 IIAVCYYEQENNWWVSKHIKKPIKSTINCLSWH--ENGVLLAAGGTDGFIRVF 180

>Scas_701.45
          Length = 1276

 Score = 35.4 bits (80), Expect = 0.067,   Method: Composition-based stats.
 Identities = 64/336 (19%), Positives = 117/336 (34%), Gaps = 82/336 (24%)

Query: 37  WSIDCSKGLMATSSSDRKIKLVNLKNMDFQL-VEELDD-STHKKSVRSVSFRP-HSSILA 93
           WS D +K +      + KI+L + +  D ++ ++ L     H  +V ++ F P   ++LA
Sbjct: 72  WSFD-NKFIAGALDDNGKIELFSKEENDTKISLKSLGKFKKHTTAVNTLRFNPKQQNVLA 130

Query: 94  AGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSV 153
           +   +  I IW   +     D  P    +A+    ++E+K+VSW+ S  ++ + + D + 
Sbjct: 131 SAGNNGEILIWDINKTLSSTDYSPSAPGIAM--STQDEIKSVSWNKSLAHVFASAGDTTT 188

Query: 154 W--IWEADELGEEYEC------------LSVLQEHAQDVKHV-------------VW--- 183
           +  IW+     E                L+V++ H +   +V             +W   
Sbjct: 189 YASIWDLKAKKEVIHLNYTSPKTGLKPNLAVVEWHPKVTTYVATASGSDSDPVILIWDLR 248

Query: 184 HSEM-----------------------HLLASSSYDDTIRLWKEDAD------------- 207
           +S M                        LL SS  D  + LW   A+             
Sbjct: 249 NSNMPMTTLEGPHTKGIMSLDWCTKDESLLLSSGRDGIVALWDTKANEVSTTYPTRSQWC 308

Query: 208 ----------DWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWNYVEEEENG 257
                     D   +A  +G        D   S+ S   A  + +S    WN+V      
Sbjct: 309 FKTKFAPENPDIFASAGFDGQINVNTLQDLTNSQDSQTQADTNKESESEFWNHVSTSTPL 368

Query: 258 EDVWAQEAILPNVHSRAVYSVSWSLDGYIASVGSDG 293
           E     +   PN +     +  W+  G +  +  DG
Sbjct: 369 EKPTVSKIHAPNWYGNRSPAAQWAFGGKLVKISKDG 404

>Kwal_14.884
          Length = 395

 Score = 35.0 bits (79), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 36/68 (52%), Gaps = 4/68 (5%)

Query: 190 LASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWN 249
           L S+S D  + +W+    DWE    L GH   +  +DF+   S+    S S+D ++R+WN
Sbjct: 115 LISASDDHNLVIWR--VKDWENFGTLKGHASRI--NDFDIHPSNRIAISVSEDHSIRLWN 170

Query: 250 YVEEEENG 257
            +  ++ G
Sbjct: 171 LMTVKKAG 178

>Scas_627.9
          Length = 500

 Score = 35.4 bits (80), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 45/97 (46%), Gaps = 18/97 (18%)

Query: 124 IIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGE--EYECLSVLQEH------- 174
           II    + + AV + H+G YLA+  +   V ++E ++  +  EY+ L+  Q H       
Sbjct: 20  IIVTEADIITAVEFDHTGDYLATGDKGGRVVLFERNKANKHCEYKFLTEFQSHDAEFDYL 79

Query: 175 -----AQDVKHVVW---HSEMHLLASSSYDDTIRLWK 203
                 + +  + W       H L S++ D TI+LWK
Sbjct: 80  KSLEIEEKINQIKWLRPTQRSHFLLSTN-DKTIKLWK 115

>KLLA0F21406g complement(1996260..1998377) similar to sp|P47025
           Saccharomyces cerevisiae YJL112w MDV1, start by
           similarity
          Length = 705

 Score = 35.4 bits (80), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 32/141 (22%), Positives = 59/141 (41%), Gaps = 28/141 (19%)

Query: 87  PHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYY--L 144
           P  ++ +AGS D ++ +W          D  + + +A + GH   + ++S      Y  L
Sbjct: 408 PFGTMCSAGSLDHSVKVW----------DLSKKKQIATLHGH---LASISCMQIDQYSTL 454

Query: 145 ASCSRDKSVWIWE-----ADELGEEYE----CLSVLQEHAQDVKHVVWHSEMHLLASSSY 195
            +  RD  + +W+     ADE     E    CL     H  ++  + +  +   L S S 
Sbjct: 455 ITGGRDAVLKLWDIDKAMADEASNSSEDNDACLYTFDSHVDEITAISFDGDN--LVSGSQ 512

Query: 196 DDTIRLWKEDADDWECAAVLN 216
           D T+R W  D +  +C   ++
Sbjct: 513 DRTVRQW--DLNSGKCTQTID 531

>CAGL0A00561g complement(63710..64948) similar to sp|P53196
           Saccharomyces cerevisiae YGL004c, hypothetical start
          Length = 412

 Score = 35.0 bits (79), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 37/82 (45%), Gaps = 10/82 (12%)

Query: 76  HKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAV 135
           H   V +V   P +++L +GS D  + +W  E+ ++P+           ++GH   +   
Sbjct: 140 HVSDVTTVKIFPSNAVLLSGSTDMQLKVWSLEDGSNPR----------TLKGHSAGITDT 189

Query: 136 SWSHSGYYLASCSRDKSVWIWE 157
                G  + S S D SV +WE
Sbjct: 190 IIIERGRNVLSSSLDGSVRLWE 211

 Score = 29.3 bits (64), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 20/82 (24%), Positives = 36/82 (43%), Gaps = 4/82 (4%)

Query: 122 LAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHV 181
           L+++  H ++V  V    S   L S S D  + +W      E+      L+ H+  +   
Sbjct: 134 LSLVGAHVSDVTTVKIFPSNAVLLSGSTDMQLKVWSL----EDGSNPRTLKGHSAGITDT 189

Query: 182 VWHSEMHLLASSSYDDTIRLWK 203
           +       + SSS D ++RLW+
Sbjct: 190 IIIERGRNVLSSSLDGSVRLWE 211

>AGR242C [4553] [Homologous to ScYIR012W (SQT1) - SH]
           (1203152..1204411) [1260 bp, 419 aa]
          Length = 419

 Score = 35.0 bits (79), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 37/183 (20%), Positives = 72/183 (39%), Gaps = 22/183 (12%)

Query: 76  HKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAV 135
           H  SV +V+  P   ++ +G  D+   +W    +       P  E  ++   H   V   
Sbjct: 59  HTDSVFTVAAHPKLPLVVSGGGDNKAHLWTTHRE-------PPREAGSV--EHSESVIGA 109

Query: 136 SWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVW----HSEMHLLA 191
           +++  G YL +   +  V +  A   G+E+   + LQE    V  V W         + A
Sbjct: 110 AFTADGRYLVTADMNGQVRVQVAARQGQEWRPAAELQE----VDEVTWLKVHPHRAGIFA 165

Query: 192 SSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCS-----DFEKSESSLRLASCSDDSTVR 246
             + D ++  ++ D  +     ++ G      C+     +    + ++ L +CS D T+ 
Sbjct: 166 IGAVDGSVWCYEMDTQNNTPVLLMTGVAHAQDCTMGVFLETAADDENVILVTCSLDGTII 225

Query: 247 VWN 249
            WN
Sbjct: 226 GWN 228

>CAGL0K07095g 698028..699143 highly similar to sp|P38328
           Saccharomyces cerevisiae YBR234c AR41, hypothetical
           start
          Length = 371

 Score = 35.0 bits (79), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 46/113 (40%), Gaps = 8/113 (7%)

Query: 235 RLASCSDDSTVRVWNYVEEEENGEDVWAQEAILPNVHSRAVYSVSWSLDGYIASVGSDGL 294
           R+ +CS D    VW     E   +  +    +L  ++ RA  SVSW+  GY  +VGS   
Sbjct: 70  RIVTCSQDRNAYVW-----EPLSDGSYKPTLVLLRIN-RAATSVSWAPSGYKFAVGSSAR 123

Query: 295 LXXXXXXXXXXXXXXXQQHEAHGIYEINVVKWATVDDSVLLLTGGDDGCANIW 347
           +               +  +      IN + W T  + VLL  GG DG   ++
Sbjct: 124 IIAVCYYEHENNWWVSKHIKKPIKSTINCLSWHT--NGVLLAAGGTDGYMRVF 174

 Score = 33.9 bits (76), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 32/135 (23%), Positives = 60/135 (44%), Gaps = 6/135 (4%)

Query: 117 PETELLAIIEGHENEVKAVSWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQ 176
           P  +L+A +  H+  V AV  S  G  + +CS+D++ ++WE    G  Y+   VL    +
Sbjct: 45  PTPQLVATLANHDKLVTAVDISPHGR-IVTCSQDRNAYVWEPLSDG-SYKPTLVLLRINR 102

Query: 177 DVKHVVWHSEMHLLASSSYDDTIRL--WKEDADDWECAAVLNGHKGTVWCSDFEKSESSL 234
               V W    +  A  S    I +  ++ + + W    +    K T+ C  +    + +
Sbjct: 103 AATSVSWAPSGYKFAVGSSARIIAVCYYEHENNWWVSKHIKKPIKSTINCLSWH--TNGV 160

Query: 235 RLASCSDDSTVRVWN 249
            LA+   D  +RV++
Sbjct: 161 LLAAGGTDGYMRVFS 175

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.129    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 11,907,276
Number of extensions: 499229
Number of successful extensions: 4346
Number of sequences better than 10.0: 412
Number of HSP's gapped: 3038
Number of HSP's successfully gapped: 1012
Length of query: 347
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 245
Effective length of database: 13,065,073
Effective search space: 3200942885
Effective search space used: 3200942885
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 62 (28.5 bits)