Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_55.205471014100047240.0
KLLA0D15081g1010104617710.0
YGR097W (ASK10)1146113615960.0
AAR086W80777914350.0
Scas_716.281108105914261e-180
CAGL0G03179g1061108913911e-175
YPR115W108382413611e-171
CAGL0B04213g9007299491e-113
Kwal_23.49586493134342e-44
ADL234C7364414265e-43
CAGL0G01386g5324384096e-42
Sklu_2395.67113134104e-41
CAGL0G02827g7493254106e-41
YIL105C6863203943e-39
Scas_671.236863253925e-39
KLLA0F03839g6483273891e-38
YNL047C6562853561e-34
YGL173C (KEM1)152886722.4
Sklu_2436.531096712.5
ADL057W89045722.5
KLLA0C07887g87545722.6
Kwal_23.588787945703.7
AGL015W35386676.7
ACR155W864136687.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_55.20547
         (1000 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_55.20547                                                        1824   0.0  
KLLA0D15081g 1271696..1274728 some similarities with sgd|S000631...   686   0.0  
YGR097W (ASK10) [2057] chr7 (678697..682137) Potential transcrip...   619   0.0  
AAR086W [272] [Homologous to ScYGR097W (ASK10) - SH; ScYPR115W -...   557   0.0  
Scas_716.28                                                           553   e-180
CAGL0G03179g 295541..298726 similar to sp|P48361 Saccharomyces c...   540   e-175
YPR115W (YPR115W) [5536] chr16 (754873..758124) Protein containi...   528   e-171
CAGL0B04213g 412230..414932 some similarities with sp|P48361 Sac...   370   e-113
Kwal_23.4958                                                          171   2e-44
ADL234C [1507] [Homologous to ScYIL105C - SH; ScYNL047C - SH] (2...   168   5e-43
CAGL0G01386g complement(132280..133878) similar to sp|P40485 Sac...   162   6e-42
Sklu_2395.6 YIL105C, Contig c2395 8302-10437                          162   4e-41
CAGL0G02827g complement(259569..261818) similar to sp|P40485 Sac...   162   6e-41
YIL105C (YIL105C) [2571] chr9 complement(167578..169638) Protein...   156   3e-39
Scas_671.23                                                           155   5e-39
KLLA0F03839g complement(363977..365923) similar to sp|P40485 Sac...   154   1e-38
YNL047C (YNL047C) [4541] chr14 complement(539909..541879) Protei...   141   1e-34
YGL173C (KEM1) [1817] chr7 complement(175531..180117) Nuclease w...    32   2.4  
Sklu_2436.5 YDR460W, Contig c2436 11903-12835                          32   2.5  
ADL057W [1684] [Homologous to ScYER070W (RNR1) - SH; ScYIL066C (...    32   2.5  
KLLA0C07887g complement(693437..696064) highly similar to sp|P21...    32   2.6  
Kwal_23.5887                                                           32   3.7  
AGL015W [4296] [Homologous to ScYPL011C (TAF47) - SH] complement...    30   6.7  
ACR155W [1202] [Homologous to ScYIL066C - NSH] complement(623554...    31   7.7  

>Kwal_55.20547
          Length = 1014

 Score = 1824 bits (4724), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 902/1000 (90%), Positives = 902/1000 (90%)

Query: 1    MSSELSHLEHLGKELLTPEKEEDDASSLFSSDSGYLMELADASDDDETILPKTDFHSPYY 60
            MSSELSHLEHLGKELLTPEKEEDDASSLFSSDSGYLMELADASDDDETILPKTDFHSPYY
Sbjct: 1    MSSELSHLEHLGKELLTPEKEEDDASSLFSSDSGYLMELADASDDDETILPKTDFHSPYY 60

Query: 61   VNVPTPSQSALTSDYSELSQDAAAAGFVREYPTDILLDRFTKWRKILKGLANYLREVAYA 120
            VNVPTPSQSALTSDYSELSQDAAAAGFVREYPTDILLDRFTKWRKILKGLANYLREVAYA
Sbjct: 61   VNVPTPSQSALTSDYSELSQDAAAAGFVREYPTDILLDRFTKWRKILKGLANYLREVAYA 120

Query: 121  QERFARINYSLRGAVKFSFLTDLEESTNRVIDPFQQRAKKPGNAASTSNLNTGLKSPPAV 180
            QERFARINYSLRGAVKFSFLTDLEESTNRVIDPFQQRAKKPGNAASTSNLNTGLKSPPAV
Sbjct: 121  QERFARINYSLRGAVKFSFLTDLEESTNRVIDPFQQRAKKPGNAASTSNLNTGLKSPPAV 180

Query: 181  DDEXXXXXXXXXXXXXXAFEVKNVPMAPGDNDSASSGFMKFGSGSIEDIQVVLKKYHTSM 240
            DDE              AFEVKNVPMAPGDNDSASSGFMKFGSGSIEDIQVVLKKYHTSM
Sbjct: 181  DDENLTNSSTLQSSSQSAFEVKNVPMAPGDNDSASSGFMKFGSGSIEDIQVVLKKYHTSM 240

Query: 241  GNQQIKMSKELNTVVVPXXXXXXXXXXXXXXEIKELHGDFRTNIGEHIALTGQLLQKYMA 300
            GNQQIKMSKELNTVVVP              EIKELHGDFRTNIGEHIALTGQLLQKYMA
Sbjct: 241  GNQQIKMSKELNTVVVPKLDDLRKDLQLKIKEIKELHGDFRTNIGEHIALTGQLLQKYMA 300

Query: 301  AVKFMSTNSNDQNIFKLKNQKLKPKHDPYXXXXXXXXXXXXXXXEENYLQEAYINLQSSG 360
            AVKFMSTNSNDQNIFKLKNQKLKPKHDPY               EENYLQEAYINLQSSG
Sbjct: 301  AVKFMSTNSNDQNIFKLKNQKLKPKHDPYLLKLQLDLQLKRQLLEENYLQEAYINLQSSG 360

Query: 361  LELEKIIYGEVQHTLQRYSALISTSARISIGNLCNELHQGMLSKPPAIEWDHFVGHHPKC 420
            LELEKIIYGEVQHTLQRYSALISTSARISIGNLCNELHQGMLSKPPAIEWDHFVGHHPKC
Sbjct: 361  LELEKIIYGEVQHTLQRYSALISTSARISIGNLCNELHQGMLSKPPAIEWDHFVGHHPKC 420

Query: 421  LINWKSTEPIPQPRKLSHIRYPKMKSSLAKCIKAGYLSKKSQILKNYNKGYFVLTSNYLH 480
            LINWKSTEPIPQPRKLSHIRYPKMKSSLAKCIKAGYLSKKSQILKNYNKGYFVLTSNYLH
Sbjct: 421  LINWKSTEPIPQPRKLSHIRYPKMKSSLAKCIKAGYLSKKSQILKNYNKGYFVLTSNYLH 480

Query: 481  EFKSSNFFKLSQDNSEKKDHGEVQTGSKKRAMVPVTSLSLNSAKLVEASESKFSIRGIAT 540
            EFKSSNFFKLSQDNSEKKDHGEVQTGSKKRAMVPVTSLSLNSAKLVEASESKFSIRGIAT
Sbjct: 481  EFKSSNFFKLSQDNSEKKDHGEVQTGSKKRAMVPVTSLSLNSAKLVEASESKFSIRGIAT 540

Query: 541  SSNFERKSAETGKMISKSTSSIQKFLKSSGXXXXXXXXXXXXXAXXXXXXXXXXXXQDVA 600
            SSNFERKSAETGKMISKSTSSIQKFLKSSG             A            QDVA
Sbjct: 541  SSNFERKSAETGKMISKSTSSIQKFLKSSGKNPHKKDNHHNHHAPGSSGSVSGPVVQDVA 600

Query: 601  DDVSTWVFKPVSSKPEDAKDLKKWIAEVRHLSNFDTSADRAKFIEEKILRAHSRASSMNL 660
            DDVSTWVFKPVSSKPEDAKDLKKWIAEVRHLSNFDTSADRAKFIEEKILRAHSRASSMNL
Sbjct: 601  DDVSTWVFKPVSSKPEDAKDLKKWIAEVRHLSNFDTSADRAKFIEEKILRAHSRASSMNL 660

Query: 661  AKMASDASAKKQDKVASNRTQGSRNKPHFIHLGPQEFQDPTSARAKINTPAIDDNGNLIT 720
            AKMASDASAKKQDKVASNRTQGSRNKPHFIHLGPQEFQDPTSARAKINTPAIDDNGNLIT
Sbjct: 661  AKMASDASAKKQDKVASNRTQGSRNKPHFIHLGPQEFQDPTSARAKINTPAIDDNGNLIT 720

Query: 721  AGERHISLKSPSELSSPRQSPGQSLNSIGGGTPGSNHQNVPSPVNPQGFVITSNGMTPIN 780
            AGERHISLKSPSELSSPRQSPGQSLNSIGGGTPGSNHQNVPSPVNPQGFVITSNGMTPIN
Sbjct: 721  AGERHISLKSPSELSSPRQSPGQSLNSIGGGTPGSNHQNVPSPVNPQGFVITSNGMTPIN 780

Query: 781  RTPAPTAKRVPXXXXXXXXXXXXXXXXXPMNSPGSASMAINXXXXXXXXXXXXXYFAIPV 840
            RTPAPTAKRVP                 PMNSPGSASMAIN             YFAIPV
Sbjct: 781  RTPAPTAKRVPSGIILSSGASSDGSGSLPMNSPGSASMAINSPSSHVSGSSGGGYFAIPV 840

Query: 841  HASSQASTPGGANPDSSAAQAQATGPVVPRVRLNDKDLAHDKPDKSQLSEQLSEKPQATK 900
            HASSQASTPGGANPDSSAAQAQATGPVVPRVRLNDKDLAHDKPDKSQLSEQLSEKPQATK
Sbjct: 841  HASSQASTPGGANPDSSAAQAQATGPVVPRVRLNDKDLAHDKPDKSQLSEQLSEKPQATK 900

Query: 901  VSEGAPLSRGAPVHIRKSVNAGGTGMTIAEPPHSVYANPKQSNSAQTLASTNAQPIRKHK 960
            VSEGAPLSRGAPVHIRKSVNAGGTGMTIAEPPHSVYANPKQSNSAQTLASTNAQPIRKHK
Sbjct: 901  VSEGAPLSRGAPVHIRKSVNAGGTGMTIAEPPHSVYANPKQSNSAQTLASTNAQPIRKHK 960

Query: 961  KNVSFGSLNSLLFSKKGGDVSNNNMTDYFMSGNRIEENED 1000
            KNVSFGSLNSLLFSKKGGDVSNNNMTDYFMSGNRIEENED
Sbjct: 961  KNVSFGSLNSLLFSKKGGDVSNNNMTDYFMSGNRIEENED 1000

>KLLA0D15081g 1271696..1274728 some similarities with sgd|S0006319
            Saccharomyces cerevisiae YPR115w, hypothetical start
          Length = 1010

 Score =  686 bits (1771), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/1046 (42%), Positives = 578/1046 (55%), Gaps = 131/1046 (12%)

Query: 24   DASSLFSSDSGYLMELADASDDDETILPKTDFHSPYYVNVPTPSQSALTSDYSELSQ--- 80
            D SS+ SSDS YL++LAD ++  E ILPKT++HSPYYVNVPTP  S L    +  +    
Sbjct: 15   DNSSVASSDSNYLLDLADETEY-EDILPKTNYHSPYYVNVPTPKHSLLAGAGANSASAGA 73

Query: 81   --------------------------------------DAAAAGFVREYPTDILLDRFTK 102
                                                  D   A FVREYPTDIL DRF K
Sbjct: 74   NSGAGNANISARAGANVGVGSGAGASANAGKAEGLDLYDDGTASFVREYPTDILADRFHK 133

Query: 103  WRKILKGLANYLREVAYAQERFARINYSLRGAVKFSFLTDLEESTNRVIDPFQQRA--KK 160
            WRKILK +  YLREVAY+QE+FARINYSL+ +VKFSFLTDL+ESTNRV DP  +    KK
Sbjct: 134  WRKILKAMIIYLREVAYSQEQFARINYSLKNSVKFSFLTDLDESTNRVSDPLTKNLPQKK 193

Query: 161  PGNAASTSNLNTGLKSPPAVDDEXXXXXXXXXXXXXXAFEVKNVPMAPGDNDSASSGFMK 220
            P          T +KSP     +                  + + + P D+ S + GFM 
Sbjct: 194  PQPM-------TQMKSPFDEKPDPFAASNASTLNNSSIDLGQELQLEPNDSCSGA-GFMN 245

Query: 221  FGSGSIEDIQVVLKKYHTSMGNQQIKMSKELNTVVVPXXXXXXXXXXXXXXEIKELHGDF 280
            FGSGSI+DIQV+LKKYH S+ +QQ+K SKE+   ++P              EIKEL+ DF
Sbjct: 246  FGSGSIQDIQVILKKYHLSLASQQVKSSKEITLQIIPKLEDLRKDLSHKIKEIKELNADF 305

Query: 281  RTNIGEHIALTGQLLQKYMAAVKFMSTNSNDQNIFKLK-NQKLKPKHDPYXXXXXXXXXX 339
            +TNI EH+ALTGQLL KY+AAV F++ N++  ++ KLK N  LK KHDPY          
Sbjct: 306  KTNIQEHVALTGQLLHKYIAAVNFLNDNASRSDLIKLKRNSSLKSKHDPYLLKLQLDLQL 365

Query: 340  XXXXXEENYLQEAYINLQSSGLELEKIIYGEVQHTLQRYSALISTSARISIGNLCNELHQ 399
                 EENYLQEAYINLQSSG+ELEKII+  +Q TLQ++SA+I   AR SI NLC EL +
Sbjct: 366  KRQLLEENYLQEAYINLQSSGMELEKIIFSTIQKTLQKFSAIIDVQARTSINNLCRELQR 425

Query: 400  GMLSKPPAIEWDHFVGHHPKCLINWKSTEPIPQPRKLSHIRYPKMKSSLAKCIKAGYLSK 459
            G+LSKPP +EWD+FV HHP+CL+NWKST+PIPQPRKLS IRYPKMKSSLAKCI+AGYL K
Sbjct: 426  GILSKPPCVEWDNFVSHHPRCLLNWKSTDPIPQPRKLSDIRYPKMKSSLAKCIRAGYLLK 485

Query: 460  KSQILKNYNKGYFVLTSNYLHEFKSSNFFKLSQDNSEKKDHGEV-QTGSKKRAMVPVTSL 518
            KS+ LK YNKGYFVLTSNYLHEFKSSNFFKL+QD  E  +H  +  +G+K R+++P+ S+
Sbjct: 486  KSKYLKQYNKGYFVLTSNYLHEFKSSNFFKLTQDTGENSEHAIIPSSGNKGRSIIPIMSI 545

Query: 519  SLNSAKLVEASESKFSIRGIATSSNFERKSAETG---KMISKSTSSIQKFLK-SSGXXXX 574
            SLN ++L+E  E KF+I   +T    E  S       K ISKSTS+I K  K  SG    
Sbjct: 546  SLNESELLEI-EDKFTINCKSTYIMEESASESISNDLKKISKSTSTISKLFKPGSG---- 600

Query: 575  XXXXXXXXXAXXXXXXXXXXXXQDVADDVSTWVFKPVSSKPE--DAKDLKKWIAEVRHLS 632
                     A             D     ++  FK    +P   D K+ KKW   ++ L+
Sbjct: 601  -KHGKNNNLAMGSSNDSRVVSGGDDTVKFTSITFK----RPADVDVKEFKKWTNNLKDLT 655

Query: 633  NFDTSADRAKFIEEKILRAHSRASSMNLAKMASDASAKKQDKVASNRTQGSRNKPHFIHL 692
             F  + DRA++IEEKIL+AH++ +S  L+   S +       ++S  +   + +PH+I L
Sbjct: 656  KFHNTLDRARYIEEKILKAHNKFASSTLSLGQSKSEPTSSLHLSSQSSSNLQQRPHYIQL 715

Query: 693  GPQEFQDPTSARAKINTPAIDDNGNLITAGERHISLK-------SPSELSSPRQSPGQSL 745
             P   Q   + R+K+NTPAIDDNGNLI A ER  SL         P+EL S + SP   +
Sbjct: 716  -PSVSQ--VNLRSKVNTPAIDDNGNLIFATERPKSLAPTIEARPPPTELPSHQVSPTSFI 772

Query: 746  NSIGGGTPGSNHQNVPSPVNPQGFVITSNGMTPINRTPAPTAKRVPXXXXXXXXXXXXXX 805
            ++   G+ GSN        +  G+VITSNGMTP++     T  R                
Sbjct: 773  SN--DGSSGSNK------TSNMGYVITSNGMTPVHHLTPLTHVRTTSGDAGNTTNHTGAE 824

Query: 806  ---XXXPMNSPGSASMAINXXXXXXXXXXXXXYFAIPVHASSQASTPGGANPDSSAAQAQ 862
                  P +  G+ + A N             YFAIPV ++SQ STP G        +  
Sbjct: 825  FNFFMSPKDISGNVTSASN-----TSSGSGGGYFAIPVKSTSQHSTPTG--------EGS 871

Query: 863  ATGPVVPRVRLNDKDLAHDKPDKSQLSEQLSEKPQATKVSEGAPLSRGAPVHIRK----- 917
             T   +P++ +N+ +  H  P K      L+  P+ +        SR  P +  K     
Sbjct: 872  RTPNAIPKIHINELEAPH--PAKVI---PLNHTPETST-------SRNIPYNNLKKNSSA 919

Query: 918  SVNAGGTGMTIAEPPHSVYANPKQSNSAQTL---ASTNAQPIRKHKKNVSFGSLNSLLFS 974
            S     + +  A P   + +NP  + S   L     +  QP+RKHKK VSF SLNSL+FS
Sbjct: 920  SSVPSVSSLRAASP---ILSNPLHNLSTPALQGGKQSQTQPVRKHKKTVSFNSLNSLMFS 976

Query: 975  KKGGDVSNNNMTDYFMSGNRIEENED 1000
            KK     N+     ++S  +I E++D
Sbjct: 977  KKAPTPVNSQ----YLSDAKINEDDD 998

>YGR097W (ASK10) [2057] chr7 (678697..682137) Potential transcription
            factor involved in Skn7p-mediated two-component
            regulatory system [3441 bp, 1146 aa]
          Length = 1146

 Score =  619 bits (1596), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/1136 (37%), Positives = 572/1136 (50%), Gaps = 193/1136 (16%)

Query: 25   ASSLFSSDSGYLME-LADASDDDET-------------ILPKTDFHSPYYVNVPTPSQ-- 68
            ASS+ S  S YLM+ L D+   +E+             ILP+TD  SPY++NVP P    
Sbjct: 29   ASSIHSKSSQYLMDILPDSMTLNESVSSIVANNQAKEFILPETDERSPYFINVPIPKAQP 88

Query: 69   SALTSDYSELSQDAAAAG-FVREYPTDILLDRFTKWRKILKGLANYLREVAYAQERFARI 127
            ++ T     L+ D A  G FV+EYPTDIL+DRF KW+KILKGL  YLREVAYAQE+FARI
Sbjct: 89   TSTTETKKPLAGDEAIDGQFVKEYPTDILVDRFYKWKKILKGLVIYLREVAYAQEQFARI 148

Query: 128  NYSLRGAVKFSFLTDLEESTNRVIDPFQQRAKKPGNA-------ASTSNLNTGLKSPPAV 180
            NY L+G+VKF FLTD++E+TN + DPF    + P  A         T +    ++     
Sbjct: 149  NYQLKGSVKFPFLTDIDETTNTITDPFTTAPRGPKKAQPAQKKVGLTDSEQFQMQMQQEQ 208

Query: 181  DDEXXXXXXXXXXXXXXAFEVKNVPMAPGDNDSASSGFMKFGSGSIEDIQVVLKKYHTSM 240
             +                 E K V     DN SA+SGF+KFGSGSI+DIQV+LKKYH S+
Sbjct: 209  QENAVQAPTDESKMSLAPHEYKPVQTTESDNTSAASGFVKFGSGSIQDIQVILKKYHLSL 268

Query: 241  GNQQIKMSKELNTVVVPXXXXXXXXXXXXXXEIKELHGDFRTNIGEHIALTGQLLQKYMA 300
             NQQ K+SKE+ + V+P              EIK+LHGDF+TNIG HI LT QLL+KY+A
Sbjct: 269  ANQQFKISKEITSTVIPKLEELRKDLRYKITEIKDLHGDFKTNIGAHIQLTSQLLKKYIA 328

Query: 301  AVKFMSTNS--NDQ-NIFKLKNQKLKPKHDPYXXXXXXXXXXXXXXXEENYLQEAYINLQ 357
            AVKFM+ +   ND+ +    K  KL PKHDPY               EE YLQEA+INLQ
Sbjct: 329  AVKFMNAHGIGNDRASPTNKKPHKLDPKHDPYLLKLQLDLQLKRQVAEETYLQEAFINLQ 388

Query: 358  SSGLELEKIIYGEVQHTLQRYSALISTSARISIGNLCNELHQGMLSKPPAIEWDHFVGHH 417
            SSGL+LEKIIY ++QH L RYSALI + AR+ I N+C EL  G++SKPPA EWD+FV  H
Sbjct: 389  SSGLQLEKIIYTKIQHALLRYSALIDSEARLMIKNMCQELQHGIISKPPAFEWDNFVTQH 448

Query: 418  PKCLINWKSTEPIPQPRKLSHIRYPKMKSSLAKCIKAGYLSKKSQILKNYNKGYFVLTSN 477
            P CL+NWKS +PIP PRK+S + YP MKS LAKCIKAGY  KKS++L  Y++GYFVLTSN
Sbjct: 449  PSCLLNWKSNDPIPPPRKVSDVIYPHMKSPLAKCIKAGYFLKKSELLPTYHQGYFVLTSN 508

Query: 478  YLHEFKSSNFFKLSQD---------------------------------------NSEKK 498
            Y+HEF+SS+F+ LS                                         NS   
Sbjct: 509  YIHEFQSSDFYNLSSSTPNSTKSSAYSSSVSIADTYANANNAKANNHHRQASDVHNSSTT 568

Query: 499  DHGE-----VQTGSKKRAMVPVTSLSLNSAKLVEASESKFSIRGIAT------------- 540
              G      ++   KK  + P+ S+ LN   L +AS +KF + G  T             
Sbjct: 569  TGGTAGANGIRGIRKKSYLAPIMSIPLNDCTLKDASSTKFVLVGKPTLNENADVRKSSSS 628

Query: 541  -------SSNFERKSAETGKMISKSTSSIQKFLKSSGXXXXXXXXXXXXXAXXXXXXXXX 593
                    ++  +   ET K+ SK+     KFLK S                        
Sbjct: 629  TYLSGSSQASLPKYGHETAKIFSKA--PFHKFLKGS--------KPKNKNTKSSELDQFY 678

Query: 594  XXXQDVADDVSTWVFKPVSSKP--EDAKDLKKWIAEVRHLSNFDTSADRAKFIEEKILRA 651
               Q  +++  TW FK VS +P  E+ K  K+W+ ++++L++F+ + DR KFIE++++++
Sbjct: 679  AAAQKESNNYVTWTFKIVSPEPSEEELKHFKRWVQDLKNLTSFNDTKDRIKFIEDRVMKS 738

Query: 652  H-------SRASSMNLAK---MASDASAKKQD-KVASNRTQGSRNKPHFIHLGPQEFQ-- 698
            H       SR +S+N+       +D++   QD    S   +G   KP +IH+        
Sbjct: 739  HRFKAGHMSR-NSVNIGSHTPCLTDSTFTLQDGTTTSVNLKGRAEKPQYIHIQNNSLADF 797

Query: 699  DPTSARAKINTPAIDDNGNLITAGERHISLKSPSELSSPRQSPGQ---SLNSIGGGTP-- 753
            D    R+K+NTPAIDD GNLIT   R            P QSP Q    + + G  TP  
Sbjct: 798  DGNGFRSKVNTPAIDDYGNLITVERR------------PAQSPHQYSDYMATSGNTTPSY 845

Query: 754  --GSNHQNVPSPVNPQGFVITSNGMTPINRTPAPTAKRVPXXXXXXXXXXXXXXXXXPMN 811
              GS  Q++ +  NP    ITSNGM       +                        P  
Sbjct: 846  SSGSRPQSMYNGYNP-AVSITSNGMM---LQQSTANNNTNPTTNLRHQRNISQTSSLPGF 901

Query: 812  SPGSASMAINXXXXXXXXXXXXXYFAIPVHA----------SSQASTPG----------- 850
            S  S S+ +N             YFAIP+H           +S+ S+P            
Sbjct: 902  SYTSLSLPVNSPGSSNSESSSGGYFAIPLHGNNNNNNYTQRNSEGSSPCYNDDQIRQQQQ 961

Query: 851  ------------------GANPDSSAAQAQATGPVVPRVRLNDKDLAHDKPDKSQLSEQL 892
                                   S+     A  PVVP+V +N++++      K+  ++Q 
Sbjct: 962  PLQMQPLSRTSSSSVNVTAMRSTSAGNSITANAPVVPKVMVNNQNV------KTVAADQS 1015

Query: 893  SEKPQA-TKVSEGAPLSRGAPVHIRKSVNA-GGTGMTIAEPPHSVYANPKQ-SNSAQTLA 949
            +  P + T  S    ++R +P    K  N+ G      AE  H+  A  K+ +NSAQ L 
Sbjct: 1016 ATAPSSPTMNSSVTTINRESPYQTLKKTNSTGNVPCLTAEKTHAHPAFYKRGNNSAQNLT 1075

Query: 950  STNA-----QPIRKHKKNVSFGSLNSLLFSKKGGDVSNNNMTDYFMSGNRIEENED 1000
            ++++      PIRKHKKNVSF SLNSL+FSKKG +   N MT+ FMSG   E++ D
Sbjct: 1076 TSSSTASRVHPIRKHKKNVSFSSLNSLMFSKKGANHGGNLMTNQFMSGGIQEDDGD 1131

>AAR086W [272] [Homologous to ScYGR097W (ASK10) - SH; ScYPR115W -
           SH] complement(496601..499024) [2424 bp, 807 aa]
          Length = 807

 Score =  557 bits (1435), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/779 (42%), Positives = 439/779 (56%), Gaps = 124/779 (15%)

Query: 23  DDASSLFSSDSGYLMELADASDDDETILPKTDFHSPYYVNVPTPSQSALTSDYSELSQDA 82
           +DA S  SSD  YL+ELAD ++  E +LPK  + SP+YV+VP P       D+  L  D 
Sbjct: 7   EDAESGSSSDDDYLLELADVTEF-EGVLPKDHYSSPFYVDVPVPQS---LGDHRHLGDDT 62

Query: 83  AAAGFVREYPTDILLDRFTKWRKILKGLANYLREVAYAQERFARINYSLRGAVKFSFLTD 142
            +  +VREYPT IL DRF KWRK+LK L  YLREVA AQE+ ARIN  L+ AVKFSFL D
Sbjct: 63  QS--YVREYPTSILADRFDKWRKLLKSLVAYLREVAAAQEQHARINAHLKSAVKFSFLAD 120

Query: 143 LEESTNRVIDPFQQRAKKPGNAASTSNLNTGLKSPPAVDDEXXXXXXXXXXXXXXAFEVK 202
           LEE TN+V++  + R   P  + + S  ++                          F+V+
Sbjct: 121 LEEGTNKVVEQLK-RPSSPSQSGAESAQDS-------------------------YFQVQ 154

Query: 203 NVPMAPGDNDSASSGFMKFGSGSIEDIQVVLKKYHTSMGNQQIKMSKELNTVVVPXXXXX 262
                    +  S+GF+++GSGSI+D+QV LKKYH ++ NQQ+K S+ELN VV+P     
Sbjct: 155 ---------EGCSNGFLRYGSGSIQDLQVSLKKYHMTVSNQQLKASRELNNVVIPKLEEL 205

Query: 263 XXXXXXXXXEIKELHGDFRTNIGEHIALTGQLLQKYMAAVKFMSTNSNDQNIFKLKNQKL 322
                    EIKEL  DF+TNI E +ALTGQLLQKY+A+V  +ST + D    K   Q+L
Sbjct: 206 RRNLSSKIKEIKELSNDFKTNIHEQVALTGQLLQKYIASVDLLST-AEDSTSSKSTGQRL 264

Query: 323 KPKHDPYXXXXXXXXXXXXXXXEENYLQEAYINLQSSGLELEKIIYGEVQHTLQRYSALI 382
           KPKHDPY               EENYLQEAYINLQ+SG+ELEKI+YG++Q  LQ+++  +
Sbjct: 265 KPKHDPYLLKLQLDLQLKRQLLEENYLQEAYINLQTSGMELEKIVYGQIQTALQKFAHYM 324

Query: 383 STSARISIGNLCNELHQGMLSKPPAIEWDHFVGHHPKCLINWKSTEPIPQPRKLSHIRYP 442
              +  +I  +C EL +G+LSKP  IEWD FVG HP CL+NWKS++P+P PR+LS IRYP
Sbjct: 325 DIESCAAINGICQELRRGILSKPTTIEWDDFVGLHPTCLLNWKSSDPVPPPRRLSDIRYP 384

Query: 443 KMKSSLAKCIKAGYLSKKSQILKNYNKGYFVLTSNYLHEFKSSNFFKLSQDNSEKKDHGE 502
           KMKS +AKCI+AGYL KKS++LKNYNKGYFVLTSNYLHEFKSS+FFK++ +N EK     
Sbjct: 385 KMKSPMAKCIRAGYLMKKSKLLKNYNKGYFVLTSNYLHEFKSSDFFKMA-NNGEKPSL-- 441

Query: 503 VQTGSKKRAMVPVTSLSLNSAKLVEASESKFSI----RGI--------ATSSNFERKSAE 550
                KK    P+ S+ LN + + EA   KF +     GI        ATSS     ++ 
Sbjct: 442 -----KKINFDPLGSIPLNESTVTEALPQKFVLCSTWAGIDSQEAGLSATSSG----TSF 492

Query: 551 TGKMISKSTSSIQKFLKSSGXXXXXXXXXXXXXAXXXXXXXXXXXXQDVADDVSTWVFKP 610
           T    S+S+ S+ K LK +              +                     W FKP
Sbjct: 493 TSMQGSRSSVSLGKLLKGAAKPGKALTSAKASTSEITKGH--------------VWTFKP 538

Query: 611 VSSKPEDAKDLKKWIAEVRHLSNFDTSADRAKFIEEKILRAHSRASSMNLAKMASDASAK 670
            +++ E  KD KKW  E+R L+ F+++ +R ++IEEKI++AHSRASS           A 
Sbjct: 539 STTQSE--KDFKKWCGELRQLAGFNSTLERCRYIEEKIVKAHSRASS----------KAS 586

Query: 671 KQDKVASNRTQGSRNKPHFIH---LGPQEFQDPTSARAKINTPAIDDNGNLITAGERHIS 727
           +          G   KP FI    L P  +    +  + INTPA DDNGNLI AG+R++S
Sbjct: 587 QSSIGTPPEGPGRAQKPQFIDIKGLSPIGY----NIASPINTPAFDDNGNLIMAGDRNMS 642

Query: 728 LKSPSELSSPRQSPGQSLNSIGGGTPGSNHQNVPSPVNPQGFVITSNGMTPINRTPAPT 786
           L +PS LS                      Q  PS  N     I+S+G +  +R+P P 
Sbjct: 643 LLTPSGLS---------------------FQGAPSLTN----TISSDGTSLQSRSPTPV 676

>Scas_716.28
          Length = 1108

 Score =  553 bits (1426), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 378/1059 (35%), Positives = 526/1059 (49%), Gaps = 174/1059 (16%)

Query: 49   ILPKTDFHSPYYVNVPTPSQSALTSDYSELSQDAAAAG-----------FVREYPTDILL 97
            +L K D  SP YV+VP P            ++D +AA            +VREYPTDI+ 
Sbjct: 78   LLGKNDERSPLYVDVPIPKALPKQEQQDLQNRDGSAATKGDIELEENQQYVREYPTDIMA 137

Query: 98   DRFTKWRKILKGLANYLREVAYAQERFARINYSLRGAVKFSFLTDLEESTNRVIDPFQQR 157
            DRF KW+KILK L  YLREVAYAQE+F RIN  L+ AVKFSFLTD++E +N++++P    
Sbjct: 138  DRFHKWKKILKALIAYLREVAYAQEQFGRINNQLKTAVKFSFLTDIQEGSNKLVEPM--- 194

Query: 158  AKKPGNAASTSNLNTGLKSPPAVDDEXXXXXXXXXXXXXXAFEVKNV-------PMAP-- 208
                     T+      + P  + ++               FE++N        P AP  
Sbjct: 195  ---------TTIAPIKRQQPMTLAEKQKQAELEKLRATELEFELENSKSQSQFPPQAPLQ 245

Query: 209  ------------------------------GDNDSASSGFMKFGSGSIEDIQVVLKKYHT 238
                                           D+ SA+SGF+KFGSGSI+DIQV+LKKYH 
Sbjct: 246  SQQSQPLNQMPMNDESSMTLNIYPPIQQLESDDTSATSGFIKFGSGSIQDIQVILKKYHL 305

Query: 239  SMGNQQIKMSKELNTVVVPXXXXXXXXXXXXXXEIKELHGDFRTNIGEHIALTGQLLQKY 298
            S+ NQQ K+SKE+ T+++P              EIK++HGDF++NI  H+ LT QLL KY
Sbjct: 306  SVANQQFKVSKEITTLLIPKLEELRKDLRVKIQEIKDIHGDFKSNISHHVKLTNQLLNKY 365

Query: 299  MAAVKFMSTNSNDQNIFKLKNQKLKPKHDPYXXXXXXXXXXXXXXXEENYLQEAYINLQS 358
              +++ M+  S+  + F+       PKHDPY               EENYL++AY+NLQS
Sbjct: 366  NNSIRIMNHQSHSHHEFQ-------PKHDPYLLKLQLDLQLKRQLSEENYLKDAYVNLQS 418

Query: 359  SGLELEKIIYGEVQHTLQRYSALISTSARISIGNLCNELHQGMLSKPPAIEWDHFVGHHP 418
            SG++LEKIIY ++Q+ LQRY+ LI T  R+ I NLC+EL QG+LS+PPA EWDHFV HHP
Sbjct: 419  SGMQLEKIIYSKIQNVLQRYTTLIDTEVRLMIKNLCHELQQGILSRPPAFEWDHFVSHHP 478

Query: 419  KCLINWKSTEPIPQPRKLSHIRYPKMKSSLAKCIKAGYLSKKSQILKNYNKGYFVLTSNY 478
            KCL+NWKS +P+PQPRK+S I Y  MKS LAKCI+AGY       LKN +KGYFVLTSNY
Sbjct: 479  KCLLNWKSVDPVPQPRKVSEIVYSNMKSPLAKCIRAGYF------LKNGSKGYFVLTSNY 532

Query: 479  LHEFKSSNFFKLSQDNSEKKDHGEVQTGSK---KRAMVPVTSLSLNSAKLVEASESKFSI 535
            LHEFK+SNFF  +Q +S  +       G K      + P+ S+SLN  KL+E  E+ F+I
Sbjct: 533  LHEFKTSNFF--NQQSSTLQAPASDPMGKKISTLNGLTPINSISLNECKLIETGENHFTI 590

Query: 536  RG------IATSSN-FERKSAETGKMISKSTSSIQKF-----LKSSGXXXXXXXXXXXXX 583
             G      + T++N     +++T   +S + +  +K+     LKS               
Sbjct: 591  EGTVFHGPVTTTANQLSPSTSKTSASMSLNATHHKKYHLPNLLKS---KKDAKPKTKVPT 647

Query: 584  AXXXXXXXXXXXXQDVADDVSTWVFKPVS--SKPEDAKDLKKWIAEVRHLSNFDTSADRA 641
            A              +   V  W FKP S  +  ED+K  KKW+ +++ L+N+ T  DR+
Sbjct: 648  ATTSSGSTVANNKTSIESKVK-WTFKPASKLTSEEDSKHFKKWVQDLKSLTNYKTVKDRS 706

Query: 642  KFIEEKILRAHSRASSMNLAKMASDASAKKQDKVASNRTQGSRNKPHFIHLGPQEFQDPT 701
            KFIE+++++AH R+ S+ +       S   Q +     T     KP +I +      D +
Sbjct: 707  KFIEDRLMKAHYRSKSVGII----PGSKLSQQQYHYPSTSEKPGKPQYIQIQNSNPTDWS 762

Query: 702  SARAKINTPAIDDNGNLITAGERHISLKSPSELSSPRQSPGQSLNSIGGGTPGSNHQNVP 761
              R+KINTPAIDDNGNLIT  ER  +  + S   SP  SP  S  S       SN     
Sbjct: 763  GFRSKINTPAIDDNGNLITLTERKYA-PTLSMTPSPMVSPMYSDKSAS----SSNPPPPQ 817

Query: 762  SPVNPQGFVITSNG-----MTPINRTPAPTAKRVPXXXXXXXXXXXXXXXXXPMNS--PG 814
                P     TSNG     MT  N + + +    P                  +++   G
Sbjct: 818  QQHQPTNIASTSNGIIQPVMTSRNGSASSSGATTPKGVTLNPRHKRHVSLTNSLSAFVQG 877

Query: 815  SASMAINXXXXXXXXXXXXXYFAIPVH----------------ASSQASTP----GGANP 854
             +++ ++             YFAIPV                 A+S+ STP       +P
Sbjct: 878  GSNLGVHSPESINSDGSMGGYFAIPVRNNQTAYNTAANAKIIDATSRVSTPEYQAAYVHP 937

Query: 855  DS--------------SAAQAQATGPVVPRVRL-NDKDLAHDKPDKSQL-----SEQLSE 894
             S              S  Q Q     VP+V L N++++  +  +  QL     ++Q   
Sbjct: 938  LSRTSSRGTPVMSRHPSQYQLQTVN-TVPKVILNNNQEIGRNVSNPDQLQGAVNNQQNPT 996

Query: 895  KPQATKVSE--GAPLSRGAPVHIRKSVNAGGTGMTIAEPPHSVYANPKQSNSAQT----- 947
             P   K++    APL     +H   S N   T       PH+     + ++S Q+     
Sbjct: 997  MPALKKITSTGSAPL-----MHADSSPNLSTTM------PHASQLYQRSNSSTQSLTTPS 1045

Query: 948  -LASTNAQPIRKHKKNVSFGSLNSLLFSKKGGDVSNNNM 985
             L +    PIRKHKKNVSF SLNSL+FSKKG ++S + M
Sbjct: 1046 QLVTQRVHPIRKHKKNVSFSSLNSLMFSKKGSNISTHVM 1084

>CAGL0G03179g 295541..298726 similar to sp|P48361 Saccharomyces
            cerevisiae YGR097w ASK10 involved in SKN7P-dependent
            transcription, hypothetical start
          Length = 1061

 Score =  540 bits (1391), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 386/1089 (35%), Positives = 534/1089 (49%), Gaps = 252/1089 (23%)

Query: 23   DDASSLFSSDSGYLMELA------------DASDDDETILPKTDFHSPYYVNVPTP--SQ 68
            DDA S+ SSD  YLM++               +   E ILP+TD  SPY+V VP P  + 
Sbjct: 54   DDAVSIKSSD--YLMDMVPDSMTLKDGASISTAKRKEFILPETDERSPYFVGVPVPVIAA 111

Query: 69   SALTSD----YSELSQDAAAAG--------FVREYPTDILLDRFTKWRKILKGLANYLRE 116
            SA+  +      + ++     G        FVREYPTD+L+DRF KW+KILK +  YLRE
Sbjct: 112  SAVVDNGDKSLEKSTRSKTVIGDTEGYDGQFVREYPTDMLIDRFYKWKKILKSIIAYLRE 171

Query: 117  VAYAQERFARINYSLRGAVKFSFLTDLEESTNRVIDPFQQRAKK--PGNAASTSNLNTGL 174
            VAYAQE+FARIN  LR +VKF FLTDL E +N++IDP  Q  KK  P   A         
Sbjct: 172  VAYAQEQFARINNQLRNSVKFPFLTDLTEGSNKIIDPLSQAPKKNAPTTMAQKRKQKEEE 231

Query: 175  KSPPAVDDEXXXXXXXXXXXXXXAFEVKNVPMAPGDNDSASSGFMKFGSGSIEDIQVVLK 234
            ++ P VD                      +P+   DN SASSGF++FGSGSI+DIQV+LK
Sbjct: 232  QNAPNVDLPPVDPSEQF------------MPVQATDNTSASSGFLRFGSGSIQDIQVILK 279

Query: 235  KYHTSMGNQQIKMSKELNTVVVPXXXXXXXXXXXXXXEIKELHGDFRTNIGEHIALTGQL 294
            KYH S+ NQQ K+SKE+ + V+P              EIKEL+GDF+TNI  HI +TG L
Sbjct: 280  KYHVSLANQQFKISKEIVSTVIPKLEEIKKDLSFKIKEIKELNGDFKTNINYHIKMTGIL 339

Query: 295  LQKYMAAVKFMSTNSNDQNIFKLKNQKLKPKHDPYXXXXXXXXXXXXXXXEENYLQEAYI 354
            L+KY+AA +F+  N+  Q++      KLKPKHDPY               EENYLQEA++
Sbjct: 340  LKKYIAACRFVDRNNYLQDV----QNKLKPKHDPYLLKLQLDLQLKRQIAEENYLQEAFV 395

Query: 355  NLQSSGLELEKIIYGEVQHTLQRYSALISTSARISIGNLCNELHQGMLSKPPAIEWDHFV 414
            NLQSSGL+LEKIIY  +QH LQRYS LI + AR+ I NLC EL  G+L+KPPA+EWD+FV
Sbjct: 396  NLQSSGLQLEKIIYSRIQHVLQRYSTLIDSEARLMIKNLCQELQYGILAKPPAMEWDNFV 455

Query: 415  GHHPKCLINWKSTEPIPQPRKLSHIRYPKMKSSLAKCIKAGYL----SKKSQILKNYNKG 470
             HHP CL+NWKS +P+P PR  S + YP MKS ++KCI+AGY       KS    N+ K 
Sbjct: 456  SHHPLCLLNWKSNDPVPVPRNASAVIYPNMKSPMSKCIRAGYFMMKSESKSSKSNNFQKS 515

Query: 471  YFVLTSNYLHEFKSSNFFK-----LSQDNS-------------------EKKDHGEVQT- 505
            YF+LTS Y+H+F SS+F+K      +Q NS                    +K  G V   
Sbjct: 516  YFILTSTYIHQFSSSDFYKPKKGAPNQQNSIQFQFQPNIYHNYNNNSINTRKVSGNVNAV 575

Query: 506  ------------GSKKRAMVPVTSLSLNSAKLVEASESKFSIRGIATSSN---------- 543
                         S+   ++P+ S+ L+  +LVE+S++ F I G A  SN          
Sbjct: 576  SGHNGVTVENSPFSRHSEVIPIASIPLSECRLVESSDAIFVIEGKAEYSNNLTEKVPKKQ 635

Query: 544  -FERKSAETGKMISKSTSSI----------QKFLKSSGXXXXXXXXXXXXXAXXXXXXXX 592
             ++  +      IS   +SI           K L  +                       
Sbjct: 636  VYKSMAHAGSNTISNPLASIPGAKYGQDASTKVLHKTKLSKLVKGAKAKTLGTETSKHSK 695

Query: 593  XXXXQD----VADDVST-----WVFKPVSSKP--EDAKDLKKWIAEVRHLSNFDTSADRA 641
                +D    V + V T     W FK V+ KP  ++ K   KWI ++++L+ F+   +R 
Sbjct: 696  SGLEKDANKVVTNKVYTTEQVKWTFKMVAEKPTEDEVKYFNKWIIDIKNLTKFEKPKERF 755

Query: 642  KFIEEKILRAHSRASSMNLAKMASDASAKKQDKVASNRTQGSRNKPHFIHLGPQEFQDPT 701
             FIE++++++ ++          S  S  ++ +   N T     KP +I LG       T
Sbjct: 756  NFIEDRLMKSQTK----------SQMSVAEEGRSNQNSTSNFAGKPTYISLGVDSKSTFT 805

Query: 702  SARAKINTPAIDDNGNLITAGERHISLKSP----SELSSPRQS--PGQSLNSIGGGTPGS 755
               + +NTPAIDDNGNLIT G+RH S+ SP    +  +S RQS  P  SL       PGS
Sbjct: 806  PDGSVMNTPAIDDNGNLITFGQRH-SVVSPHYSNNSDNSYRQSYRPTNSL-------PGS 857

Query: 756  NHQNVPSPVNPQGFVITSNGMTPINRTPAPTAKRVPXXXXXXXXXXXXXXXXXPMNSPGS 815
             + + P PVN                  +PT+                      +NS GS
Sbjct: 858  RNLS-PLPVN------------------SPTS----------------------VNSEGS 876

Query: 816  ASMAINXXXXXXXXXXXXXYFAIPVHASSQASTPG-----------------GANPDSSA 858
                               YFAIPV+   Q S PG                 G++P+ + 
Sbjct: 877  GG----------------GYFAIPVN--KQMSHPGSNVQVSEFGSRSNVNTAGSSPNITG 918

Query: 859  ----AQAQATGPVVPRVRLNDKDLAHDKPDKSQLSEQLSEKPQATKVSEGAPLSRGAPVH 914
                   Q+TG VVP+V++N++++  + P           +P A+  +            
Sbjct: 919  MGYFVPVQSTG-VVPKVKVNNEEMGQNSP-----------QPPASPYNS----------- 955

Query: 915  IRKSVNAGGTGMTIAEPPHSVYANPKQSNSAQT--LASTNA----QPIRKHKKNVSFGSL 968
            +RK+++ G       E       N  ++N++ T  +A+ N     Q +RKHKKNVSF SL
Sbjct: 956  LRKNISTGSIPTLNNEGSRPESGNFYKNNNSSTNLVAAANGTARVQAVRKHKKNVSFSSL 1015

Query: 969  NSLLFSKKG 977
            NSL+FSKKG
Sbjct: 1016 NSLMFSKKG 1024

>YPR115W (YPR115W) [5536] chr16 (754873..758124) Protein containing
           a pleckstrin homology (PH) domain, which mediate
           protein-protein and protein-lipid interactions, has
           moderate similarity to S. cerevisiae Ask10p, which may
           be a transcription factor in the S. cerevisiae
           Skn7p-mediated regulatory system [3252 bp, 1083 aa]
          Length = 1083

 Score =  528 bits (1361), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 318/824 (38%), Positives = 450/824 (54%), Gaps = 161/824 (19%)

Query: 23  DDASSLFSSDSGYLMELA--------------------DASDD-----DETILPKTDFHS 57
           D+ +S++S+DS YLM++                     D  ++     DE ILPKTD  S
Sbjct: 46  DELASMYSADSQYLMDMIPDSLTLKNEPASGNTQMNGPDGKENKDIKLDEYILPKTDPRS 105

Query: 58  PYYVNVPTPS------------QSALTSDYSELSQD---AAAAGFVREYPTDILLDRFTK 102
           PYY+N+P P             Q    +D S+L  +     +  FVREYPTDIL+DRF K
Sbjct: 106 PYYINMPIPKKLPKSEGKARAKQKVNRADPSDLDVENIYETSGEFVREYPTDILIDRFHK 165

Query: 103 WRKILKGLANYLREVAYAQERFARINYSLRGAVKFSFLTDLEESTNRVIDPFQQRAKKPG 162
           W+KILK L  Y RE AY+QE+ ARINY ++ AVKF+FLTDLE+ TN+++DP         
Sbjct: 166 WKKILKSLIAYFREAAYSQEQIARINYQMKNAVKFAFLTDLEDETNKLVDP--------- 216

Query: 163 NAASTSNLNTGLKSPPAVDDEXXXXXXXXXXXXXXAFEVKNVPMAPGDNDSASSGFMKFG 222
              S S L T  K P  V                    +++VP    +  SASSGFMKFG
Sbjct: 217 ---SISKLPT--KKPQPVPLAAQKLDSKYDTDVEQPQSIQSVPSE--EVASASSGFMKFG 269

Query: 223 SGSIEDIQVVLKKYHTSMGNQQIKMSKELNTVVVPXXXXXXXXXXXXXXEIKELHGDFRT 282
           SGSI+DIQV+LKKYH S+G+QQ K+SKE+   ++P              EIKEL+GDF+T
Sbjct: 270 SGSIQDIQVILKKYHLSLGSQQYKISKEILAYIIPKLTDLRKDLTTKMKEIKELNGDFKT 329

Query: 283 NIGEHIALTGQLLQKYMAAVKFM--STNSNDQNIFKLKNQKLKPKHDPYXXXXXXXXXXX 340
           NIGEHI +T +LL KY+A+VK +  ++ S D+     + +KLKPKHDPY           
Sbjct: 330 NIGEHIKITSRLLNKYIASVKLLDEASTSGDK-----QGEKLKPKHDPYLLKLQLDLQLK 384

Query: 341 XXXXEENYLQEAYINLQSSGLELEKIIYGEVQHTLQRYSALISTSARISIGNLCNELHQG 400
               EENYL+EA++NLQS+ L+LEKI+Y ++Q  LQRYSALI + AR+ I NLC+EL QG
Sbjct: 385 RQLLEENYLREAFLNLQSAALQLEKIVYSKIQSALQRYSALIDSEARLMIKNLCHELQQG 444

Query: 401 MLSKPPAIEWDHFVGHHPKCLINWKSTEPIPQPRKLSHIRYPKMKSSLAKCIKAGYLSKK 460
           +LS+PPA+EWD+FV HHP CL+N KST+P PQPR+LS I YP MKS LAKCI+ GYL KK
Sbjct: 445 ILSRPPAVEWDNFVSHHPTCLMNLKSTDPPPQPRRLSDIVYPNMKSPLAKCIRVGYLLKK 504

Query: 461 SQILKNYNKGYFVLTSNYLHEFKSSNFF--------------------KLSQDNSEKKDH 500
           ++  K++ KGYFVLT+NYLHEFKSS+FF                    ++++D +    H
Sbjct: 505 TESSKSFTKGYFVLTTNYLHEFKSSDFFLDSKSPRSKNKPVVEQSDISRVNKDGTNAGSH 564

Query: 501 -----------GEVQTGSKKRAMVPVTSLSLNSAKLVEASESKFSIRGIATSSNFE---- 545
                       + + G     + P++SLSLN   L ++++S F ++G A+  + E    
Sbjct: 565 PSSKGTQDPKLTKRRKGLSSSNLYPISSLSLNDCSLKDSTDSTFVLQGYASYHSPEDTCT 624

Query: 546 RKSAETGKMISKSTS------------------SIQKFLKSSGXXXXXXXXXXXXXAXXX 587
           ++S+ T  +   + +                  S+ KFLKSS                  
Sbjct: 625 KESSTTSDLACPTKTLASNKGKHQRTPSALSMVSVPKFLKSSSVPKEQKKAKEEANINK- 683

Query: 588 XXXXXXXXXQDVADDVSTWVFKPVSSK----PEDAKDLKKWIAEVRHLSNFDTSADRAKF 643
                    + + +    W FK  S+     PE++K+ KKW+ +++ L++F+++ +R+ F
Sbjct: 684 ---------KSICEKRVEWTFKIFSASLEPTPEESKNFKKWVQDIKALTSFNSTQERSNF 734

Query: 644 IEEKIL--RAHSRASSMNLAKMAS-----DASAKKQDKVASN------RTQGSRNKPHFI 690
           IEEKIL  R H+   S   +K ++     D+     +KV  +       T+   N+P +I
Sbjct: 735 IEEKILKSRNHNNGKSSQRSKNSTYITPVDSFVNLSEKVTPSSSVTTLNTRKRANRPRYI 794

Query: 691 HLGPQEFQDPTSA-----------RAKINTPAIDDNGNLITAGE 723
            +       P SA           R+K+NTPAID+NGNL   GE
Sbjct: 795 DI-------PKSANMNAGAMNSVYRSKVNTPAIDENGNLAIVGE 831

>CAGL0B04213g 412230..414932 some similarities with sp|P48361
           Saccharomyces cerevisiae YGR097w ASK10 involved in
           SKN7P-dependent transcription, hypothetical start
          Length = 900

 Score =  370 bits (949), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 248/729 (34%), Positives = 366/729 (50%), Gaps = 65/729 (8%)

Query: 49  ILPKTDFHSPYYVNVPTPSQSALTSDYSELSQDAAA--------AGFVREYPTDILLDRF 100
           ++ +T+ +SPYY+ VP P   A+T   + +S  A          + +V+EYPT +L DRF
Sbjct: 95  VVSRTEVNSPYYLPVPVPE--AVTDSANPVSSSAKEQYLNGYHHSQYVKEYPTVLLADRF 152

Query: 101 TKWRKILKGLANYLREVAYAQERFARINYSLRGAVKFSFLTDLEESTNRVIDPFQQRAKK 160
            KW KILK L +YLRE AY +E  AR++  L+  V F FLTDL++  N+++DP+Q+    
Sbjct: 153 KKWNKILKYLISYLREAAYVEEHIARLHVKLKKKVTFPFLTDLDDH-NQLVDPYQKNLP- 210

Query: 161 PGNAASTSNLNTGLKSPPAVDDEXXXXXXXXXXXXXXAFEVK---NVPMAPGDNDSASSG 217
                 T  +    K     +                 F+ +    VP++  ++  A SG
Sbjct: 211 ---TKRTQPITPAEKKRLEAEAALAAATTTEETTEELDFDTELEDEVPVSSDNDTMAPSG 267

Query: 218 FMKFGSGSIEDIQVVLKKYHTSMGNQQIKMSKELNTVVVPXXXXXXXXXXXXXXEIKELH 277
           F+KFGSGSI+DIQV+LKKYH S+  QQ+K+S+E+   V+P              EIK L 
Sbjct: 268 FLKFGSGSIQDIQVLLKKYHGSIAGQQLKVSREIMENVIPKLEGLVKELNNKIREIKSLD 327

Query: 278 GDFRTNIGEHIALTGQLLQKYMAAVKFMSTNSNDQNIFKLKNQKLKPKHDPYXXXXXXXX 337
           GDFRTN+   +  T +L+QKY + VK ++   +D          ++PK DPY        
Sbjct: 328 GDFRTNLIGQMNQTSRLIQKYNSVVKKLANEKSDATT------TIQPKCDPYLVKIQLET 381

Query: 338 XXXXXXXEENYLQEAYINLQSSGLELEKIIYGEVQHTLQRYSALISTSARISIGNLCNEL 397
                  EE YL EA++NLQSSGL+LE+I+Y ++Q  L+ Y+ALI + AR+ + NLC EL
Sbjct: 382 QLKKQLAEEKYLMEAFVNLQSSGLDLERIVYTKIQSALENYTALIDSEARLILKNLCQEL 441

Query: 398 HQGMLSKPPAIEWDHFVGHHPKCLINWKSTEPIPQPRKLSHIRYPKMKSSLAKCIKAGYL 457
            QGMLSKP   EWD F+ HH  C++NW ST+P P PR+LS I Y  MK+  +KCI+ GY+
Sbjct: 442 QQGMLSKPANYEWDQFITHHTNCMLNWTSTQPKPVPRELSDIVYQNMKAPQSKCIRKGYM 501

Query: 458 SKKS-QILKNYNKGYFVLTSNYLHEFKSSNF---FKLSQDNSEKKDHGEVQTGSKKRAMV 513
              S + +K Y+KGYF+LTS+YLHEFK S+F    K S D S    H  +   +    ++
Sbjct: 502 YYGSGKDVKKYSKGYFILTSHYLHEFKDSDFSKEMKGSTDASNNFCHMAISLVN----LI 557

Query: 514 PVTSLSLNSAKLVEASESK--FSIRGIATSSNFERKSAETGKMI---SKS---TSSIQKF 565
           P  S SL+   + E ++++  F+ R + ++      S          S+S   T+++ KF
Sbjct: 558 PEKSFSLSDIDIEEITDTEMVFTARSLKSTKPRSSPSPAPIPAPEHKSRSPSITAAVPKF 617

Query: 566 LKSSGXXXXXXXXXXXXXAXXXXXXXXXXXXQDVADDVSTWVFKPV--SSKPEDAKDLKK 623
           L+                                  + +TW  +        E  K  KK
Sbjct: 618 LRGGPSRSTKTRSNSGANRQTLFAEPSLSEPLREIGERTTWHLRLSLGDYDEEYKKQFKK 677

Query: 624 WIAEVRHLSNFDTSADRAKFIEEKILRAHSRASSMNLAKMASDASAKKQDKVASNRTQGS 683
           W ++ + L++F+ S  R  FI E+   A  RAS     K A      KQ     N     
Sbjct: 678 WSSDFKALADFNHSYHRNSFINERAESATRRAS-----KTAGPGEFNKQ-----NSDSSR 727

Query: 684 RNKPHFIHLGPQEFQDPTSARAKI-NTPAIDDNGNLITAGERHISL------KSPSELSS 736
            +    I       QD   + +KI N   +D++GNLI +  R  S+      +  S L+S
Sbjct: 728 GSSDSTI------VQDSGRSDSKIGNIVGLDEDGNLIASDGRKYSVSPQLQRQGSSGLTS 781

Query: 737 PRQSPGQSL 745
           P   PG  L
Sbjct: 782 PSSQPGSPL 790

>Kwal_23.4958
          Length = 649

 Score =  171 bits (434), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 102/313 (32%), Positives = 152/313 (48%), Gaps = 41/313 (13%)

Query: 218 FMKFGSGSIEDIQVVLKKYHTSMGNQQIKMSKELNTVVVPXXXXXXXXXXXXXXEIKELH 277
           F+  G+GS++D+  +L ++H+ M N  +KMSKEL   V+P              EIK LH
Sbjct: 213 FLPMGNGSVQDLPSILSQFHSQMANGALKMSKELANEVIPRLEDLRGDLLIKIKEIKTLH 272

Query: 278 GDFRTNIGEHIALTGQLLQKYMAAVKFMSTNSNDQNIFKLKNQKLKPKHDPYXXXXXXXX 337
            DF+ +  + +  T   L+ ++ AV+     +              PK DPY        
Sbjct: 273 SDFKNSCSKELQQTKHDLKHFIEAVEAARYGA--------------PKSDPYLIKISLEK 318

Query: 338 XXXXXXXEENYLQEAYINLQSSGLELEKIIYGEVQHTLQRYSALISTSARISIGNLCNEL 397
                  EEN L EA+ NLQ SG ELEK++  E+Q+ L  Y+ L+  +A+I    L + L
Sbjct: 319 QIKRQLNEENLLHEAFDNLQGSGRELEKVVVMEIQNALSIYARLLGQNAQIVFDVLISRL 378

Query: 398 HQGMLSKPPAIEWDHFVGHHPKCLINWKSTEPIPQPRKLSHIRYPKMKSSLAKCIKAGYL 457
             G  +K P  EWD+F+   P  +      EP    R +  I Y      L   +K+G+L
Sbjct: 379 DVGFFNKEPVFEWDNFISKDPNFI------EPNLPVRHMRDIVYKYQDDPLTYEVKSGFL 432

Query: 458 SKKSQILKNYNKGYFVLTSNYLHEFKSSNFFKLSQDNSEKKDHGEVQTGSKKRAMVPVTS 517
            ++S+ LK+Y KG+++LTS+YLHEFK                     T  +KR +VPV S
Sbjct: 433 ERRSKFLKSYTKGFYLLTSSYLHEFK---------------------TPDRKRDLVPVMS 471

Query: 518 LSLNSAKLVEASE 530
           LSLN   + E S+
Sbjct: 472 LSLNDCTVAEHSK 484

>ADL234C [1507] [Homologous to ScYIL105C - SH; ScYNL047C - SH]
           (293117..295327) [2211 bp, 736 aa]
          Length = 736

 Score =  168 bits (426), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 119/441 (26%), Positives = 185/441 (41%), Gaps = 103/441 (23%)

Query: 92  PTDILLDRFTKWRKILKGLANYLREVAYAQERFARINYSLRGAVKFSFLTDLEESTNRVI 151
           PT++L  RF  WR ++K +  YL E A  Q+    +   LR +   SF            
Sbjct: 246 PTEVLAGRFASWRAVIKAIIVYLTETASIQDEL--VRQHLRLSHAVSF------------ 291

Query: 152 DPFQQRAKKPGNAASTSNLNTGLKSPPAVDDEXXXXXXXXXXXXXXAFEVKNV--PMAPG 209
            PF                                            F V+NV  P  P 
Sbjct: 292 -PF--------------------------------------------FSVENVRQPSTP- 305

Query: 210 DNDSASSGFMKFGSGSIEDIQVVLKKYHTSMGNQQIKMSKELNTVVVPXXXXXXXXXXXX 269
           +  +    F+  GSGSI+D+  +L  YH  M +   K SKEL   V+P            
Sbjct: 306 EEKAIQQFFLPLGSGSIQDLPTILTGYHAQMASMASKASKELTNEVIPRLEDMRRDLLVK 365

Query: 270 XXEIKELHGDFRTNIGEHIALTGQLLQKYMAAVKFMSTNSNDQNIFKLKNQKLKPKHDPY 329
             EIK L  DF+ +  + ++ T Q+L+ +  +V+              + +   PK DPY
Sbjct: 366 IKEIKSLQSDFKNSCAKEVSETKQMLRTFHESVE--------------QARYGTPKSDPY 411

Query: 330 XXXXXXXXXXXXXXXEENYLQEAYINLQSSGLELEKIIYGEVQHTLQRYSALISTSARIS 389
                          EEN+L +A+ NLQ+SG ELEK++  E+Q  L  Y+ ++   A++ 
Sbjct: 412 LTRILLDKQLKRQLAEENFLHQAFNNLQASGKELEKVVVMEIQSALTVYARILGREAQLV 471

Query: 390 IGNLCNELHQGMLSKPPAIEWDHFVGHHPKCLINWKSTEPIPQPRKLSHIRYPKMKSSLA 449
             ++  +L  G LS+ P  EWD F+   P  +      EP    R L  I Y      L 
Sbjct: 472 FDSVITKLDMGFLSRDPVFEWDDFIARDPNFV------EPSVPMRSLKDITYKHQYDPLT 525

Query: 450 KCIKAGYLSKKSQILKNYNKGYFVLTSNYLHEFKSSNFFKLSQDNSEKKDHGEVQTGSKK 509
             ++ G+L ++S+ LK+Y++G++VLT ++LHEFK                     T  +K
Sbjct: 526 YKLQCGFLERRSKFLKSYSRGFYVLTPSFLHEFK---------------------TCDRK 564

Query: 510 RAMVPVTSLSLNSAKLVEASE 530
           + + PV SLSL+   + E S+
Sbjct: 565 KDVSPVMSLSLSDCTVAEHSK 585

>CAGL0G01386g complement(132280..133878) similar to sp|P40485
           Saccharomyces cerevisiae YIL105c or sp|P53955
           Saccharomyces cerevisiae YNL047c, hypothetical start
          Length = 532

 Score =  162 bits (409), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 129/438 (29%), Positives = 192/438 (43%), Gaps = 59/438 (13%)

Query: 91  YPTDILLDRFTKWRKILKGLANYLREVAYAQERFARINYSLRGAVKFSFLTDLEESTNRV 150
           +P + L  RFT+WRK+LK +  YL EVA  QE        +R   K S +      +N  
Sbjct: 20  HPAEQLAQRFTEWRKVLKAIIVYLSEVASVQEEI------IRQNAKVSNILASHGISNAG 73

Query: 151 IDPFQQRAKKPGNAASTSNLNTGLKSPPAVDDEXXXXXXXXXXXXXXAFEVKNVPMAPGD 210
           I           N  S +N    L S  A D                  E  N   A   
Sbjct: 74  IGSSGSGLSGSFNLTSAAN---KLASGGAHDKHGKNNNGWFFSGS----EEDNTHSA--- 123

Query: 211 NDSASSGFMKFGSGSIEDIQVVLKKYHTSMGNQQIKMSKELNTVVVPXXXXXXXXXXXXX 270
            ++ +  F+  G+GSI+D+ ++L++YH  M  +  K ++EL   ++P             
Sbjct: 124 -NTINHFFLPIGNGSIQDVPIILRQYHDVMAAEAAKGTRELQNSIIPGLESLNKDLVLKI 182

Query: 271 XEIKELHGDFRTNIGEHIALTGQLLQKYMAAVKFMSTNSNDQNIFKLKNQKLKPKHDPYX 330
             IK L  DF+ N  + +  T + + K+  ++     N   +N+         P  DPY 
Sbjct: 183 KSIKSLSSDFKNNCSKELDTTRECMVKFQQSI-----NQARKNV---------PARDPYL 228

Query: 331 XXXXXXXXXXXXXXEENYLQEAYINLQSSGLELEKIIYGEVQHTLQRYSALISTSARISI 390
                         EEN+L EA++NLQSSG ELEKI+   +Q+  +  + ++   A+I  
Sbjct: 229 LKVNLDNQIRRQLSEENFLHEAFMNLQSSGQELEKIVVASIQNAFRVLAQILGAEAKIID 288

Query: 391 GNLCNELHQGMLSKPPAIEWDHFVGHHPKCLINWKSTEPIPQP-RKLSHIRYPKMKSSLA 449
             L N L    LS  P+ EWD+F+       I      P+  P RK   I Y      L 
Sbjct: 289 DQLVNRLLSSFLSLSPSHEWDNFLLRDNTNFI------PLNLPMRKFKEIEYTGKNDPLT 342

Query: 450 KCIKAGYLSKKSQILKNYNKGYFVLTSNYLHEFKSSNFFKLSQDNSEKKDHGEVQTGSKK 509
             ++ GYL ++S+ LK+Y KGY+VLT NYLHEFK+S+                     +K
Sbjct: 343 LVVQCGYLERRSKYLKSYTKGYYVLTPNYLHEFKTSD---------------------RK 381

Query: 510 RAMVPVTSLSLNSAKLVE 527
           R  VP+ SLSL   K+V+
Sbjct: 382 RDSVPLFSLSLAECKVVQ 399

>Sklu_2395.6 YIL105C, Contig c2395 8302-10437
          Length = 711

 Score =  162 bits (410), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 97/313 (30%), Positives = 151/313 (48%), Gaps = 41/313 (13%)

Query: 218 FMKFGSGSIEDIQVVLKKYHTSMGNQQIKMSKELNTVVVPXXXXXXXXXXXXXXEIKELH 277
           F+  G+GSI+D+  +L +YH+ M +   K SKEL   V+P              EIK L 
Sbjct: 250 FLPLGNGSIQDLPSILTQYHSQMASAASKASKELTNEVLPRLEDLRRDLLVKIKEIKGLQ 309

Query: 278 GDFRTNIGEHIALTGQLLQKYMAAVKFMSTNSNDQNIFKLKNQKLKPKHDPYXXXXXXXX 337
            DF+ +  + +  T Q L+ +  +++     +               + DPY        
Sbjct: 310 SDFKNSCNKELQQTKQDLKGFQDSIEEARYGT--------------ARQDPYLAKIILDK 355

Query: 338 XXXXXXXEENYLQEAYINLQSSGLELEKIIYGEVQHTLQRYSALISTSARISIGNLCNEL 397
                  EEN+L EA+ NLQSSG ELEK++  E+Q+ L  Y+ ++   A++    L ++L
Sbjct: 356 QIKRQLTEENFLHEAFNNLQSSGRELEKVVVMEIQNALTIYARILGQEAQLVFDILISKL 415

Query: 398 HQGMLSKPPAIEWDHFVGHHPKCLINWKSTEPIPQPRKLSHIRYPKMKSSLAKCIKAGYL 457
             G  +K P  EWD+FV   P  +      EP    R +  I Y      L   +K+G+L
Sbjct: 416 DMGFFNKEPIFEWDNFVSKDPNFV------EPDLPMRHMKDIVYRNQFDPLTNEVKSGFL 469

Query: 458 SKKSQILKNYNKGYFVLTSNYLHEFKSSNFFKLSQDNSEKKDHGEVQTGSKKRAMVPVTS 517
            ++S+ LK+Y+KG++VLT ++LHEFK                     TG +K+ +VPV S
Sbjct: 470 ERRSKFLKSYSKGFYVLTPSFLHEFK---------------------TGDRKKDLVPVMS 508

Query: 518 LSLNSAKLVEASE 530
           LSLN   + E S+
Sbjct: 509 LSLNDCTVAEHSK 521

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 24/49 (48%)

Query: 92  PTDILLDRFTKWRKILKGLANYLREVAYAQERFARINYSLRGAVKFSFL 140
           PT++L  RF  WR +++ +  Y+ E    Q+   R    L  AV F F 
Sbjct: 182 PTEVLAQRFAAWRSVIRSILVYMTETVSIQDEIVRQQLRLSHAVNFPFF 230

>CAGL0G02827g complement(259569..261818) similar to sp|P40485
           Saccharomyces cerevisiae YIL105c, start by similarity
          Length = 749

 Score =  162 bits (410), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 97/325 (29%), Positives = 154/325 (47%), Gaps = 46/325 (14%)

Query: 218 FMKFGSGSIEDIQVVLKKYHTSMGNQQIKMSKELNTVVVPXXXXXXXXXXXXXXEIKELH 277
           F+  GSGS++D+  +L +YH ++ +     S+EL   V+P              EIK L 
Sbjct: 296 FLPLGSGSVQDLPTILNQYHEALASNASNASRELTNDVIPRLEDLRRDLLVKIKEIKSLQ 355

Query: 278 GDFRTNIGEHIALTGQLLQKYMAAVKFMSTNSNDQNIFKLKNQKLKPKHDPYXXXXXXXX 337
            DF+ +  + +  T Q ++ Y+ ++K     +              PK DPY        
Sbjct: 356 SDFKNSCAKELQQTKQDMKHYIDSLKEARYGT--------------PKQDPYLAKIALDK 401

Query: 338 XXXXXXXEENYLQEAYINLQSSGLELEKIIYGEVQHTLQRYSALISTSARISIGNLCNEL 397
                  EEN+L EA+ NL++SG ELEK++  E+Q+ L  Y+ L+   +++    L ++L
Sbjct: 402 QIKKQLIEENFLHEAFDNLETSGAELEKVVVMEIQNALTIYARLLGQQSQLIFDILISKL 461

Query: 398 HQGMLSKPPAIEWDHFVGHHPKCLINWKSTEPIPQPRKLSHIRYPKMKSSLAKCIKAGYL 457
             G  +  P  EWD F+   P  L      +P    R L  I Y          I++GYL
Sbjct: 462 DMGFFNMNPQYEWDTFISRDPNFL------QPNVPMRNLKEITYKYQHDPFTYEIRSGYL 515

Query: 458 SKKSQILKNYNKGYFVLTSNYLHEFKSSNFFKLSQDNSEKKDHGEVQTGSKKRAMVPVTS 517
            ++S+ LK+Y+KG++VLT N+LHEFKS +                     +K+ +VP+ S
Sbjct: 516 ERRSKFLKSYSKGFYVLTPNFLHEFKSID---------------------RKKDLVPIMS 554

Query: 518 LSLNSAKLVEAS-----ESKFSIRG 537
           LSLN   + E S     E+KF + G
Sbjct: 555 LSLNECTVTEHSKKGSHEAKFVLHG 579

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 29/50 (58%)

Query: 92  PTDILLDRFTKWRKILKGLANYLREVAYAQERFARINYSLRGAVKFSFLT 141
           PTD+L  RF+ WR +++ +  YL E+A  ++   R    L  AV+F F T
Sbjct: 228 PTDVLAARFSAWRNVIRSIIVYLTEIASIEDEIVRQQLRLSHAVQFPFFT 277

>YIL105C (YIL105C) [2571] chr9 complement(167578..169638) Protein
           with similarity to Ask10p and Ynl047p, contains a
           Q/N-rich domain [2061 bp, 686 aa]
          Length = 686

 Score =  156 bits (394), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 96/320 (30%), Positives = 153/320 (47%), Gaps = 41/320 (12%)

Query: 210 DNDSASSGFMKFGSGSIEDIQVVLKKYHTSMGNQQIKMSKELNTVVVPXXXXXXXXXXXX 269
           ++ S    F+  G+GSI+D+  +L +YH S+ +   K S+EL   V+P            
Sbjct: 248 EDKSVQKFFLPLGNGSIQDLPTILNQYHESLASSASKASRELTNDVIPRLEDLRRDLIVK 307

Query: 270 XXEIKELHGDFRTNIGEHIALTGQLLQKYMAAVKFMSTNSNDQNIFKLKNQKLKPKHDPY 329
             EIK L  DF+ +  + +  T Q ++++  ++K                +   PK DP+
Sbjct: 308 IKEIKSLQSDFKNSCSKELQQTKQAMKQFQESLK--------------DARYSVPKQDPF 353

Query: 330 XXXXXXXXXXXXXXXEENYLQEAYINLQSSGLELEKIIYGEVQHTLQRYSALISTSARIS 389
                          EEN+L EA+ NL++SG ELEKI+  E+Q++L  Y+ L+   A++ 
Sbjct: 354 LTKLALDRQIKKQLQEENFLHEAFDNLETSGAELEKIVVMEIQNSLTIYARLLGQEAQLV 413

Query: 390 IGNLCNELHQGMLSKPPAIEWDHFVGHHPKCLINWKSTEPIPQPRKLSHIRYPKMKSSLA 449
              L ++L  G  +  P  EWD+F+   P  L+      P    R    I Y      L 
Sbjct: 414 FDILISKLDSGFFNVDPQFEWDNFISRDPNFLL------PNLPMRTFKEIVYKYQFDPLT 467

Query: 450 KCIKAGYLSKKSQILKNYNKGYFVLTSNYLHEFKSSNFFKLSQDNSEKKDHGEVQTGSKK 509
             IK+G+L ++S+ LK+Y+KGY+VLT N+LHEFK                     T  +K
Sbjct: 468 YEIKSGFLERRSKFLKSYSKGYYVLTPNFLHEFK---------------------TADRK 506

Query: 510 RAMVPVTSLSLNSAKLVEAS 529
           + +VPV SL+L+   + E S
Sbjct: 507 KDLVPVMSLALSECTVTEHS 526

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 29/50 (58%)

Query: 92  PTDILLDRFTKWRKILKGLANYLREVAYAQERFARINYSLRGAVKFSFLT 141
           PTDIL  RF+ WR ++K +  YL E+A  Q+   R    L  AV+F F +
Sbjct: 188 PTDILAARFSAWRNVIKSVIVYLTEIASIQDEIVRQQLRLSHAVQFPFFS 237

>Scas_671.23
          Length = 686

 Score =  155 bits (392), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 97/325 (29%), Positives = 152/325 (46%), Gaps = 46/325 (14%)

Query: 218 FMKFGSGSIEDIQVVLKKYHTSMGNQQIKMSKELNTVVVPXXXXXXXXXXXXXXEIKELH 277
           F+  G+ SI+D+  +L  YH    N     S+EL   V+P              EIK L 
Sbjct: 302 FLPQGNNSIQDLPTILFNYHNKTANSASAASRELTNEVIPRLEDLRRDLLIKIKEIKSLQ 361

Query: 278 GDFRTNIGEHIALTGQLLQKYMAAVKFMSTNSNDQNIFKLKNQKLKPKHDPYXXXXXXXX 337
            DF+ +  + +  T Q L+ +  ++K    ++              PK DPY        
Sbjct: 362 SDFKNSCIKELQQTKQDLRNFYDSLKDARYST--------------PKQDPYLTKIVLDK 407

Query: 338 XXXXXXXEENYLQEAYINLQSSGLELEKIIYGEVQHTLQRYSALISTSARISIGNLCNEL 397
                  EEN+L EA+ NL++SG ELEK++  E+Q+ L +Y+ L+   ++I   +L  +L
Sbjct: 408 QIKRQISEENFLHEAFDNLETSGAELEKVVVMEIQNALTQYARLLGQQSQIVFDDLIAKL 467

Query: 398 HQGMLSKPPAIEWDHFVGHHPKCLINWKSTEPIPQPRKLSHIRYPKMKSSLAKCIKAGYL 457
             G  +  P  EWD+F+   P  L+      P    R   +I Y      L   I++GYL
Sbjct: 468 DSGFFNIDPQFEWDNFIARDPNFLL------PNLPMRNFKNIIYKAQYDPLTYQIRSGYL 521

Query: 458 SKKSQILKNYNKGYFVLTSNYLHEFKSSNFFKLSQDNSEKKDHGEVQTGSKKRAMVPVTS 517
            ++S+ LK+Y+KGY+VLT ++LHEFK+S+                     +K+ +VPV S
Sbjct: 522 ERRSKFLKSYSKGYYVLTPSFLHEFKTSD---------------------RKKDLVPVMS 560

Query: 518 LSLNSAKLVEAS-----ESKFSIRG 537
           LSL    + E S     E+KF +  
Sbjct: 561 LSLTECTVQEHSKKNPQEAKFILHA 585

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 28/50 (56%)

Query: 92  PTDILLDRFTKWRKILKGLANYLREVAYAQERFARINYSLRGAVKFSFLT 141
           PTDIL  RF+ WR I++ +  YL E A  Q+   R    L  AV+F F +
Sbjct: 234 PTDILAARFSAWRNIIRSILAYLTETASIQDEIVRQQLRLSHAVQFPFFS 283

>KLLA0F03839g complement(363977..365923) similar to sp|P40485
           Saccharomyces cerevisiae YIL105c, start by similarity
          Length = 648

 Score =  154 bits (389), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 97/327 (29%), Positives = 153/327 (46%), Gaps = 44/327 (13%)

Query: 205 PMAPGDNDSASSGFMKFGSGSIEDIQVVLKKYHTSMGNQQIKMSKELNTVVVPXXXXXXX 264
           P  P D +     F+  G GSI+D+  +  +YHT M +   K SKEL+  V+P       
Sbjct: 214 PTTPEDKN-IQKFFLPLGHGSIQDLPTLFNQYHTQMVHAASKASKELSQDVIPRLEDMRR 272

Query: 265 XXXXXXXEIKELHGDFRTNIGEHIALTGQLLQKYMAAVKFMSTNSNDQNIFKLKNQKL-K 323
                  EI+ L  DF+ +  + +  T   L+ +  +               L+N K   
Sbjct: 273 DLLVKIKEIQSLESDFKNSCNKELQETKIRLKAFQES---------------LENSKYGS 317

Query: 324 PKHDPYXXXXXXXXXXXXXXXEENYLQEAYINLQSSGLELEKIIYGEVQHTLQRYSALIS 383
            K DP+               EEN+L EA+ NLQ+SG ELEK++  E+Q+ L  Y+ ++ 
Sbjct: 318 VKQDPFLAKILLEKQIKKQLTEENFLHEAFNNLQTSGRELEKVVMMEIQNALTSYAKVLG 377

Query: 384 TSARISIGNLCNELHQGMLSKPPAIEWDHFVGHHPKCLINWKSTEPIPQPRKLSHIRYPK 443
             A+I    L ++L  G  +K P  EW++FV   P  +      +P    R++  I Y  
Sbjct: 378 QEAQIVFDVLISKLDTGFFNKDPVFEWENFVAKDPNFI------DPNLPMRRVKDIVYKN 431

Query: 444 MKSSLAKCIKAGYLSKKSQILKNYNKGYFVLTSNYLHEFKSSNFFKLSQDNSEKKDHGEV 503
                   IK+G L ++S+ LK+Y++G++VLT ++LHEFKS                   
Sbjct: 432 QNDPFTYEIKSGILERRSKFLKSYSRGFYVLTPSFLHEFKS------------------- 472

Query: 504 QTGSKKRAMVPVTSLSLNSAKLVEASE 530
             G +K+ ++PV SLSLN   + E S+
Sbjct: 473 --GDRKKDLIPVISLSLNDCTVAEHSK 497

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 28/50 (56%)

Query: 92  PTDILLDRFTKWRKILKGLANYLREVAYAQERFARINYSLRGAVKFSFLT 141
           PT++L  RF  WR I++ L  YL+E    Q+   R +  L+ A+ F F T
Sbjct: 158 PTEVLSQRFAAWRGIIRSLLVYLQETVSIQDEVVRQHLRLQHAINFPFFT 207

>YNL047C (YNL047C) [4541] chr14 complement(539909..541879) Protein
           with similarity to Ask10p [1971 bp, 656 aa]
          Length = 656

 Score =  141 bits (356), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 86/285 (30%), Positives = 143/285 (50%), Gaps = 23/285 (8%)

Query: 209 GDNDSASSGFMKFGSGSIEDIQVVLKKYHTSMGNQQIKMSKELNTVVVPXXXXXXXXXXX 268
            ++ S    F+  GSGS++D+  +L KYH ++ +   K SKEL + ++P           
Sbjct: 223 NEDKSMQKFFLPLGSGSVQDLPTMLTKYHDNLASLASKSSKELTSEIIPRLEDLRRDLLV 282

Query: 269 XXXEIKELHGDFRTNIGEHIALTGQLLQKYMAAVKFMSTNSNDQNIFKLKNQKL-KPKHD 327
              EIK L  DF+ +  + +  T  L++ +  +               LK  KL  PK D
Sbjct: 283 KIKEIKALQSDFKNSCNKELQQTKHLMKLFNES---------------LKECKLGTPKSD 327

Query: 328 PYXXXXXXXXXXXXXXXEENYLQEAYINLQSSGLELEKIIYGEVQHTLQRYSALISTSAR 387
           P+               EENYL EA+ NLQ+SG +LE +I  E+Q+ L  Y+ ++   A+
Sbjct: 328 PFLIKLQLEKQIKRQLVEENYLHEAFDNLQNSGAQLESVIVMEIQNGLTSYARILGKEAQ 387

Query: 388 ISIGNLCNELHQGMLSKPPAIEWDHFVGHHPKCLINWKSTEPIPQP-RKLSHIRYPKMKS 446
           +   ++ ++L   +L+K   +EWD F+      L N  +  P   P R+   I Y     
Sbjct: 388 VVFDSVISKLDSTILNKNTNLEWDSFI------LRNISNFVPPNLPMRRFKEISYSNQND 441

Query: 447 SLAKCIKAGYLSKKSQILKNYNKGYFVLTSNYLHEFKSSNFFKLS 491
                +K+G+L K+S+ LK+Y++G++VLT ++LHEFK+ +  K S
Sbjct: 442 PFTFEVKSGFLEKRSKFLKSYSRGFYVLTPSFLHEFKTPDKHKFS 486

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 28/50 (56%)

Query: 92  PTDILLDRFTKWRKILKGLANYLREVAYAQERFARINYSLRGAVKFSFLT 141
           PTD+L  RF+ WR +++ +  YL E A  Q+   R    L  AV+F F +
Sbjct: 164 PTDVLSARFSAWRNVIRAILVYLSETASIQDEIVRQQLRLSHAVQFPFFS 213

>YGL173C (KEM1) [1817] chr7 complement(175531..180117) Nuclease with
            5'-3' exonuclease activity for single-stranded RNA and
            DNA, primary role is to degrade decapped mRNA, required
            for pseudohyphal and invasive growth [4587 bp, 1528 aa]
          Length = 1528

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 43/86 (50%), Gaps = 8/86 (9%)

Query: 704  RAKINTPAIDDNGNLITAGERHISLKSPSELSSPRQSPGQSLNSIGGGTPGSNH-QNVPS 762
            +A ++ P +   G++  A     S    S L+ P  +P   +N +GG  PG+N   +V  
Sbjct: 1342 KAPLDNPTV--AGSIFNAVANQYSDGIGSNLNIP--TPPHPMNVVGGPIPGANDVADVGL 1397

Query: 763  PVN-PQGFVITSNGMTPI--NRTPAP 785
            P N P GF+   NG+ P+  ++ P P
Sbjct: 1398 PYNIPPGFMTHPNGLHPLHPHQMPYP 1423

>Sklu_2436.5 YDR460W, Contig c2436 11903-12835
          Length = 310

 Score = 32.0 bits (71), Expect = 2.5,   Method: Composition-based stats.
 Identities = 26/96 (27%), Positives = 41/96 (42%), Gaps = 8/96 (8%)

Query: 606 WVFKPVSSKPEDAKDLKKWIAEVRHLSNFDTSADRAKFIE-EKILRAHSRASSMNLAKMA 664
           W  K + ++   + D ++ IA V+       S+ R K  +  K+LR        N   M 
Sbjct: 178 WAKKEIVNQLTSSTDAEEIIASVKKTVKLKKSSARRKLEDLNKVLRN-------NPYMMV 230

Query: 665 SDASAKKQDKVASNRTQGSRNKPHFIHLGPQEFQDP 700
           S+   KK+DKV      G R+      L   ++QDP
Sbjct: 231 SNGMMKKKDKVPFTPFNGDRDLHKRYKLVQSDYQDP 266

>ADL057W [1684] [Homologous to ScYER070W (RNR1) - SH; ScYIL066C
           (RNR3) - SH] complement(577138..579810) [2673 bp, 890
           aa]
          Length = 890

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 27/45 (60%), Gaps = 1/45 (2%)

Query: 615 PEDAKDLKKWIAEVRHLSNFDTSADRAKFIEE-KILRAHSRASSM 658
           P++ KDL K + E+   +  D +ADR  F+++ + L  H RA +M
Sbjct: 678 PQELKDLYKTVWELSQKTIIDMAADRGAFVDQSQSLNIHIRAPTM 722

>KLLA0C07887g complement(693437..696064) highly similar to sp|P21524
           Saccharomyces cerevisiae YER070w RNR1
           ribonucleoside-diphosphate reductase, large subunit,
           start by similarity
          Length = 875

 Score = 32.3 bits (72), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 27/45 (60%), Gaps = 1/45 (2%)

Query: 615 PEDAKDLKKWIAEVRHLSNFDTSADRAKFIEE-KILRAHSRASSM 658
           P++ KDL K + E+      D +ADRA +I++ + L  H RA +M
Sbjct: 678 PQELKDLYKTVWELSQKHIIDMAADRAAYIDQSQSLNIHIRAPTM 722

>Kwal_23.5887
          Length = 879

 Score = 31.6 bits (70), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 28/45 (62%), Gaps = 1/45 (2%)

Query: 615 PEDAKDLKKWIAEVRHLSNFDTSADRAKFIEE-KILRAHSRASSM 658
           P++ KDL K + E+   +  + +ADRA +I++ + L  H RA +M
Sbjct: 678 PQELKDLYKTVWELSQKTIIEMAADRACYIDQSQSLNVHIRAPTM 722

>AGL015W [4296] [Homologous to ScYPL011C (TAF47) - SH]
           complement(693465..694526) [1062 bp, 353 aa]
          Length = 353

 Score = 30.4 bits (67), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 40/86 (46%), Gaps = 6/86 (6%)

Query: 705 AKINTPAIDDNGNLITAGER-----HISLKSPSELSSPRQSPGQSLNSIGGGTPGSNHQN 759
           A IN   +DD    +   +R      +S K P EL S    PG   + +G G  G+N ++
Sbjct: 172 AMINNGDMDDWVRFMVTRQRVHALRKLSGKMPRELESLPTIPGLKNSVLGRGKGGANPEH 231

Query: 760 VPSPV-NPQGFVITSNGMTPINRTPA 784
            P+ V + Q   + S+    ++R PA
Sbjct: 232 FPADVIDEQNHELRSHAAELVSRLPA 257

>ACR155W [1202] [Homologous to ScYIL066C - NSH]
           complement(623554..626148) [2595 bp, 864 aa]
          Length = 864

 Score = 30.8 bits (68), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 35/136 (25%), Positives = 50/136 (36%), Gaps = 15/136 (11%)

Query: 611 VSSKPEDAKDLKKWIAEVRHLSNFDTSADRAKFIEE-KILRAHSRASSMNLAKMASDASA 669
           +   P D KDL K + E+      D SADRA F+++ + L    +  +M         + 
Sbjct: 698 IDGIPPDLKDLYKTVWELPQRKLIDLSADRAPFVDQSQSLNLFLKEPTMGKLTSMHFYAW 757

Query: 670 KKQDKVASN--RTQGSRNKPHFIHLGPQEFQDPTSARAKINTPAIDDNGNLITAGERHIS 727
           KK  K      RTQ + N   F          P   R           G  +    RH  
Sbjct: 758 KKGLKTGMYYLRTQAAANAIQFTLTDENTLSGPVKLR----------EGAAVAQSPRHA- 806

Query: 728 LKSPSELSSPRQSPGQ 743
            + PSE +  R SP +
Sbjct: 807 -RYPSEEAGSRVSPAR 821

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.310    0.126    0.354 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 29,942,834
Number of extensions: 1238328
Number of successful extensions: 3928
Number of sequences better than 10.0: 60
Number of HSP's gapped: 4012
Number of HSP's successfully gapped: 80
Length of query: 1000
Length of database: 16,596,109
Length adjustment: 111
Effective length of query: 889
Effective length of database: 12,753,511
Effective search space: 11337871279
Effective search space used: 11337871279
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 67 (30.4 bits)