Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_55.206641791789311e-130
AGR126C10131667771e-97
KLLA0C17534g10051677472e-93
CAGL0G04015g10191797297e-91
YLL031C (GPI13)10171677183e-89
Scas_604.610111666982e-86
CAGL0M14113g58139651.6
CAGL0L13354g58139641.6
CAGL0G08448g58039623.6
CAGL0J04378g55128605.9
YOR071C59841598.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_55.20664
         (178 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_55.20664                                                         363   e-130
AGR126C [4437] [Homologous to ScYLL031C (GPI13) - SH] (989241..9...   303   1e-97
KLLA0C17534g 1540967..1543984 similar to sgd|S0003954 Saccharomy...   292   2e-93
CAGL0G04015g 379330..382389 highly similar to tr|Q07830 Saccharo...   285   7e-91
YLL031C (GPI13) [3389] chr12 complement(77151..80204) Protein in...   281   3e-89
Scas_604.6                                                            273   2e-86
CAGL0M14113g complement(1395857..1397602) similar to sp|Q05998 S...    30   1.6  
CAGL0L13354g complement(1435582..1437327) similar to sp|Q05998 S...    29   1.6  
CAGL0G08448g complement(797481..799223) highly similar to sp|Q05...    28   3.6  
CAGL0J04378g complement(410790..412445) similar to sp|P38206 Sac...    28   5.9  
YOR071C (YOR071C) [4879] chr15 complement(459481..461277) Probab...    27   8.1  

>Kwal_55.20664
          Length = 179

 Score =  363 bits (931), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 178/178 (100%), Positives = 178/178 (100%)

Query: 1   MMGPLCVKLNIRNNDVKSQQATILGYANVYGSQFFLLVINFLMCIMLFNKPMAQISLFLM 60
           MMGPLCVKLNIRNNDVKSQQATILGYANVYGSQFFLLVINFLMCIMLFNKPMAQISLFLM
Sbjct: 1   MMGPLCVKLNIRNNDVKSQQATILGYANVYGSQFFLLVINFLMCIMLFNKPMAQISLFLM 60

Query: 61  CNQLLSMLEIFDLLKLKENLIGPVAMGLLAYQQFFSTGHQATIPAVQWDIGFVLTERITF 120
           CNQLLSMLEIFDLLKLKENLIGPVAMGLLAYQQFFSTGHQATIPAVQWDIGFVLTERITF
Sbjct: 61  CNQLLSMLEIFDLLKLKENLIGPVAMGLLAYQQFFSTGHQATIPAVQWDIGFVLTERITF 120

Query: 121 PFTHLGIVMNTFGPHILVALSVALLTLWKQPPSVLKPQTLLARIVSTPECYLFTTLYC 178
           PFTHLGIVMNTFGPHILVALSVALLTLWKQPPSVLKPQTLLARIVSTPECYLFTTLYC
Sbjct: 121 PFTHLGIVMNTFGPHILVALSVALLTLWKQPPSVLKPQTLLARIVSTPECYLFTTLYC 178

>AGR126C [4437] [Homologous to ScYLL031C (GPI13) - SH]
           (989241..992282) [3042 bp, 1013 aa]
          Length = 1013

 Score =  303 bits (777), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 139/166 (83%), Positives = 157/166 (94%)

Query: 1   MMGPLCVKLNIRNNDVKSQQATILGYANVYGSQFFLLVINFLMCIMLFNKPMAQISLFLM 60
           MMGPLC+KLN+ NND +SQQATILGYAN YG+Q+FLLVINF MCI+LFNKP+AQ+SLFLM
Sbjct: 775 MMGPLCIKLNVHNNDRRSQQATILGYANAYGAQYFLLVINFFMCILLFNKPLAQLSLFLM 834

Query: 61  CNQLLSMLEIFDLLKLKENLIGPVAMGLLAYQQFFSTGHQATIPAVQWDIGFVLTERITF 120
           CNQLLS+LEIFDLLKLKENLIGPVA+GLL+YQQFFSTGHQATIPAVQWD+GF+LTERITF
Sbjct: 835 CNQLLSILEIFDLLKLKENLIGPVALGLLSYQQFFSTGHQATIPAVQWDMGFILTERITF 894

Query: 121 PFTHLGIVMNTFGPHILVALSVALLTLWKQPPSVLKPQTLLARIVS 166
           PFTHLGIV+NTFGPHIL  +SVALLTLWKQPP +L+  TLLAR+VS
Sbjct: 895 PFTHLGIVLNTFGPHILCGISVALLTLWKQPPGILRANTLLARVVS 940

>KLLA0C17534g 1540967..1543984 similar to sgd|S0003954 Saccharomyces
           cerevisiae YLL031c GPI13 protein involved in
           glycosylphosphatidylinositol biosynthesis, start by
           similarity
          Length = 1005

 Score =  292 bits (747), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 139/167 (83%), Positives = 158/167 (94%)

Query: 1   MMGPLCVKLNIRNNDVKSQQATILGYANVYGSQFFLLVINFLMCIMLFNKPMAQISLFLM 60
           M GPLCVKLNI N D+KSQQATILGY+NVYGSQ+FLLVINFLM IMLFNKP+ Q+S+FLM
Sbjct: 767 MKGPLCVKLNIHNTDLKSQQATILGYSNVYGSQYFLLVINFLMAIMLFNKPLGQLSIFLM 826

Query: 61  CNQLLSMLEIFDLLKLKENLIGPVAMGLLAYQQFFSTGHQATIPAVQWDIGFVLTERITF 120
           CNQLLS++EI DLLK+KE+LIGPVA+GLLAYQQFFSTGHQATIP+VQWD+GF+LTE+I F
Sbjct: 827 CNQLLSIIEICDLLKVKESLIGPVALGLLAYQQFFSTGHQATIPSVQWDMGFILTEKIIF 886

Query: 121 PFTHLGIVMNTFGPHILVALSVALLTLWKQPPSVLKPQTLLARIVST 167
           P+THLGIV+NTFGP ILVALSVALLTLWKQPPSVL+PQT+LARIVS 
Sbjct: 887 PWTHLGIVLNTFGPFILVALSVALLTLWKQPPSVLQPQTILARIVSN 933

>CAGL0G04015g 379330..382389 highly similar to tr|Q07830
           Saccharomyces cerevisiae YLL031c GPI13, start by
           similarity
          Length = 1019

 Score =  285 bits (729), Expect = 7e-91,   Method: Compositional matrix adjust.
 Identities = 132/179 (73%), Positives = 159/179 (88%), Gaps = 1/179 (0%)

Query: 1   MMGPLCVKLNIRNNDVKSQQATILGYANVYGSQFFLLVINFLMCIMLFNKPMAQISLFLM 60
           MMGPLC+KLN++N D+KS QATILGY N+YGS+FFLLVIN LM IMLFNKP+AQ+SLFLM
Sbjct: 781 MMGPLCIKLNVKNADLKSNQATILGYTNIYGSEFFLLVINALMAIMLFNKPLAQLSLFLM 840

Query: 61  CNQLLSMLEIFDLLKLKENLIGPVAMGLLAYQQFFSTGHQATIPAVQWDIGFVLTERITF 120
            NQ+LS+ EI DLLKLKEN++GP+A+GL+AYQQFFSTGHQATIP+VQWD+GF+L+++I F
Sbjct: 841 VNQILSIFEIIDLLKLKENIVGPIALGLVAYQQFFSTGHQATIPSVQWDVGFILSDKIIF 900

Query: 121 PFTHLGIVMNTFGPHILVALSVALLTLWKQPPSVLKPQTLLARIVSTPECYL-FTTLYC 178
           PFTHLGI++NTFGPHI+V+LSVALLTLW QPP VLKPQTLL RIVS     L + T+ C
Sbjct: 901 PFTHLGILLNTFGPHIIVSLSVALLTLWSQPPDVLKPQTLLGRIVSNCGVLLTYNTVLC 959

>YLL031C (GPI13) [3389] chr12 complement(77151..80204) Protein
           involved in glycosylphosphatidylinositol biosynthesis,
           probably responsible for adding phosphoethanolamine to
           the third mannose [3054 bp, 1017 aa]
          Length = 1017

 Score =  281 bits (718), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 128/167 (76%), Positives = 152/167 (91%)

Query: 1   MMGPLCVKLNIRNNDVKSQQATILGYANVYGSQFFLLVINFLMCIMLFNKPMAQISLFLM 60
           +MGPLC+KLNI N DVKS +ATILGY N+YGS+FFLLVIN L+ I+LFNKP+AQ+S FLM
Sbjct: 779 LMGPLCIKLNIHNTDVKSHEATILGYTNIYGSEFFLLVINVLISILLFNKPLAQLSYFLM 838

Query: 61  CNQLLSMLEIFDLLKLKENLIGPVAMGLLAYQQFFSTGHQATIPAVQWDIGFVLTERITF 120
           CNQLLS+LEI DLLKLKEN+IGP+A+GLL+YQ FF+TGHQATIP+VQWDIGF+L+E++TF
Sbjct: 839 CNQLLSILEIIDLLKLKENIIGPIALGLLSYQHFFTTGHQATIPSVQWDIGFMLSEKVTF 898

Query: 121 PFTHLGIVMNTFGPHILVALSVALLTLWKQPPSVLKPQTLLARIVST 167
           PFT + I++NTFGPHILV+LSVALLTLW QPP VLKPQTLL RIVS 
Sbjct: 899 PFTQIAIILNTFGPHILVSLSVALLTLWSQPPDVLKPQTLLGRIVSN 945

>Scas_604.6
          Length = 1011

 Score =  273 bits (698), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 121/166 (72%), Positives = 151/166 (90%)

Query: 1   MMGPLCVKLNIRNNDVKSQQATILGYANVYGSQFFLLVINFLMCIMLFNKPMAQISLFLM 60
           +MGPLC+KLNI N DVKS QATILGY N+YGS++FLLVIN++M I++F KP+AQIS+FLM
Sbjct: 773 LMGPLCIKLNIHNTDVKSHQATILGYTNIYGSEYFLLVINWIMSIIIFMKPLAQISIFLM 832

Query: 61  CNQLLSMLEIFDLLKLKENLIGPVAMGLLAYQQFFSTGHQATIPAVQWDIGFVLTERITF 120
           CNQ+LS+LEI DLLKLKEN+IGP+ + LL+YQQ+FSTGHQATIP++QWD+GF+L+++ITF
Sbjct: 833 CNQILSILEIIDLLKLKENIIGPIVLALLSYQQYFSTGHQATIPSIQWDVGFILSDKITF 892

Query: 121 PFTHLGIVMNTFGPHILVALSVALLTLWKQPPSVLKPQTLLARIVS 166
           P TH+ + +NTFGP IL+ALSVALLTLWKQPP VLKPQT+L RIVS
Sbjct: 893 PLTHISLALNTFGPQILIALSVALLTLWKQPPDVLKPQTILGRIVS 938

>CAGL0M14113g complement(1395857..1397602) similar to sp|Q05998
           Saccharomyces cerevisiae YLR237w THI7 or sp|Q08485
           Saccharomyces cerevisiae YOR071c or sp|Q08579
           Saccharomyces cerevisiae YOR192c, hypothetical start
          Length = 581

 Score = 29.6 bits (65), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 5/39 (12%)

Query: 104 PAVQWDIGFVLTERITFPFTHLGIVMNTFGPHILVALSV 142
           P   W +G+ L++R TF     GI  + FG  I V LS+
Sbjct: 94  PGWDWKVGYTLSQRFTF-----GIYGSAFGVIIRVLLSI 127

>CAGL0L13354g complement(1435582..1437327) similar to sp|Q05998
           Saccharomyces cerevisiae YLR237w THI7 or sp|Q08485
           Saccharomyces cerevisiae YOR071c or sp|Q08579
           Saccharomyces cerevisiae YOR192c, start by similarity
          Length = 581

 Score = 29.3 bits (64), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 5/39 (12%)

Query: 104 PAVQWDIGFVLTERITFPFTHLGIVMNTFGPHILVALSV 142
           P   W +G+ L++R TF     GI  + FG  I V LS+
Sbjct: 94  PGWDWKVGYTLSQRFTF-----GIYGSAFGVIIRVLLSI 127

>CAGL0G08448g complement(797481..799223) highly similar to sp|Q05998
           Saccharomyces cerevisiae YLR237w THI7 thiamin transport
           protein, hypothetical start
          Length = 580

 Score = 28.5 bits (62), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 20/39 (51%), Gaps = 5/39 (12%)

Query: 104 PAVQWDIGFVLTERITFPFTHLGIVMNTFGPHILVALSV 142
           P   W +G+ L +R TF     GI  + FG  I V +S+
Sbjct: 94  PGWDWKVGYTLAQRFTF-----GIYGSAFGVVIRVLMSI 127

>CAGL0J04378g complement(410790..412445) similar to sp|P38206
           Saccharomyces cerevisiae YBL020w RFT1 nuclear division
           protein, hypothetical start
          Length = 551

 Score = 27.7 bits (60), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 10/28 (35%), Positives = 18/28 (64%)

Query: 83  PVAMGLLAYQQFFSTGHQATIPAVQWDI 110
           P+++GL+A+Q     G+  T+P  QW +
Sbjct: 107 PLSIGLIAWQYHNINGYFVTLPFFQWSV 134

>YOR071C (YOR071C) [4879] chr15 complement(459481..461277) Probable
           low affinity thiamine transporter [1797 bp, 598 aa]
          Length = 598

 Score = 27.3 bits (59), Expect = 8.1,   Method: Composition-based stats.
 Identities = 14/41 (34%), Positives = 20/41 (48%), Gaps = 5/41 (12%)

Query: 102 TIPAVQWDIGFVLTERITFPFTHLGIVMNTFGPHILVALSV 142
           + P   W IGF L +R  F     GI  + FG  I + +S+
Sbjct: 96  SYPGYDWKIGFTLAQRFVF-----GIYGSAFGIIIRILMSI 131

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.330    0.143    0.440 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 5,369,095
Number of extensions: 196301
Number of successful extensions: 477
Number of sequences better than 10.0: 16
Number of HSP's gapped: 477
Number of HSP's successfully gapped: 16
Length of query: 178
Length of database: 16,596,109
Length adjustment: 95
Effective length of query: 83
Effective length of database: 13,307,399
Effective search space: 1104514117
Effective search space used: 1104514117
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 58 (26.9 bits)