Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_55.205351636161381050.0
AAR089C1618164326460.0
Scas_716.271620164822440.0
YGR098C (ESP1)1630164722390.0
KLLA0D15136g1591158420490.0
CAGL0G03223g1604158312421e-143
Scas_682.6149884770.99
Kwal_26.761347374723.2
KLLA0B12562g126066724.4
Kwal_56.2393053337705.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_55.20535
         (1613 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_55.20535                                                        3126   0.0  
AAR089C [275] [Homologous to ScYGR098C (ESP1) - SH] (500951..505...  1023   0.0  
Scas_716.27                                                           868   0.0  
YGR098C (ESP1) [2058] chr7 complement(682568..687460) Separin pr...   867   0.0  
KLLA0D15136g complement(1276819..1281594) similar to sp|Q03018 S...   793   0.0  
CAGL0G03223g complement(300119..304933) similar to sp|Q03018 Sac...   483   e-143
Scas_682.6                                                             34   0.99 
Kwal_26.7613                                                           32   3.2  
KLLA0B12562g complement(1095953..1099735) similar to sp|Q04439 S...    32   4.4  
Kwal_56.23930                                                          32   5.9  

>Kwal_55.20535
          Length = 1636

 Score = 3126 bits (8105), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1528/1613 (94%), Positives = 1528/1613 (94%)

Query: 1    MAGKNIALNDISLNSPCKIVSSLEGDTSDCVKLKNAEILNTRMDGENMVYDSFWGFECSR 60
            MAGKNIALNDISLNSPCKIVSSLEGDTSDCVKLKNAEILNTRMDGENMVYDSFWGFECSR
Sbjct: 1    MAGKNIALNDISLNSPCKIVSSLEGDTSDCVKLKNAEILNTRMDGENMVYDSFWGFECSR 60

Query: 61   IAPNSDIIRKRVRDFLQRPCIEDVQEVSLGFKRLYRTYLWKHQFNLVKELVKQNMLAIIK 120
            IAPNSDIIRKRVRDFLQRPCIEDVQEVSLGFKRLYRTYLWKHQFNLVKELVKQNMLAIIK
Sbjct: 61   IAPNSDIIRKRVRDFLQRPCIEDVQEVSLGFKRLYRTYLWKHQFNLVKELVKQNMLAIIK 120

Query: 121  IVELQSYDAAVQEVLNIYNETNHHKAESLEQFLLADLTTSNDYYXXXXXXXXXXXXXXXX 180
            IVELQSYDAAVQEVLNIYNETNHHKAESLEQFLLADLTTSNDYY                
Sbjct: 121  IVELQSYDAAVQEVLNIYNETNHHKAESLEQFLLADLTTSNDYYLSALKLLALQIIIKGK 180

Query: 181  RQDFYGETILKLFANDSRYILRTEKIKIQPLTKILLNFFSLLPDFKALFSLKFMQYVKQF 240
            RQDFYGETILKLFANDSRYILRTEKIKIQPLTKILLNFFSLLPDFKALFSLKFMQYVKQF
Sbjct: 181  RQDFYGETILKLFANDSRYILRTEKIKIQPLTKILLNFFSLLPDFKALFSLKFMQYVKQF 240

Query: 241  DLNFESYIKNMDMPKFQEMILIWAQRSPTKTNGFLGLXXXXXXXXXXXVDKIMLHDLVNP 300
            DLNFESYIKNMDMPKFQEMILIWAQRSPTKTNGFLGL           VDKIMLHDLVNP
Sbjct: 241  DLNFESYIKNMDMPKFQEMILIWAQRSPTKTNGFLGLFYSSYSQYFQSVDKIMLHDLVNP 300

Query: 301  SSRDRIKVISKGFNSLSSHEWSQGIETFTNLSIIERNSLLEFIESQLEEKKFDSQKVAIL 360
            SSRDRIKVISKGFNSLSSHEWSQGIETFTNLSIIERNSLLEFIESQLEEKKFDSQKVAIL
Sbjct: 301  SSRDRIKVISKGFNSLSSHEWSQGIETFTNLSIIERNSLLEFIESQLEEKKFDSQKVAIL 360

Query: 361  LRWFLQLANNELSPATRQLWRIVDRITVFINSNLHSLSIHIVKELLDIIYDLCIVNLEPK 420
            LRWFLQLANNELSPATRQLWRIVDRITVFINSNLHSLSIHIVKELLDIIYDLCIVNLEPK
Sbjct: 361  LRWFLQLANNELSPATRQLWRIVDRITVFINSNLHSLSIHIVKELLDIIYDLCIVNLEPK 420

Query: 421  RLLNVANVAFNSFIVFKNDIFVLQAAKFDLARQTIFKQGGLDLTRLEKFLSSASNGHRIK 480
            RLLNVANVAFNSFIVFKNDIFVLQAAKFDLARQTIFKQGGLDLTRLEKFLSSASNGHRIK
Sbjct: 421  RLLNVANVAFNSFIVFKNDIFVLQAAKFDLARQTIFKQGGLDLTRLEKFLSSASNGHRIK 480

Query: 481  LFTDVFNVFTCFEYESLGSLTEVTSRFAKCLRSVNIRASTELSGASELMICLLSTLRPLE 540
            LFTDVFNVFTCFEYESLGSLTEVTSRFAKCLRSVNIRASTELSGASELMICLLSTLRPLE
Sbjct: 481  LFTDVFNVFTCFEYESLGSLTEVTSRFAKCLRSVNIRASTELSGASELMICLLSTLRPLE 540

Query: 541  PDSISCWSPLTRMLYHSLTNYAKDNNKTEKCRDTLDPLKHYEVLIKTIYSLGLEIKKSSS 600
            PDSISCWSPLTRMLYHSLTNYAKDNNKTEKCRDTLDPLKHYEVLIKTIYSLGLEIKKSSS
Sbjct: 541  PDSISCWSPLTRMLYHSLTNYAKDNNKTEKCRDTLDPLKHYEVLIKTIYSLGLEIKKSSS 600

Query: 601  HCLAKVSDNFTENWVKRLNFRESTMISLEYSAIRTLFGYLRFNKFHKKVIDLALALKNSP 660
            HCLAKVSDNFTENWVKRLNFRESTMISLEYSAIRTLFGYLRFNKFHKKVIDLALALKNSP
Sbjct: 601  HCLAKVSDNFTENWVKRLNFRESTMISLEYSAIRTLFGYLRFNKFHKKVIDLALALKNSP 660

Query: 661  HPYYEYCAENAQEQLIRGYVGLQMKTRILEGCSELMRLAQNPRLENLKRDQIFMYAETQL 720
            HPYYEYCAENAQEQLIRGYVGLQMKTRILEGCSELMRLAQNPRLENLKRDQIFMYAETQL
Sbjct: 661  HPYYEYCAENAQEQLIRGYVGLQMKTRILEGCSELMRLAQNPRLENLKRDQIFMYAETQL 720

Query: 721  EICFWKRDFDTFNKIFVEGLPITNPEVMDVTNTLKLPTKLYLKCLVLSINIVGIASNLQI 780
            EICFWKRDFDTFNKIFVEGLPITNPEVMDVTNTLKLPTKLYLKCLVLSINIVGIASNLQI
Sbjct: 721  EICFWKRDFDTFNKIFVEGLPITNPEVMDVTNTLKLPTKLYLKCLVLSINIVGIASNLQI 780

Query: 781  HAGNLIEALVEAKRSIKLCQTLLKKVTQLDQEIKWKVLTSLGTAFANIINIYTQLGVSRD 840
            HAGNLIEALVEAKRSIKLCQTLLKKVTQLDQEIKWKVLTSLGTAFANIINIYTQLGVSRD
Sbjct: 781  HAGNLIEALVEAKRSIKLCQTLLKKVTQLDQEIKWKVLTSLGTAFANIINIYTQLGVSRD 840

Query: 841  CDFYVTEYLRVSCSMKDPVVIHECLQKCVGYYRLTDQLSLADALLRKANGIFNQLDGSEX 900
            CDFYVTEYLRVSCSMKDPVVIHECLQKCVGYYRLTDQLSLADALLRKANGIFNQLDGSE 
Sbjct: 841  CDFYVTEYLRVSCSMKDPVVIHECLQKCVGYYRLTDQLSLADALLRKANGIFNQLDGSEN 900

Query: 901  XXXXXXXXXXXGEHEKLANSLRLFFKDYFSESLLVDIWSLALGGTLNRYHEDATLRRLSG 960
                       GEHEKLANSLRLFFKDYFSESLLVDIWSLALGGTLNRYHEDATLRRLSG
Sbjct: 901  FDDLALFLLNNGEHEKLANSLRLFFKDYFSESLLVDIWSLALGGTLNRYHEDATLRRLSG 960

Query: 961  INEGKQLYEKISKQMDTDAFFGSVKESVTTIPSCVLPALEVRKHPATSVCEFGTPTKNKG 1020
            INEGKQLYEKISKQMDTDAFFGSVKESVTTIPSCVLPALEVRKHPATSVCEFGTPTKNKG
Sbjct: 961  INEGKQLYEKISKQMDTDAFFGSVKESVTTIPSCVLPALEVRKHPATSVCEFGTPTKNKG 1020

Query: 1021 IPFTNLNSPRPSSLTPRGKSLKQKFDRAKALNDLETVKRLVGSLSTDGMKNYEIVEAXXX 1080
            IPFTNLNSPRPSSLTPRGKSLKQKFDRAKALNDLETVKRLVGSLSTDGMKNYEIVEA   
Sbjct: 1021 IPFTNLNSPRPSSLTPRGKSLKQKFDRAKALNDLETVKRLVGSLSTDGMKNYEIVEASDL 1080

Query: 1081 XXXXXXXXXXXXXXXXXXXAIEQMLTLAELPKMRPLHFDKILSSQGNEIYGSFIPLQVDC 1140
                               AIEQMLTLAELPKMRPLHFDKILSSQGNEIYGSFIPLQVDC
Sbjct: 1081 YSLVLSLLSSITTSRLSSSAIEQMLTLAELPKMRPLHFDKILSSQGNEIYGSFIPLQVDC 1140

Query: 1141 KRISIDNQLQDIVRNQTDMSFNSDPHLFNVVCIDVCGITGDLILTRTDSGRNKVMCLRLP 1200
            KRISIDNQLQDIVRNQTDMSFNSDPHLFNVVCIDVCGITGDLILTRTDSGRNKVMCLRLP
Sbjct: 1141 KRISIDNQLQDIVRNQTDMSFNSDPHLFNVVCIDVCGITGDLILTRTDSGRNKVMCLRLP 1200

Query: 1201 LSRGSSRDVDEVALSFHDAMEELKSIIKESNITTSSDVTAAINTKDDRKQWWQRRYDLDA 1260
            LSRGSSRDVDEVALSFHDAMEELKSIIKESNITTSSDVTAAINTKDDRKQWWQRRYDLDA
Sbjct: 1201 LSRGSSRDVDEVALSFHDAMEELKSIIKESNITTSSDVTAAINTKDDRKQWWQRRYDLDA 1260

Query: 1261 RLRNLILKIENSWFSGFKTFFKQETIEQRHLDRFRVKLEEILQESLPTRKQFGNPANFFR 1320
            RLRNLILKIENSWFSGFKTFFKQETIEQRHLDRFRVKLEEILQESLPTRKQFGNPANFFR
Sbjct: 1261 RLRNLILKIENSWFSGFKTFFKQETIEQRHLDRFRVKLEEILQESLPTRKQFGNPANFFR 1320

Query: 1321 IXXXXXXXXXXXXPSDSDFMEMMEXXXXXXXXXXXXHGEENAYDEIDVNMIHIQIEEFIK 1380
            I            PSDSDFMEMME            HGEENAYDEIDVNMIHIQIEEFIK
Sbjct: 1321 IDDVVLDLFLKLDPSDSDFMEMMEDLIFFVFDLLLFHGEENAYDEIDVNMIHIQIEEFIK 1380

Query: 1381 EFRTTVPPPPKLAHTFLVVCSAGHLMPWESLEFLAKNSISRIPSTQILFDLIEKEQHLIS 1440
            EFRTTVPPPPKLAHTFLVVCSAGHLMPWESLEFLAKNSISRIPSTQILFDLIEKEQHLIS
Sbjct: 1381 EFRTTVPPPPKLAHTFLVVCSAGHLMPWESLEFLAKNSISRIPSTQILFDLIEKEQHLIS 1440

Query: 1441 PLVELEQNISVILNPDGDLVRTQADFICPFEEWCSHAPGSRLIVGEKPDEKTFLEMLTKA 1500
            PLVELEQNISVILNPDGDLVRTQADFICPFEEWCSHAPGSRLIVGEKPDEKTFLEMLTKA
Sbjct: 1441 PLVELEQNISVILNPDGDLVRTQADFICPFEEWCSHAPGSRLIVGEKPDEKTFLEMLTKA 1500

Query: 1501 KTFIYVGHGGGEQFVRLKKIKQQNCIAPSFLLGCSSAYMQNFGKLEPSGIAYSYLLGGSS 1560
            KTFIYVGHGGGEQFVRLKKIKQQNCIAPSFLLGCSSAYMQNFGKLEPSGIAYSYLLGGSS
Sbjct: 1501 KTFIYVGHGGGEQFVRLKKIKQQNCIAPSFLLGCSSAYMQNFGKLEPSGIAYSYLLGGSS 1560

Query: 1561 MVVGNLWDVTDKDIDKFSRTMFEKLGLVREEEETYTVSDAVASARYSCQLKYL 1613
            MVVGNLWDVTDKDIDKFSRTMFEKLGLVREEEETYTVSDAVASARYSCQLKYL
Sbjct: 1561 MVVGNLWDVTDKDIDKFSRTMFEKLGLVREEEETYTVSDAVASARYSCQLKYL 1613

>AAR089C [275] [Homologous to ScYGR098C (ESP1) - SH] (500951..505807)
            [4857 bp, 1618 aa]
          Length = 1618

 Score = 1023 bits (2646), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 599/1643 (36%), Positives = 916/1643 (55%), Gaps = 81/1643 (4%)

Query: 1    MAGKNIALNDISLNSPCKIVSSLEGDTSDCVKLKN--AEILNTRMDGENMV----YDSFW 54
            MA +   LN I+LN+P  + +S  G      K +    E  N+  +  + V    +D   
Sbjct: 1    MAREKEVLNVINLNTPI-MRNSWTGAAGGTTKHEKPLVEAFNSSTNRLHFVDRLPFDVTE 59

Query: 55   GFECSRIAPNSDIIRKRVRDFLQRPCIEDVQEVSLGFKRLYRTYLWKHQFNLVKELVKQN 114
            GF             + V+ F+Q    E   +V      LYR    +HQ   V E+ +Q+
Sbjct: 60   GF-------------REVQRFVQEGKGE-ADKVREALTGLYRELKQRHQLGRVAEVSRQH 105

Query: 115  MLAIIKIVELQSYDAAVQEVLNIYNETNHHKAESLEQFLLADLTTSNDYYXXXXXXXXXX 174
            M  +++++E     AA +EV+ +YN+TN+  A  L   L+AD   SN+ Y          
Sbjct: 106  MGVVVRLLEAGQDAAAAREVVALYNQTNYRPAGGLGDVLMADFGVSNERYLSTAKILAMQ 165

Query: 175  XXXXXXRQDFYGETILKLFANDSRYILRTEKIKIQPLTKILLNFFSLLPDFKALFSLKFM 234
                  + + + ET++++FA D RYILR  K+K+  + K++LNFFSLLP +K LF+LKF+
Sbjct: 166  LIIRMRQVESHAETVVRIFAADERYILRDPKLKVHTVVKLILNFFSLLPQYKVLFALKFL 225

Query: 235  QYVKQFDLNFESYIKNMDMPKFQEMILIWAQRSPTKTNGFLGLXXXXXXXXXXXVDKIML 294
            QYV QF L+F +YIKNMD+ KFQ+ +L +A      +  FL +           + K+M 
Sbjct: 226  QYVSQFRLDFSTYIKNMDLAKFQKQVLKFAGAGLESSLPFLDIYYRSYSQHMTSIGKLMW 285

Query: 295  HDL---------VNPSSRDRIKVISKGFNSLSSHE---WSQGIETFTNLSIIERNSLLEF 342
             D          +NP     ++ I  G  +L + E   +++ I T  +  +   ++ L  
Sbjct: 286  QDFRVPDRGDTKLNPEDPIILQQILHGRRTLDNAEFDAYTKHITTKLSKGVSPTDAFLGA 345

Query: 343  IESQL---EEKKFDSQKVAILLRWFLQLANNELSPATRQLWRIVDRITVFINSNLHSLSI 399
            ++  +     K+   QK  ++L                     +D+I +FIN+N+  +S+
Sbjct: 346  LKVYILNCSLKRLRLQKAHVIL---------------------LDKIAIFINTNVVHVSV 384

Query: 400  HIVKELLDIIYDLCIVNLEPKRLLNVANVAFNSFIVFKNDIFVLQAAKFDLARQTIFKQG 459
              +  +L  + +  I   E KRL NV N++FN+++++K++  +  AA  +L      KQ 
Sbjct: 385  ESIHTILKSLAEYFIDAKEYKRLNNVVNISFNAYVMYKHESLIRLAADLELFLFMSVKQD 444

Query: 460  GLDLTRLEKFLSSASNGHRIKLFTDVFNVFTCFEYESLGSLTEVT-SRFAKCLRSVNIRA 518
                T+ EKF+S AS    + LF   FNV+  F   SL  L +V  ++  KC + + + +
Sbjct: 445  WSMFTKFEKFISVASGDISVSLFEQCFNVYVMFADPSLAGLWDVCLNKSLKCFKKLGLTS 504

Query: 519  STELSGASELMICLLST--LRPLEPDSISCWSPLTRMLYHSLTNYAKDNNKTEKCR-DTL 575
             T+   +SE M+ L+ +  +  +     + W+PL++ML+ +L    K       C+  ++
Sbjct: 505  YTDFKASSEPMLVLVYSGFVSDIFTIPYNGWAPLSKMLFMALNGVYKFGYMDVDCKIKSV 564

Query: 576  DPLKHYEVLIKTIYSLGLEIKKSSSHCLAKVSDNFTENWVKRLNFRESTMISLEYSAIRT 635
            D L  YE+LIK+ YSL +E++   +  L+K+++ +   WV  L   E  +  LE   ++ 
Sbjct: 565  DVLAKYEMLIKSTYSLNMEMETHGTLQLSKIANMYVSRWVSSLPTDER-ISGLEVRFVKA 623

Query: 636  LFGYLRFNKFHKKVIDLALALKNSPHPYYEYCAENAQEQLIRGYVGLQMKTRILEGCSEL 695
            L  YLRFNKFHKK+I+L   LK S   YYE    + +  L+  Y  L+M          +
Sbjct: 624  LVQYLRFNKFHKKLIELCQLLK-SKGEYYESFKNDIRVWLLEAYTALKMVQATKLQIQSV 682

Query: 696  MRLAQNPRLENLKRDQIFMYAETQLEICFWKRDFDTFNKIFVEGLPITNPEVMDVTNTLK 755
            +++  +  +E    D ++ Y   +L I  W+RD D+FN + V+ L ++     D+ N   
Sbjct: 683  LKIHSSFSIERATFDSLYEYLYARLLIISWERDNDSFNHL-VQELRVSQTNFFDINNNSN 741

Query: 756  LPTKLYLKCLVLSINIVGIASNLQIHAGNLIEALVEAKRSIKLCQTLLKKVTQLDQEIKW 815
            LP   +LK L+L+I I  +AS LQ H  N+ E+L+EAK+++KLCQ+L+KK  +L Q  + 
Sbjct: 742  LPVSQFLKLLLLNIRIEKLASLLQFHNNNMFESLLEAKKALKLCQSLIKKQQKLSQFHRL 801

Query: 816  KVLTSLGTAFANIINIYTQLGVSRDCDFYVTEYLRVSCSMKDPVVIHECLQKCVGYYRLT 875
            +V++ L   FA +I IY Q+GVS+DC+FYV +++RV   ++D   I++CL     YY+LT
Sbjct: 802  EVISLLQDLFAQVIGIYIQVGVSKDCEFYVKDFMRVVGELQDWTPIYDCLCFVYDYYKLT 861

Query: 876  DQLSLADALLRKANGIFNQLDGSEXXXXXXXXXXXXGEHEKLANSLRLFFKDYFSESLLV 935
            +Q  LA A L + N  F+ LDGSE             E +KL NSL LFF     ++ LV
Sbjct: 862  EQNQLASATLSRLNRTFDMLDGSENIDALAKFMYYNDEPDKLRNSLALFFSGDLEDTFLV 921

Query: 936  DIWSLALGGTLNRYHEDATLRRLSGINEGKQLYEKISKQMDTDAFFGSVKESVTTIPSCV 995
            D W+L LG  +    E   L+ LS +N+  +LY +I KQM+ D FF ++ ESV  IPSC 
Sbjct: 922  DEWNLRLGIVIENTREQPQLKALSDVNKSNELYLRILKQMELDPFFSNMCESVIAIPSCF 981

Query: 996  LPALEVRKHPATSVCEFGTPTKNKGIPFTNLNSPRPSSLTPRGKSLKQKFDRAKALNDLE 1055
             P +E    PA S     +P    G P+   +SPRPSSLTPRGK L+QKFDR+ A+N+L+
Sbjct: 982  SPKVE-EIRPAVS--NVWSPA---GSPY---HSPRPSSLTPRGKCLRQKFDRSNAINNLQ 1032

Query: 1056 TVKRLVGSLSTDGMKNYEIVEAXXXXXXXXXXXXXXXXXXXXXXAIEQMLTLAELPKMRP 1115
             +KRL+ S++ D M+N+E+ +                       A+ +  T+AELPK  P
Sbjct: 1033 MIKRLIESVNLDEMQNHEVSKTSCLYSLSLSFLSNISSKTDFRHALIKRFTMAELPKYMP 1092

Query: 1116 LHFDKILSSQGNEIYGSFIPLQVDCKRISIDNQLQDIVRNQTDMSFNSDPHLFNVVCIDV 1175
            +++DK+ S  GNE+YGSF+P++V           Q +   QT+  FNS    F  + +D+
Sbjct: 1093 MYYDKMFSRMGNEVYGSFMPMEVKSMCTPFFTVQQKVDGIQTN--FNSWDEPFQAISVDI 1150

Query: 1176 CGITGDLILTRTDSGRNKVMCLRLPLSRGSSRDVDEVALSFHDAMEELKSIIKESNITTS 1235
            C   GDL+L++  S   K   LRLPL+R  SRD+ +  L+F   MEEL  II+++N TTS
Sbjct: 1151 CKYNGDLLLSKVVSTTGKHFHLRLPLNRHESRDLSQETLTFALLMEELNDIIEKNNRTTS 1210

Query: 1236 SDVTAAINTKDDRKQWWQRRYDLDARLRNLILKIENSWFSGFKTFFKQETIEQRHLDRFR 1295
             +VT+ I TK+DR++WW+ RY LD R+ +L+ +IE+SW  GF  FF Q+ +++ H   F+
Sbjct: 1211 IEVTSVIKTKEDRREWWEERYSLDKRMCDLMRRIEDSWICGFCGFFSQKQLDKNHFALFK 1270

Query: 1296 VKLEEILQESLPTRKQFGNPANFFR----IXXXXXXXXXXXXPSDSDFMEMMEXXXXXXX 1351
            +  +++LQ++LPTR+Q+GNP+ F +    I            P +   +E ME       
Sbjct: 1271 LGFQKVLQQNLPTRRQYGNPSMFLQVDDFILELFLKVDWDALPHEKK-VEFMEDLIYFIF 1329

Query: 1352 XXXXXHGEENAYDEIDVNMIHIQIEEFIKEFRTTVPPPPKLAHTFLVVCSAGHLMPWESL 1411
                 HGEENAYDEIDV++IHIQ+EE I ++    P  P+L HTFLV+ S   L+PWESL
Sbjct: 1330 DILLFHGEENAYDEIDVHLIHIQLEELIHDYHAKAPEAPRLGHTFLVISSECSLVPWESL 1389

Query: 1412 EFLAKNSISRIPSTQILFDLIEKEQHLISPLVELEQNISVILNPDGDLVRTQADFICPFE 1471
               +  S+SR+PS   L +L+ K +  ISP + L+  +S++LNP GDL RT+  F   F 
Sbjct: 1390 SIFSDASVSRVPSINFLHELLTKFRGEISPKINLDSRLSIVLNPHGDLTRTELRFKEHFT 1449

Query: 1472 EWCSHAPGSRLIVGEKPDEKTFLEMLTKAKTFIYVGHGGGEQFVRLKKIKQQNCIAPSFL 1531
              C     +R++ G KP+E  F+ M+T + TFIY+GHGGGEQ+ R K +K Q+  APSFL
Sbjct: 1450 RLCCDLGSTRIVTGSKPEEDEFVRMITNSSTFIYIGHGGGEQYFRSKTLKLQDNAAPSFL 1509

Query: 1532 LGCSSAYMQNFGKLEPSGIAYSYLLGGSSMVVGNLWDVTDKDIDKFSRTMFEKLGLVREE 1591
            LGCSSAYM  +GKLEPS + YSYLLGGS MV+GNLWDVTDKDID F+  M  KLG+   +
Sbjct: 1510 LGCSSAYMIQYGKLEPSSVLYSYLLGGSPMVIGNLWDVTDKDIDAFTEAMSHKLGIFPSQ 1569

Query: 1592 EETY-TVSDAVASARYSCQLKYL 1613
             + +  VS+AV+S+R  C L+YL
Sbjct: 1570 RDRFLNVSEAVSSSRDVCHLRYL 1592

>Scas_716.27
          Length = 1620

 Score =  868 bits (2244), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 548/1648 (33%), Positives = 884/1648 (53%), Gaps = 79/1648 (4%)

Query: 1    MAGKNIALNDISLNSPCKIVSSLEGDTSDCVKLKNAEILNTRMDGENMVYDSFWGFECSR 60
            M+ +   LN++SLN+      S  G  ++   LKN    N   + EN+           R
Sbjct: 1    MSKQEDPLNEVSLNTTTWHSPSKRGQNNE---LKN---FNAYPNKENIP-----QLHTGR 49

Query: 61   IAPNSDIIRKRVRDF-----LQRPCIEDVQEVSLGFKRLYRTYLWKHQFNLVKELVKQNM 115
            +  + D+  K++ +F     LQ+P IE +  V   F  LYR    +H    ++ LVK+++
Sbjct: 50   LEKDLDLYYKQISEFIKAQSLQKPQIERIHAV---FTTLYRELNRRHLLRHLRALVKEHL 106

Query: 116  LAIIKIVELQSYDAAVQEVLNIYNETNHHKAESLEQFLLADLTTSNDYYXXXXXXXXXXX 175
            + ++K++    YD +   +L +YN TN  KA  L+  +LAD + SN++Y           
Sbjct: 107  IVVVKLINNNFYDYSQSGILCLYNTTNLFKAHDLKDVILADFSESNEFYLSTLKILSFQV 166

Query: 176  XXXXXRQDFYGETILKLFANDSRYILRTEKIKIQPLTKILLNFFSLLPDFKALFSLKFMQ 235
                     Y +TI++ F++D RYIL+   IKI  + K+LLNFFS+LP FK LF LKF+Q
Sbjct: 167  ILKKKNLKMYEDTIIQAFSHDERYILKDPNIKIHTVVKLLLNFFSILPTFKTLFGLKFLQ 226

Query: 236  YVKQFDLNFESYIKNMDMPKFQEMILIWAQRSPTKTNGFLGLXXXXXXXXXXXVDKIMLH 295
            Y+KQF+L+F++YIKNMD   F++ ++ +  ++  +   +L             + K+ML 
Sbjct: 227  YIKQFNLSFQTYIKNMDSITFEKQLVRYGSKNIQQLKPYLNSYYINYSKFNSHLTKLMLT 286

Query: 296  DLVNPSSRDRIKVISKGFNSLSSHE--WSQGIETFTNLS-------IIERNSLLEFIESQ 346
            D V    RD ++   K F  L  H+   S   E +  LS       +I  ++L+     Q
Sbjct: 287  DFV---GRD-LQSHKKTFALLKDHKEISSTSTECYCCLSHSQMDNFVISCHALMS-NNDQ 341

Query: 347  LEEKKFDSQKVAILLRWFLQLANNELSPATRQLWRIVDRITVFINS---NLHSLSIHIVK 403
            +     D    A+   W   +  +E  P  +++  ++D   +F+NS   +L  + I +VK
Sbjct: 342  IHLHTID----AVTFGW--SIIRSENFPRNKKMLALLDSTLIFLNSQMKHLEKMQISLVK 395

Query: 404  ELLDIIYDLCIVNLEPKRLLNVANVAFNSFIVFKNDIFVLQAAKFDLARQTIF---KQGG 460
             L+ ++ ++C+   E KR+ NV NV+FN F+ F+N  F+   A+ +     +     Q  
Sbjct: 396  -LIKMLAEVCMDYQEYKRMTNVINVSFNCFVFFRNFDFLKLTAELESKHYLVCHDKSQWK 454

Query: 461  LDLTRLEKFLSSASNGH-RIKLFTDVFNVFTCFEYESLGSLTEVTSR-FAKCLRSVNIRA 518
              + + EKF+ SA   + +I+LF+ VFN F  F  +SL  + E T   F +C   + +  
Sbjct: 455  KLIQKFEKFIGSAPEQYQKIELFSYVFNTFLLFNDDSLSFVVEFTETIFLRCFSRLKLTY 514

Query: 519  STELSGASELMICLLSTLRPLEPDSISCWSPLTRMLYHSLT-----NYAKDNNKTEKCRD 573
              +    SE M+ +L     +       W+ LT ML+  ++     N    N  T K   
Sbjct: 515  FIDFHDVSEPMLSILYGNSSITNIPHGDWNNLTEMLFFCVSGRFEINAININQVTTKWY- 573

Query: 574  TLDPLKHYEVLIKTIYSLGLEIKKSSSHCLAKVSDNFTENWVKRLNFRESTMISLEYSAI 633
                L  Y+ LIK+IY L L++KK SS  L++++ ++   WV++ +     + S+E + I
Sbjct: 574  ---YLYKYKDLIKSIYVLNLDMKKHSSSNLSQLTSSYISKWVQKTSLLNEGISSIEVTFI 630

Query: 634  RTLFGYLRFNKFHKKVIDLALALKNSPHPYYEYCAENAQEQLIRGYVGLQMKTRILEGCS 693
              LF YL FN F+K ++ L+ AL++  + Y+           I+  + LQ+  +I +   
Sbjct: 631  TMLFQYLGFNNFNKCILTLSAALRDHIN-YFAPLKLEISRWNIQSSINLQLMEQINDEAK 689

Query: 694  ELMRLAQNPRLENLKRDQIFMYAETQLEICFWKRDFDTFNKIFVEGLPITNPEVMDVTNT 753
             L  +A  P     K +++  + E +L++  W  D++ F ++F+E LP    EV D+ N 
Sbjct: 690  LLSTIA--PTYTICKLEKLLTFLEAKLDVFTWTNDYEGFQELFMEELPSVRLEVFDLNNQ 747

Query: 754  LKLPTKLYLKCLVLSINIVGIASNLQIHAGNLIEALVEAKRSIKLCQTLLKKVTQLDQEI 813
             K+P   Y+K L+    +   +S L +   ++  +++E+KR++KL  +L+KK  +L Q  
Sbjct: 748  SKMPASQYIKVLLFMTKLFNHSSRLHLARDDITASVIESKRALKLATSLIKKQNKLSQSS 807

Query: 814  KWKVLTSLGTAFANIINIYTQLGVSRDCDFYVTEYLRVSCSMKDPVVIHECLQKCVGYYR 873
            + +++  +  +F  +I IY +LG++++ D+Y  +  +V C + +P V++  L     YY+
Sbjct: 808  RIRLINLVLNSFTQLIEIYIRLGLAKEADYYADQLSKVICDLGEPSVVYRGLHFLHNYYK 867

Query: 874  LTDQLSLADALLRKANGIFNQLDGSEXXXXXXXXXXXXGEHEKLANSLRLFFKDYFSESL 933
            L    +L    L+KAN  F+ LDG               E +K++ SL LFF+D F+ S 
Sbjct: 868  LVKHEALEIITLQKANKTFDYLDGESDIESVLMFLFDNSEFKKISESLNLFFQDDFNNSF 927

Query: 934  LVDIWSLALGGTLNRYHEDATLRRLSGINEGKQLYEKISKQMDTDAFFGSVKESVTTIPS 993
            L   W L +G  ++      TL+  + I + ++ Y+ +  Q+++D FF ++ ES+  +P+
Sbjct: 928  LPLYWQLKMGRPIDDSLCLTTLKSTNSIKKLERDYKHVLGQLESDPFFKNLFESILAVPA 987

Query: 994  CVLPALEVRKHPATSVCEFGTPTKNKGIPFTNLNSPRPSSLTPRGKSLKQKFDRAKALND 1053
                 +   +   T +C   TPTK K + F   +SPRPS++TP+ K+LKQKFD+A AL++
Sbjct: 988  VT--NIHNTQSDGT-MCLMETPTKKK-LAFKVNDSPRPSNMTPKSKNLKQKFDKAVALSN 1043

Query: 1054 LETVKRLVGSLSTDGMKNYEIVEAXXXXXXXXXXXXXXXXXXXXXXAIEQMLTLAELPKM 1113
            L  +K  +  L+ + + + +++                         + Q   L +LPK 
Sbjct: 1044 LNRIKCCIEDLNLELLNHGDLLNISSLFSLTVTMLSNISKNALEDATLFQRFNLIDLPKR 1103

Query: 1114 RPLHFDKILSSQGNEIYGSFIPLQVDCKRISIDNQLQDIVRNQTDMSFNSDPHL----FN 1169
             P+++DK+LSS  +++Y        D K +   +  +   + Q  +S N         F+
Sbjct: 1104 VPMYYDKLLSSIDDDLY-------TDIKLLPFSSNHEQTRKKQALLSLNESTEFCGLSFD 1156

Query: 1170 VVCIDVCGITGDLILTRTDSGRNKVMCLRLPLSRGSSRDVDEVALSFHDAMEELKSIIKE 1229
            V+ ID+C ITG+L+L++  +       L +PL+R + RD+D  +L+F +A++EL  II E
Sbjct: 1157 VITIDICSITGNLLLSKLSATNGHKSHLSIPLNRANLRDLDAYSLTFVEAVKELAYIIDE 1216

Query: 1230 SNITTSSDVTAAINTKDDRKQWWQRRYDLDARLRNLILKIENSWFSGFKTFFKQETIEQR 1289
            SN TTS +VT++I TK+DRK WW+ RY+LD RL +L+  IE SWF+G K  F Q  ++  
Sbjct: 1217 SNSTTSVEVTSSIKTKEDRKTWWKSRYELDNRLSSLLHNIETSWFAGLKGLFDQSVVDPS 1276

Query: 1290 HLDRFRVKLEEILQESLPTRKQFGNPANFFRIXXXXXXXXXXXXPSDSDFMEMMEXXXXX 1349
              + F+ K   IL  +LP+RKQ G P  F +I            P D +F+ M+E     
Sbjct: 1277 LFEEFKKKFYGILHSNLPSRKQMGKPMTFLQINDWIIELFLKLDPQDDEFISMIEDMIYF 1336

Query: 1350 XXXXXXXHGEENAYDEIDVNMIHIQIEEFIKEFRTTV-PPPPKLAHTFLVVCSAGHLMPW 1408
                    GEENAYDEID++M+HIQ+EE IK + + V     K+ HTFLV+ SA H  PW
Sbjct: 1337 TLDILLFQGEENAYDEIDLSMVHIQLEEQIKRYHSKVISNSHKVDHTFLVIGSACHTFPW 1396

Query: 1409 ESLEFLAKNSISRIPSTQILFDLIEKEQHLISPLVELEQNISVILNPDGDLVRTQADFIC 1468
            ESL F+   S+SRIPS + L   I +    +   V L + IS+ILNP GDL RT+  F  
Sbjct: 1397 ESLSFMNDLSLSRIPSIKWLESAITRHYEQLIKGVPLTEKISMILNPHGDLERTELRFRE 1456

Query: 1469 PFEEWCSHAPGSRLIVGEKPDEKTFLEMLTKAKTFIYVGHGGGEQFVRLKKIKQQNCIAP 1528
             FE   +  P S LIV EKPDE+  L M++    FIYVGHGGGEQ+VR ++IK+ + + P
Sbjct: 1457 TFETIVAKRPSSSLIVNEKPDEEKMLHMMSNCNLFIYVGHGGGEQYVRTREIKRCDNVGP 1516

Query: 1529 SFLLGCSSAYMQNFGKLEPSGIAYSYLLGGSSMVVGNLWDVTDKDIDKFSRTMFEKLGLV 1588
            SFLLGCSSA ++ +G LEP+G   SYLL GS +V+GNLWDVTDKDIDKFS+++FEK+GLV
Sbjct: 1517 SFLLGCSSASLKYYGGLEPTGTVNSYLLAGSPLVLGNLWDVTDKDIDKFSQSVFEKIGLV 1576

Query: 1589 REEEETY---TVSDAVASARYSCQLKYL 1613
              E+E     ++S AV  +R  C LK+L
Sbjct: 1577 MGEDEIIHKRSISRAVNESRQLCHLKFL 1604

>YGR098C (ESP1) [2058] chr7 complement(682568..687460) Separin protein
            required for Mcd1p and Rec8p cleavage and sister
            chromatid separation during mitosis and meiosis, also
            cleaves Slk19p and Mcd1p, also involved in regulation of
            spindle pole body duplication [4893 bp, 1630 aa]
          Length = 1630

 Score =  867 bits (2239), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 560/1647 (34%), Positives = 886/1647 (53%), Gaps = 68/1647 (4%)

Query: 1    MAGKNIALNDISLNSPCKIVSSLEGDTSDCVKLKNAEILNTRMDGENMVYDSFWGFECSR 60
            M  +   LN+IS N+P    S L  DT   V             G+     S    + S 
Sbjct: 2    MVKQEEPLNEISPNTPMTSKSYLLNDTLSKV----------HHSGQTRPLTSVLSGDASS 51

Query: 61   -----IAPNSDIIRKRVRDFLQRP------CIEDVQEVSLGFKRLYRTYLWKHQFNLVKE 109
                 +A +++IIR    DF +         IED+  V      +Y      H +  +  
Sbjct: 52   NSIGILAMHNNIIR----DFTKIASNNIDLAIEDITTVDHSLNSIYSLLKSHHMWGHINS 107

Query: 110  LVKQNMLAIIKIVELQSYDAAVQEVLNIYNETNHHKAESLEQFLLADLTTSNDYYXXXXX 169
             VKQ+++ I+K++   +   A  E++ ++NETN  +A SL+  LLAD +T NDYY     
Sbjct: 108  TVKQHLMIIVKLINNNALGLASSEIIFLFNETNLFQAHSLKNILLADFSTWNDYYLSNLK 167

Query: 170  XXXXXXXXXXXRQDFYGETILKLFANDSRYILRTEKIKIQPLTKILLNFFSLLPDFKALF 229
                         D Y   IL+LF++D RY+L+   +K   LTKI+L+FFS+    K LF
Sbjct: 168  ILALQIILKRKLVDEYLPHILELFSHDKRYLLKDPNLKAHALTKIVLSFFSVTTSCKVLF 227

Query: 230  SLKFMQYVKQFDLNFESYIKNMDMPKFQEMILI--WAQRSPTKTNGFLGLXXXXXXXXXX 287
             LKF+QY+KQF L F+ +I N+ +  F + +L   + +  P K   +L            
Sbjct: 228  GLKFLQYIKQFKLPFKKFISNITVECFSKNLLHKNYLEMGPNKI--YLNSFYLSYSMLYD 285

Query: 288  XVDKIMLHDLVNPSSRDRIKVISKGFNSLSSH-EWSQGIETFTNLSIIERNSLLEFIESQ 346
             +DKIML D+++      ++   K     + +   S+    ++ +S+ + N +LE   + 
Sbjct: 286  GLDKIMLLDILSYEETTEVQRAIKSKKEFNEYCNMSENRLLWSCISVDDLNVILENATNF 345

Query: 347  LEEKKFDSQKVAILLRWFLQLANN---ELSPATRQLWRIVDRITVFINSNLHSL----SI 399
            L+ K    + ++  L+  + L +    E  P  + + R  D   ++INSN+ S+    + 
Sbjct: 346  LQNK---GKHISATLKCLVCLWSTIRLEGLPKNKDILRQFDCTVIYINSNIKSINDESAA 402

Query: 400  HIVKELLDIIYDLCIVNLEPKRLLNVANVAFNSFIVFKNDIFVLQAAKFDLARQTIF--- 456
             ++ ELL ++ ++CI   EPKRL N+ +V FN+ ++FK+  F+L+ A  +++   I    
Sbjct: 403  ALLSELLGVLSEICIDYKEPKRLSNIISVLFNASVLFKSHSFLLKTANLEISNVLISNDS 462

Query: 457  KQGGLDLTRLEKFLSSASNGHR-IKLFTDVFNVFTCFEYESLGSLTE-VTSRFAKCLRSV 514
            K     + + EKF+SSA +  + I++F+ +FNV+     ++L  + +   + F  C   +
Sbjct: 463  KTSHRTILKFEKFISSAQSAQKKIEIFSCLFNVYCMLRNDTLSFVFDFCQNAFIHCFTRL 522

Query: 515  NIRASTELSGASELMICLLSTLRPLEPDSISCWSPLTRMLYHSLTN-YAKDNNKTEKCRD 573
             I    E S +SE+M+ +L     +E      WS L+RM++ SL   +  D  +     D
Sbjct: 523  KITKFIEFSNSSEIMLSVLYGNSSIENIPSENWSQLSRMIFCSLRGIFDLDPLELNNTFD 582

Query: 574  TLDPLKHYEVLIKTIYSLGLEIKKSSSHCLAKVSDNFTENWVKRLNFRESTMISLEYSAI 633
             L  L  YE+LI+ +Y L L++ K  +  L+K++  +   W+++ + +   + S E   +
Sbjct: 583  KLHLLNKYELLIRIVYLLNLDMSKHLTTNLSKITKLYINKWLQKSDEKAERISSFEMDFV 642

Query: 634  RTLFGYLRFNKFHKKVIDLALALKNSPHPYYEYCAENAQEQLIRGYVGLQMKTRILEGCS 693
            + L  YL FN F K  I+L+L +K S   YY      A   L+  Y+ L M    L   +
Sbjct: 643  KMLLCYLNFNNFDKLSIELSLCIK-SKEKYYSSIVPYADNYLLEAYLSLYMIDDALMMKN 701

Query: 694  ELMRLAQNPRLENLKRDQIFMYAETQLEICFWKRDFDTFNKIFVEGLPITNPEVMDVTNT 753
            +L +      L   K +Q  ++A + + +  W  D   F   F + LP   PE+ D+ N 
Sbjct: 702  QLQKTMN---LSTAKIEQALLHASSLINVHLWDSDLTAFQIYFGKTLPAMKPELFDINND 758

Query: 754  LKLPTKLYLKCLVLSINIVGIASNLQIHAGNLIEALVEAKRSIKLCQTLLKKVTQLDQEI 813
              LP  LY+K ++L+I I   ++ L I AGN+I A+++ +++  L  +LLKK  +L Q  
Sbjct: 759  HNLPMSLYIKVILLNIKIFNESAKLNIKAGNVISAVIDCRKAQNLALSLLKKKNKLSQGS 818

Query: 814  KWKVLTSLGTAFANIINIYTQLGVSRDCDFYVTEYLRVSCSMKDPVVIHECLQKCVGYYR 873
            +  +L SL  +F  +I I+ ++G +RDC+FY  E  R+   +++P++++ CL     YY 
Sbjct: 819  RLALLKSLSFSFFQLIKIHIRIGSARDCEFYSKELSRIISDLEEPIIVYRCLHFLHRYYM 878

Query: 874  LTDQLSLADALLRKANGIFNQLDGSEXXXXXXXXXXXXGEHEKLANSLRLFFKDYFSESL 933
            +T+Q  L +  L KAN  F+ LD                E  KL  SL L+F D   ++ 
Sbjct: 879  ITEQTCLQNITLGKANKAFDYLDAEADITSLTMFLYDNKEFVKLEQSLVLYFGDQLEKTF 938

Query: 934  LVDIWSLALGGTLNRYHEDATLRRLSGINEGKQLYEKISKQMDTDAFFGSVKESVTTIPS 993
            L ++W L LG  ++     +     + IN    +++K+  Q++ D FF  + ES   IPS
Sbjct: 939  LPNLWKLHLGKDIDDSICLSEYMPKNVINRVHNMWQKVMSQLEEDPFFKGMFESTLGIPS 998

Query: 994  CVLPALEVRKHPATSVCE-FGTPTKNK-GIPFTNLNSPRPSSLTPRGKSLKQKFDRAKAL 1051
              LP +     P+T       TP+K+  G+   +  SPR SS+TPRGK+++QKFDR  A+
Sbjct: 999  S-LPVI-----PSTMPNNILKTPSKHSTGLKLCD--SPRSSSMTPRGKNIRQKFDRIAAI 1050

Query: 1052 NDLETVKRLVGSLSTDGMKNYEIVEAXXXXXXXXXXXXXXXXXXXXXXAIEQMLTLAELP 1111
            + L+ +K L+ SL  D + N+E+ +                       ++    +L +LP
Sbjct: 1051 SKLKQMKELLESLKLDTLDNHELSKISSLSSLTLTILSNITSIHNAESSLITNFSLTDLP 1110

Query: 1112 KMRPLHFDKILSSQGNEIYGSF-IPLQVDCKRISIDNQLQDIVRNQTDMSFNSDPHLFNV 1170
            +  PL FDK+L++  N+ Y  F +   +    IS   +   +   Q D+   S+ ++ NV
Sbjct: 1111 RHMPLLFDKVLNNIDNKNYREFRVSSLIAPNNISTITESIRVSAAQKDL-MESNLNI-NV 1168

Query: 1171 VCIDVCGITGDLILTRTDSGRNKVMCLRLPLSRGSSRDVDEVALSFHDAMEELKSIIKES 1230
            + ID C ITG+L+L++ +  R +   LRLPL R +SRD+DEV LSF +A ++L SII ES
Sbjct: 1169 ITIDFCPITGNLLLSKLEPRRKRRTHLRLPLIRSNSRDLDEVHLSFPEATKKLLSIINES 1228

Query: 1231 NITTSSDVTAAINTKDDRKQWWQRRYDLDARLRNLILKIENSWFSGFKTFFKQETIEQRH 1290
            N TTS +VT  I T+++RK WW  RYDLD R++ L+  IENSWF+G + FF  E ++   
Sbjct: 1229 NQTTSVEVTNKIKTREERKSWWTTRYDLDKRMQQLLNNIENSWFNGVQGFFSPEVVDNSL 1288

Query: 1291 LDRFRVKLEEILQESLPTRKQFGNPANFFRIXXXXXXXXXXXXPSDSDFMEMMEXXXXXX 1350
             ++F+ K  EIL ++LP+RK +GNPA F ++            P + DF+  ME      
Sbjct: 1289 FEKFKDKFYEILHQNLPSRKLYGNPAMFIKVEDWVIELFLKLNPQEIDFLSKMEDLIYFV 1348

Query: 1351 XXXXXXHGEENAYDEIDVNMIHIQIEEFIKEFRTTVPPPPKLAHTFLVVCSAGHLMPWES 1410
                  HGEENAYDEID +M+H+Q+EE IK++R T+     + HTFLVV S+ HL PWE 
Sbjct: 1349 LDILLFHGEENAYDEIDFSMLHVQLEEQIKKYRATMTTN-SIFHTFLVVSSSCHLFPWEC 1407

Query: 1411 LEFLAKNSISRIPSTQILFDLIEKEQHLISPLVELEQNISVILNPDGDLVRTQADFICPF 1470
            L FL   SI+R+PS   L  L+ +  + +   V +E NIS+ILNP+GDL RT++ F   F
Sbjct: 1408 LSFLKDLSITRVPSYVCLNKLLSRFHYQLPLQVTIEDNISMILNPNGDLSRTESKFKGMF 1467

Query: 1471 EEWCSHAPGSRLIVGEKPDEKTFLEMLTKAKTFIYVGHGGGEQFVRLKKIKQQNCIAPSF 1530
            ++     P S+L++ EKP+E+T L+ML  +  F+Y+GHGGGEQ+VR K+IK+   IAPSF
Sbjct: 1468 QKIIDAKPSSQLVMNEKPEEETLLKMLQNSNLFVYIGHGGGEQYVRSKEIKKCTKIAPSF 1527

Query: 1531 LLGCSSAYMQNFGKLEPSGIAYSYLLGGSSMVVGNLWDVTDKDIDKFSRTMFEKLGLVRE 1590
            LLGCSSA M+ +GKLEP+G  Y+YLLGG  MV+GNLWDVTDKDIDKFS  +FEK+G    
Sbjct: 1528 LLGCSSAAMKYYGKLEPTGTIYTYLLGGCPMVLGNLWDVTDKDIDKFSEELFEKMGFRCN 1587

Query: 1591 EEE----TYTVSDAVASARYSCQLKYL 1613
             ++    + +VS AV+ +R  C L+YL
Sbjct: 1588 TDDLNGNSLSVSYAVSKSRGVCHLRYL 1614

>KLLA0D15136g complement(1276819..1281594) similar to sp|Q03018
            Saccharomyces cerevisiae YGR098c ESP1 required for sister
            chromatid separation singleton, hypothetical start
          Length = 1591

 Score =  793 bits (2049), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 531/1584 (33%), Positives = 806/1584 (50%), Gaps = 96/1584 (6%)

Query: 64   NSDIIRKRVRDFLQRPC--IEDVQEVSLGFKRLYRTYLWKHQFNLVKELVKQNMLAIIKI 121
            NS I  K++ DF+       E+  +V+  F +LYR  +W+HQ   ++EL K++M  II +
Sbjct: 47   NSLIDWKKLYDFVDNKSKDFENYIQVNDSFIQLYRQLIWRHQLKKLQELPKKHMNWIIFL 106

Query: 122  VELQSYDAAVQEVLNIYNETNHHKAESLEQFLLADLTTSNDYYXXXXXXXXXXXXXXXXR 181
            +E      A  ++L +YNETN  KA+ ++  LL+D +  N+ Y                 
Sbjct: 107  MERNKLTQASNQILMLYNETNLIKAKGIDDVLLSDFSAGNENYLATLKVITMQLILKTGT 166

Query: 182  QDFYGETILKLFANDSRYILRTEKIKIQPLTKILLNFFSLLPDFKALFSLKFMQYVKQFD 241
             + + E++L+ FA+D+RY+L+   +K+  L K++LNFF+LL  FK LF LKF+QYV QF 
Sbjct: 167  TERHAESLLECFAHDTRYLLKDPNVKVHALVKLILNFFTLLTGFKPLFGLKFVQYVNQFK 226

Query: 242  LNFESYIKNMDMPKFQEMILIWAQRSPTKTNGFLGLXXXXXXXXXXXVDKIMLHDLVNPS 301
            L F +YIKNMD   FQ  I     R     N  + L             K M +D VN +
Sbjct: 227  LEFGNYIKNMDSSTFQRQITKLL-RKDISVNCHIYLPKYYDEYT-----KHMENDQVNLT 280

Query: 302  SRDRIKVISKGFNSLSSHEWSQGIETFTNLSIIERNSLLEFIESQLEEKKFDSQKVAILL 361
               R  VI K                           +   I +QL  + F + K+  LL
Sbjct: 281  EFLRTDVIGKD--------------------------VCTEIRNQLRLQSFSAGKIDALL 314

Query: 362  RWFL-QLANNELSPATRQLWRIVDRITVFINSNLHSLSIHIVKELLDIIYDLCIVNLEPK 420
            R FL Q A N+ S       R+ D + + +N+++  L+   V  +L  +  + +   + K
Sbjct: 315  RPFLYQAALNKSSS------RLCDSLIISVNNSIKDLNEEAVIYVLVYLSKIFLSFEDFK 368

Query: 421  RLLNVANVAFNSFIVFKNDIFVLQAAKFDLARQTIFKQGGLD-LTRLEKFLSSASNGHRI 479
            R  NVA V +N F+  +  +F+  AA  +  R  +     L+   + E+ +    + +  
Sbjct: 369  RTDNVAAVLYNCFVTKRKLLFLEHAAMVNY-RAYLRTSNILEHFKKFERIIGCCQDRNVQ 427

Query: 480  KL-FTDVFNVFTCFEYESLGSLTEVTSR-FAKCLRSVNIRASTELSGASELMICLLSTLR 537
            KL F+ V NVF  F+  +L  +  +T +    C R + +      + +SE M+CLL +  
Sbjct: 428  KLLFSYVCNVFMIFKENTLQDMWNLTRKSLVPCFRRMKLDKFEIFNFSSEPMLCLLYSGS 487

Query: 538  PLEPDSISCWSPLTRMLYHSLTNYAKDNNKTEKCRDTLDPLKHYEVLIKTIYSLGLEIKK 597
                     WS L +ML   +T+  + + + +   +TLD    YEVLIK+++ L  E+ +
Sbjct: 488  HFSYQFK--WSHLCQMLTDIVTDVKQSDLQIDMKINTLDSFSKYEVLIKSMFCLNSEMNR 545

Query: 598  SSSHCLAKVSDNFTENWVKRLNFRESTMISLEYSAIRTLFGYLRFNKFHKKVIDLALALK 657
            +S   L KVS+ + E WV + N  E+ +  LE   + ++  +L  NK +K   ++   L+
Sbjct: 546  NSCLKLQKVSNIYLEKWVNKGN--ETKLSDLELMLLESMMPFLLQNKIYKLTAEICTQLR 603

Query: 658  NSPHPYYEYCAENAQEQLIRGYVGLQMKTR----ILEGCSELMRLAQNPRLENLKRDQIF 713
            +     Y    +     L+  YVGLQ+  +    I+E  S L    Q      +  DQ+ 
Sbjct: 604  SVQR--YASIPDLISYWLLESYVGLQIGPKVELSIMETVSALK--YQPSSFTEMNVDQLH 659

Query: 714  MYAETQLEICFWKRDFDTFNKIFVEGLPITNPEVMDVTNTLKLPTKLYLKCLVLSINIVG 773
                  L    WK+D +TFNK+  + L    P + D+ N  K+P   YLK L+L+I I  
Sbjct: 660  TTLCILLTQVLWKKDIETFNKLIHDDLTRFRPNLFDIQNKTKMPVAEYLKILMLNIKITR 719

Query: 774  IASNLQIHAGNLIEALVEAKRSIKLCQTLLKKVTQLDQEIKWKVLTSLGTAFANIINIYT 833
             AS LQ+   N+  +L E KRS+K+C+ L+KK   L  + +++V++ L   F  II+IY 
Sbjct: 720  CASILQLSQNNVYMSLKECKRSLKICRLLIKKEAVLSAKYRFEVISLLDDIFQRIISIYV 779

Query: 834  QLGVSRDCDFYVTEYLRVSCSMKDPVVIHECLQKCVGYYRLTDQLSLADALLRKANGIFN 893
              G+ +DC F++TEY  V  S+ +P  +         YY+L ++   A   L K N  F+
Sbjct: 780  HTGIFKDCAFFITEYQEVIGSLDNPTALFNMFSCLCSYYQLIEESENASLSLTKMNAAFD 839

Query: 894  QLDGSEXXXXXXXXXXXXGEHEKLANSLRLFFKDYFSESLLVDIWSLALGGTLNRYHEDA 953
            Q+DGS              E EKL NS+RLFF D    S +V+ W L      +      
Sbjct: 840  QIDGSANIEALATFLYFNKESEKLNNSMRLFFGDDVFISDIVEYWLLRSCQKTSTETTRK 899

Query: 954  TLRRLSGINEGKQLYEKISKQMDTDAFFGSVKESVTTIPSCVLPALEVRKHPATSVCEFG 1013
                +  +N  K LY K+ KQM TD FF S+ ESV  IP+C         +   S+   G
Sbjct: 900  DFEAMVCMNNAKILYNKVQKQMATDTFFRSMGESVMAIPAC---------YDCDSISVDG 950

Query: 1014 TPTKNKGIPFTNL-------NSPRPSSLTPRGKSLKQKFDRAKALNDLETVKRLVGSLST 1066
               ++K +  T++       +SPRPSSLTPRGKSL   FDR+ A+N+L+   R + +   
Sbjct: 951  ---RHKSLSLTSVQTLKSVNDSPRPSSLTPRGKSLAYSFDRSTAINNLQMTDRFIQNADI 1007

Query: 1067 DGMKNYEIVEAXXXXXXXXXXXXXXXXXXXXXXAIEQMLTLAELPKMRPLHFDKILSSQG 1126
              +K +EI E                        + Q   L + P+   L ++K  S  G
Sbjct: 1008 KALKAHEIRELASLHSLTLSLFFNMSTKTRLESQLGQNFRLRDHPRSLSLLYEKAFSDMG 1067

Query: 1127 NEIYGSFIPLQVDCKRISIDNQLQDIVRNQTDMSFNSDPHLFNVVCIDVCGITGDLILTR 1186
             EIY SFIP  +  + + +     ++    ++         FNVV ID+C +TGDL++TR
Sbjct: 1068 TEIYDSFIPETIATESVEMSECNMNLATIHSEFGKKWSHLSFNVVEIDICQLTGDLLITR 1127

Query: 1187 TDSGRNKVMCLRLPLSRGSSRDVDEVALSFHDAMEELKSIIKESNITTSSDVTAAINTKD 1246
             D+ RNK + LRLPL+R +SRD+ E  L F  A++EL  II  +N TTS +VT+ I TK+
Sbjct: 1128 FDTVRNKHLHLRLPLNRHNSRDLSEEVLGFEAALDELNHIISSNNCTTSIEVTSVITTKE 1187

Query: 1247 DRKQWWQRRYDLDARLRNLILKIENSWFSGFKTFFKQETIEQRHLDRFRVKLEEILQESL 1306
             RK WW  RY L+ RL+ L+ KIE+SWF GFK  F    ++Q+  + F+   + IL   L
Sbjct: 1188 QRKNWWDERYALNNRLQTLLTKIEDSWFCGFKGVFNPRIVDQQQFEIFKKGFQSILHTHL 1247

Query: 1307 PTRKQFGNPANFFRIXXXX----XXXXXXXXPSDSDFMEMMEXXXXXXXXXXXXHGEENA 1362
            P+RK      +F ++                P++   + MME            HGE+NA
Sbjct: 1248 PSRKSSRQSDSFLQVDNMLIELFVLLDVINQPTEKA-VSMMEDLIYFVFDILLFHGEQNA 1306

Query: 1363 YDEIDVNMIHIQIEEFIKEFRTTVPPPPK-LAHTFLVVCSAGHLMPWESLEFLAKNSISR 1421
            YDEIDVN++H++ EE ++E+        + L HTFL++ +  H +PWESL+FL   SISR
Sbjct: 1307 YDEIDVNLMHVKFEELLQEYNAESKTKDQTLDHTFLILGNKCHSIPWESLDFLKSISISR 1366

Query: 1422 IPSTQILFDLIEKEQHLISPLVELEQNISVILNPDGDLVRTQADFICPFEEWCSHAPGSR 1481
            +PS ++L +L+ K   L SP V + +N+S +LNP  DL RT+  F   F    S    S+
Sbjct: 1367 VPSIKMLDELLTKHSEL-SPCVNVSENLSFVLNPGNDLGRTETVFSSEFIAMASRT-NSK 1424

Query: 1482 LIVGEKPDEKTFLEMLTKAKTFIYVGHGGGEQFVRLKKIKQQNCIAPSFLLGCSSAYMQN 1541
              +G+ P    F   +  +  F+YVGH GGEQ+V+LK +++ N +APS LLGCSSA+++ 
Sbjct: 1425 AFIGKPPTVDEFFHSVADSNLFVYVGHSGGEQYVKLKDLRKCNHLAPSLLLGCSSAHLKY 1484

Query: 1542 FGKLEPSGIAYSYLLGGSSMVVGNLWDVTDKDIDKFSRTMFEKLG------LVREEEETY 1595
             G  E SG  YSYLLGGS MVVGNLWDVTDKD DK S ++FEK G      + R +E   
Sbjct: 1485 CGTFESSGTIYSYLLGGSPMVVGNLWDVTDKDTDKLSVSVFEKTGFFNSKPISRTDESDA 1544

Query: 1596 T------VSDAVASARYSCQLKYL 1613
            T      VS+A++ +R  C +KYL
Sbjct: 1545 TIKQFLNVSEAISQSRDECNMKYL 1568

>CAGL0G03223g complement(300119..304933) similar to sp|Q03018
            Saccharomyces cerevisiae YGR098c ESP1 required for sister
            chromatid separation, hypothetical start
          Length = 1604

 Score =  483 bits (1242), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 412/1583 (26%), Positives = 724/1583 (45%), Gaps = 116/1583 (7%)

Query: 86   EVSLGFKRLYRTYLWKHQFNLVKELVKQNMLAIIKIVELQSYDAAVQEVLNIYNETNHHK 145
            E+       Y  Y   H   ++  + KQ++L I+K++     ++A + ++++YN TN + 
Sbjct: 68   EIETTLSNTYSYYYRIHGLRVINLITKQHLLLIVKLINGNCLNSASRNIISLYNNTNRNS 127

Query: 146  AESLEQFLLADLTTSNDYYXXXXXXXXXXXXXXXXRQDFYGETILKLFANDSRYILRTEK 205
               ++Q LL D T +N  Y                       +++KLFA D + +L   K
Sbjct: 128  ISEIQQLLLCDYTKNNKEYLSSLKILVLQTLLKKHDVSESIISVIKLFAYDRKLLLEDHK 187

Query: 206  IKIQPLTKILLNFFSLLPDFKALFSLKFMQYVKQFDLNFESYIKNMDMPKFQEMILIWAQ 265
            +K   + K++LN++S   +++ LF LKF+QY+ QF+  ++ +IKNM    F + +     
Sbjct: 188  LKKNTVIKLILNYYSKFKEYRLLFGLKFLQYIAQFNFRYDEFIKNMTRDAFLQQLGRQKT 247

Query: 266  RSPTKTNGFLGLXXXXXXXXXXXVDKIMLHDLVNPSSRDRIKVISKGFNSLSSHEWSQGI 325
             + T T+ +L +                 + +   S+ D++      F+S S+    +G 
Sbjct: 248  SNNTLTSRYLSMFYFS-------------YQMQYKSNNDQL------FSSTSAEHVPEGF 288

Query: 326  ----ETFTNLSIIER------------NSLLEFI--ESQLEEKKFDSQKVAILLRWFLQL 367
                   TNL   ER            N L+  I  E ++ EK+ D +K  +L++  L +
Sbjct: 289  FNLQNVVTNLERNERFFDKYMMSTKQLNDLINIIAEEGRVFEKELD-EKSILLIQRILSI 347

Query: 368  ANNELSPATRQLWRIVDRITVFINSNLHSLS--IHIVKELLDIIYDLCIVNLEPKRLLNV 425
               +    ++ + + +D+I + +NSN+  LS  I  + +L++ +   C  N   K   N 
Sbjct: 348  FQIKCYEISKPVLKFLDKIIILLNSNVKYLSNDISPLIKLIESMIQFCTTNSLHKTFENT 407

Query: 426  ANVAFNSFIVFKNDIFVLQAAKFDLAR-----QTIFKQGGLDLTRLEKFLSSASNGHRIK 480
              VA+N  +  KN   +L  +KF+ +R     +   K    DL +   FLS+        
Sbjct: 408  MAVAYNIALKTKNSELLLLVSKFEFSRLLLNYKETEKIKPSDLNKFNVFLSATKEIRNRY 467

Query: 481  LFTDVFNVFTCFE----YESLGSLTEVTSRFAKCLRSVNIRASTELSGASELMICLLSTL 536
                +F   T F+    +  + ++ E  +   K  R +       L   SE+M  +++ +
Sbjct: 468  KILQIFYHHTLFDGKEHFNEVYAVCEYIAAIVK--RKIGTLKWENLECKSEVMKGIIAGV 525

Query: 537  RPLEPDSISCWSPLTRMLYHSLTNYAKDNNKTEKCRDTLDPLK-HYEV--LIKTIYSLGL 593
                  +  C  P   +L  S   + +    +E+  D+ +     Y+V  L+K  Y L  
Sbjct: 526  TNDRYPNNECMEPCILLLQSSF--FPEKVLTSEEYNDSSNQDGIVYDVFPLLKCNYLLNN 583

Query: 594  EIKKSSSHCLAKVSDNFTENWVK--RLNFRESTMISLEYSAIRTLFGYLRFNKFHKKVID 651
            +I K  +  L +V+  F +   K  ++N+       +E   I+ L  YL  N +HK ++ 
Sbjct: 584  DIAKGRTMYLVQVTKTFCQFATKDNKVNYCSR----IENDFIKKLLNYLSINGYHKLLLS 639

Query: 652  LALALKNSPHPYYEYCAENAQEQLIRGYVGLQMKTRILEGCSELMRLAQNPRLENLKRDQ 711
            +   L+     YY+  + +         + L++K R      +        + ++ K   
Sbjct: 640  VVGILEKRTE-YYKTLSNDYITYKAHSCMRLKLKNRTKHVFDQFTNQKGEIKFDDEK--D 696

Query: 712  IFMYAETQLEICFWKRDFDTFNKIFVEGLPITNPE-VMDVTNTLKLPTKLYLKCLVLSIN 770
            I+ +    L    W+   + F     E +P    E ++D +   K     Y + L+ +I 
Sbjct: 697  IYNHLIMSLLYASWEDSPELFTSS-NERVPKDIKEHILDFSTNDKSNLNKYFQKLIFNIK 755

Query: 771  IVGIASNLQIHAGNLIEALVEAKRSIKLCQTLLKKVTQLDQEIKWKVLTSLGTAFANIIN 830
                 ++L         A+  +K+ +K+ +++LK + +LD   +  VL  L ++++N+I 
Sbjct: 756  FANYYASLLNQKKCYSYAVEVSKKGLKIGKSVLKIIEKLDLNDRLTVLNQLVSSYSNLIK 815

Query: 831  IYTQLGVSRDCDFYVTEYLRVSCSMKDPVVIHECLQKCVGYYRLTDQLSLADALLRKANG 890
            IYT +G+++   +Y  E  ++      P+ +         +Y        A    + AN 
Sbjct: 816  IYTAVGLAKGAQYYCKEVTKLLPVFDQPIFLFSVHVLLFEFYLENGDYDSALTHKKNANY 875

Query: 891  IFNQLDGSEXXXXXXXXXXXXGEHEKLANSLRLFFKDYFSESLLVDIWSLALGGTLNRYH 950
            +F+ L+                E++K+  SLRL+F    +++     W L LG   +   
Sbjct: 876  VFDNLNAEHDIINTTSFLYINEEYDKIQESLRLYFGYDLNDTDFFLSWKLKLGNICDECP 935

Query: 951  EDATLRRLSGINEGKQLYEKISKQMDTDAFFGSVKESVTTIPSCVLPALEVRKHPATSVC 1010
               +   ++  N+   + +++  ++D D F  S+ E++    +CV P         +++ 
Sbjct: 936  TQYS--NMNFFNKIVHINQRLVLEIDADPFLKSLNETILANLNCVSPG------SLSNIL 987

Query: 1011 EFGTPTKNKGIPFTNLNSPR-PSSLTPRGKS----LKQKFDRAKALNDLETVKRLVGSLS 1065
            + G  + N     +N+   R P+S           L + F    A+    T + ++  +S
Sbjct: 988  DVGMISSNSTNRSSNMTPKRRPTSFKTNKHIVMDILDEFFTTFNAMRQELTERNVILKVS 1047

Query: 1066 TDGMKNYEIVEAXXXXXXXXXXXXXXXXXXXXXXAIEQMLT-LAELPKMRPLHFDKILSS 1124
                 NY                            IE+ +T L ELP      ++ +L+ 
Sbjct: 1048 DIYRLNY------------FYLISLLSVPESRKQLIEETITQLNELPSEITHTYESLLAD 1095

Query: 1125 QGNEIYGSFIPLQVDCKRISIDNQLQDIVRNQTDMSFNSDPHL------------FNVVC 1172
            +  +IYG  I          +++   +I++++ +++ N +  +              V+C
Sbjct: 1096 KNCDIYGKTI--------FELESSNYEIMKSK-NVTLNWEEQIGKDRLLDLCNITVEVIC 1146

Query: 1173 IDVCGITGDLILTRTDSGRNKVMCLRLPLSRGSSRDVDEVALSFHDAMEELKSIIKESNI 1232
            ID+C +T  LI+ R  +  +K +  ++P+ R  SRD+D  +L+F  A E L+ II +SN 
Sbjct: 1147 IDICKLTNTLIIRRISNLDSKNIMAKIPIDRNVSRDLDADSLTFQQASESLQKIINDSNE 1206

Query: 1233 TTSSDVTAAINTKDDRKQWWQRRYDLDARLRNLILKIENSWFSGFKTFFKQETIEQRHLD 1292
            + S +VT  I  K+D + WW+RRYDLD  L NLI +IE +W +G          ++  L 
Sbjct: 1207 SVSKNVTETIKDKNDVRNWWKRRYDLDELLGNLIERIEKTWLNGLSGILNGLYCDKDALL 1266

Query: 1293 RFRVKLEEILQESLPTRKQFGNPANFFRIXXXXXXXXXXXXPSDSDFMEMMEXXXXXXXX 1352
             F+ K+  IL + LP+R+   N ANF ++            PSD  F   +E        
Sbjct: 1267 EFQSKITAILNQILPSRRNCCNRANFLQLDEWIISLLLDLDPSDLGFFTALEDVIYFILD 1326

Query: 1353 XXXXHGEENAYDEIDVNMIHIQIEEFIKEFRTTVPPPPKLAHTFLVVCSAGHLMPWESLE 1412
                 GEENAYDEID  ++H+ +EE I++ R       K+ HTFLVV  + H  PWE ++
Sbjct: 1327 TLSHKGEENAYDEIDFGLLHVLLEEEIRKVRVNKKLFTKIEHTFLVVGPSCHTFPWEIMK 1386

Query: 1413 FLAKNSISRIPSTQILFDLIEKEQHLISPLVELEQNISVILNPDGDLVRTQADFICPFEE 1472
             L   S++R+PS  IL +L+   +  +   +E   +IS+ILN + DLVRT+  F   FE 
Sbjct: 1387 PLKGRSVTRVPSLTILSNLLSSIKGNLPVKIERTNDISMILNSNSDLVRTEKTFKDIFER 1446

Query: 1473 WCSHAPGSRLIVGEKPDEKTFLEMLTKAKTFIYVGHGGGEQFVRLKKIKQQNCIAPSFLL 1532
                  GSRL+V +KP E+ +++ LT +K F+YVGHGGGEQ+VR   I++ + + P FL+
Sbjct: 1447 IQDSRAGSRLLVNQKPTEEEYMDYLTNSKVFLYVGHGGGEQYVRNCTIERCDKLPPVFLM 1506

Query: 1533 GCSSAYMQNFGKLEPSGIAYSYLLGGSSMVVGNLWDVTDKDIDKFSRTMFEKLGLVREEE 1592
            GCSSA  +  G L P+ +A SY+ G S MV+GNLWDVTDKDIDKFS  M EK  L+  + 
Sbjct: 1507 GCSSAATKLNGNLNPNCVAESYMYGNSVMVLGNLWDVTDKDIDKFSIEMLEKCNLLDAKP 1566

Query: 1593 ETYT--VSDAVASARYSCQLKYL 1613
             T    V  AVA +R  C LKYL
Sbjct: 1567 NTVITGVPQAVADSRTVCHLKYL 1589

>Scas_682.6
          Length = 1498

 Score = 34.3 bits (77), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 37/84 (44%), Gaps = 7/84 (8%)

Query: 449 DLARQTIFKQG-GLDLTRLEKFLSSASNGHRIKLFT----DVFNVFTCFEYESLGSLTEV 503
           D   Q +  Q  GL L RL+K L    NG  +  FT     +  +F C++Y    SL E+
Sbjct: 419 DFILQELLTQSEGLPLKRLQKKLRKVDNGTYVTDFTITILKMLEIFNCYDYAK--SLNEI 476

Query: 504 TSRFAKCLRSVNIRASTELSGASE 527
           T    + L + N +    L   SE
Sbjct: 477 TPDTLRLLENENHKQQQGLQNISE 500

>Kwal_26.7613
          Length = 473

 Score = 32.3 bits (72), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 38/74 (51%), Gaps = 3/74 (4%)

Query: 521 ELSGASELMICLLSTLRPLEPDSISCWSPLTRMLYHSLTNYAKDNNKTE-KCRDTLDPLK 579
           EL   SE    L+  LR +  +  SC+   T+  Y S+ N++K N K     +D +DP  
Sbjct: 343 ELDKNSEESNTLIRALRQMNRNRDSCFKMATQ-CYESVINFSKKNKKLRFNVKDLMDPSA 401

Query: 580 HYEVLIKTIYSLGL 593
            + + + +IY +G+
Sbjct: 402 AHAIAL-SIYGMGV 414

>KLLA0B12562g complement(1095953..1099735) similar to sp|Q04439
            Saccharomyces cerevisiae YMR109w MYO5 myosin I, start by
            similarity
          Length = 1260

 Score = 32.3 bits (72), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 33/66 (50%), Gaps = 9/66 (13%)

Query: 1530 FLLGCSSAYMQNFGKLEPSGIAYSYLLGGSSMVVGNLWDVTDKDIDKFSRTM--FEKLGL 1587
            F  G S  Y QNFG L+P    Y+   G +S+      D  D D+  +  T+   + +GL
Sbjct: 231  FTKGASDTYRQNFGVLQPDQYIYTSASGCTSV------DTID-DLHDYQETIKAMQVIGL 283

Query: 1588 VREEEE 1593
             +EE++
Sbjct: 284  SQEEQD 289

>Kwal_56.23930
          Length = 533

 Score = 31.6 bits (70), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 23/37 (62%)

Query: 932 SLLVDIWSLALGGTLNRYHEDATLRRLSGINEGKQLY 968
           SLL+ ++   +G  ++RY+E   L RLS  N G +LY
Sbjct: 134 SLLLRVYGPQVGSIIDRYYELQVLARLSSHNVGPKLY 170

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.136    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 49,631,416
Number of extensions: 2119980
Number of successful extensions: 5996
Number of sequences better than 10.0: 19
Number of HSP's gapped: 6108
Number of HSP's successfully gapped: 21
Length of query: 1613
Length of database: 16,596,109
Length adjustment: 115
Effective length of query: 1498
Effective length of database: 12,615,039
Effective search space: 18897328422
Effective search space used: 18897328422
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 69 (31.2 bits)