Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_55.2052969168134710.0
Scas_716.266866789871e-124
YGR099W (TEL2)6887049781e-123
KLLA0D15158g6666649431e-118
AAR090W6596708042e-97
CAGL0G07755g6856777258e-86
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_55.20529
         (681 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_55.20529                                                        1341   0.0  
Scas_716.26                                                           384   e-124
YGR099W (TEL2) [2059] chr7 (687901..689967) Protein involved in ...   381   e-123
KLLA0D15158g 1281895..1283895 similar to sp|P53038 Saccharomyces...   367   e-118
AAR090W [276] [Homologous to ScYGR099W (TEL2) - SH] complement(5...   314   2e-97
CAGL0G07755g 736112..738169 similar to sp|P53038 Saccharomyces c...   283   8e-86

>Kwal_55.20529
          Length = 691

 Score = 1341 bits (3471), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 657/681 (96%), Positives = 657/681 (96%)

Query: 1   MNFANHQRSLKLATETLKTQPSAEVIQECLSVIQSQASLTVESAAVLARYVIPVYTSLPS 60
           MNFANHQRSLKLATETLKTQPSAEVIQECLSVIQSQASLTVESAAVLARYVIPVYTSLPS
Sbjct: 1   MNFANHQRSLKLATETLKTQPSAEVIQECLSVIQSQASLTVESAAVLARYVIPVYTSLPS 60

Query: 61  ASKMLLFTIFEESFLLLGHVLNFIKLLQKSSEAKIYKRFLIEGLSHNHGCIYKYIRGAEH 120
           ASKMLLFTIFEESFLLLGHVLNFIKLLQKSSEAKIYKRFLIEGLSHNHGCIYKYIRGAEH
Sbjct: 61  ASKMLLFTIFEESFLLLGHVLNFIKLLQKSSEAKIYKRFLIEGLSHNHGCIYKYIRGAEH 120

Query: 121 ITELQMLRSAFFGSKILNSVGDEIDIENYLDIVRAQFKFIFDQTPQFEDKVYADFLCAFI 180
           ITELQMLRSAFFGSKILNSVGDEIDIENYLDIVRAQFKFIFDQTPQFEDKVYADFLCAFI
Sbjct: 121 ITELQMLRSAFFGSKILNSVGDEIDIENYLDIVRAQFKFIFDQTPQFEDKVYADFLCAFI 180

Query: 181 SLHSLLAPEVVFGGLVLSSEDHFSKFVQILRCASLLSQKKLVKALIFFLDSRVSQANTDS 240
           SLHSLLAPEVVFGGLVLSSEDHFSKFVQILRCASLLSQKKLVKALIFFLDSRVSQANTDS
Sbjct: 181 SLHSLLAPEVVFGGLVLSSEDHFSKFVQILRCASLLSQKKLVKALIFFLDSRVSQANTDS 240

Query: 241 AFNIFQRVGVELLSTDILLKVHNEILSAVLVRNLTEEQALKLYHSLLVFFHRHEAESDGT 300
           AFNIFQRVGVELLSTDILLKVHNEILSAVLVRNLTEEQALKLYHSLLVFFHRHEAESDGT
Sbjct: 241 AFNIFQRVGVELLSTDILLKVHNEILSAVLVRNLTEEQALKLYHSLLVFFHRHEAESDGT 300

Query: 301 ACFLLCLALQRLPHSVKAELGHAEEFLNAVTFRLTSQDAAIRERTMYIAKKITNDSFEYE 360
           ACFLLCLALQRLPHSVKAELGHAEEFLNAVTFRLTSQDAAIRERTMYIAKKITNDSFEYE
Sbjct: 301 ACFLLCLALQRLPHSVKAELGHAEEFLNAVTFRLTSQDAAIRERTMYIAKKITNDSFEYE 360

Query: 361 SDFTIETPHIKTPKSSIIDFSTLQAVKPLHDHERNFKPSASLDNTMVRLSLSESETDENG 420
           SDFTIETPHIKTPKSSIIDFSTLQAVKPLHDHERNFKPSASLDNTMVRLSLSESETDENG
Sbjct: 361 SDFTIETPHIKTPKSSIIDFSTLQAVKPLHDHERNFKPSASLDNTMVRLSLSESETDENG 420

Query: 421 VTLVFLKDLIREFELLSNQTASRLHLLKSTVRLIRQKKDFTLEISTYSPQLLAVITSLAN 480
           VTLVFLKDLIREFELLSNQTASRLHLLKSTVRLIRQKKDFTLEISTYSPQLLAVITSLAN
Sbjct: 421 VTLVFLKDLIREFELLSNQTASRLHLLKSTVRLIRQKKDFTLEISTYSPQLLAVITSLAN 480

Query: 481 NLEEPAFEEWRINALVSILFAAPEKVIELIKILFGQELSLQQRMXXXXXXXXXXRELRGI 540
           NLEEPAFEEWRINALVSILFAAPEKVIELIKILFGQELSLQQRM          RELRGI
Sbjct: 481 NLEEPAFEEWRINALVSILFAAPEKVIELIKILFGQELSLQQRMSILSALSLAARELRGI 540

Query: 541 DDSVIMKLQVDFPTKRLPWDKGKPEGMKNDKLSASVPTSKSLLQENXXXXXXXXXXXXXX 600
           DDSVIMKLQVDFPTKRLPWDKGKPEGMKNDKLSASVPTSKSLLQEN              
Sbjct: 541 DDSVIMKLQVDFPTKRLPWDKGKPEGMKNDKLSASVPTSKSLLQENKTTWKSKKLTTSAK 600

Query: 601 DILSENRFRKVAAKFFFPLAHGWLNGINMGTYDLMFKKHYLTTMQMVLSAAYPHHEFNSM 660
           DILSENRFRKVAAKFFFPLAHGWLNGINMGTYDLMFKKHYLTTMQMVLSAAYPHHEFNSM
Sbjct: 601 DILSENRFRKVAAKFFFPLAHGWLNGINMGTYDLMFKKHYLTTMQMVLSAAYPHHEFNSM 660

Query: 661 CQQMAIIVQDAIDQGVEVDEL 681
           CQQMAIIVQDAIDQGVEVDEL
Sbjct: 661 CQQMAIIVQDAIDQGVEVDEL 681

>Scas_716.26
          Length = 686

 Score =  384 bits (987), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 236/678 (34%), Positives = 382/678 (56%), Gaps = 19/678 (2%)

Query: 15  ETLKTQPSAEVIQECLSVIQSQA-SLTVESAAVLARYVIPVYTSLPSASKMLLFTIFEES 73
           + LK  P A+VI++ L  + ++  + T+E   ++ ++VIP+Y SL   ++ L  ++   S
Sbjct: 5   KVLKDHPDAQVIEDVLQQLSNETDAPTLEVCLLIIQHVIPIYPSLSKHTRDLTQSLVSRS 64

Query: 74  FLLLGHVLNFIKLLQKSS-EAKIYKRFLIEGLSHNHGCIYKY-IRGAEHITELQMLRSAF 131
           F  +  ++N+   + K   E K+Y+ F+ E L+    C++ Y I  +    E   L++ F
Sbjct: 65  FTFMSQLVNYASTVMKDKPEGKLYRNFIKEVLATQPECLHNYLIHMSSSRMEKNYLKTLF 124

Query: 132 FGSKILNSVGDEIDIENYLDIVRAQFKFIFDQTPQFE----DKVYADFLCAFISLHSLLA 187
           FGS++ NS+G++IDI  YL+++R+Q+K + D     E    D    + L + + L+   A
Sbjct: 125 FGSRVFNSLGNDIDIIEYLELLRSQWKSVLDDDILIETLVLDSFLGELLVSSLILNPTYA 184

Query: 188 PEVVFGGLVLSSEDHFSKFVQILRCASLLSQKKLV-KALIFFLDSRVSQANTDSAFNIFQ 246
            +++FG L LS+E + +   +I+  AS L Q++LV K L+ +L+   + +N  S  +I +
Sbjct: 185 MDLLFGDLFLSTETYATILNKIILNASNLDQQRLVNKFLLPYLEPLTNTSNFKSTNHILR 244

Query: 247 RVGV-ELLSTDILLKVHNEILSAVLVRNLTEEQALKLYHSLLVFFHRHEAESDGTACFLL 305
            + + + ++ D++L++ + IL  +++R ++E  A  +  SL+  F   +   D   C + 
Sbjct: 245 ELPLHKCITLDVILRMKSHILQEIIIRQMSE-FASSIIPSLISKFGTLDESQDEDICIIF 303

Query: 306 CLALQ-RLPHSVKAELGHAEEFLNAVTFRLTSQDAAIRERTMYIAKKITNDSFEYESDFT 364
            + L+  L    + +L H   FL+A+T RL+ +++  RERTM+IAK  +N+  EY+SDF 
Sbjct: 304 VMVLKFNLNEEQREQLAHDGNFLDAITKRLSHKNSEFRERTMFIAKLASNNELEYDSDFV 363

Query: 365 IETPHIKTPKSSIIDFSTL---QAVKPLHDHERNFKPSASLDNTMVRLSLSESETDENGV 421
           I+ P +    +  I+       ++   +   + +   S   +  +   S  E + DE  +
Sbjct: 364 IKLPDLDITNNEKIEIDPALFKRSSSGVSASKVSRISSGFHEMVLQEDSDDEVQDDEQEI 423

Query: 422 T--LVFLKDLIREFELLSNQ-TASRLHLLKSTVRLIRQKKDFTLEISTYSPQLLAVITSL 478
              +VFLKDL++EFE   N   A  + LLK T+ L+RQK+ F LE+  Y   LL  I  L
Sbjct: 424 INRIVFLKDLVKEFEKNGNDGPAESIPLLKKTITLVRQKEHFPLEVDYYFSGLLTNIAYL 483

Query: 479 ANNLEEPAFEEWRINALVSILFAAPEKVIELIKILFGQELSLQQRMXXXXXXXXXXRELR 538
            NNLEE  FEEWRINALVS+L   PEKV ELIKI    ELSLQQRM          RELR
Sbjct: 484 NNNLEESNFEEWRINALVSLLVVVPEKVQELIKIFLSSELSLQQRMSILSSLGLSARELR 543

Query: 539 GIDDSVIMKLQVDFPTKRLPWDKGKPEGMKNDKLSASVPTSKSLLQENXXXXXXXXXXXX 598
           G+DD VI K ++DFPT RLPWDK   E     +++    ++ +L++              
Sbjct: 544 GMDDKVITKPKLDFPTSRLPWDKKTKEQHDKKRITELGNSNSTLIETKTTWKSKKLTLAA 603

Query: 599 XXDILSENRFRKVAAKFFFPLAHGWLNGINMGTYDLMFKKHYLTTMQMVLSAAYPHHEFN 658
             D    NRFR+ A  FF+PLAH WLNGI++GT+D +FK H+LTT++++   A+P H++ 
Sbjct: 604 KED--KPNRFREYATLFFYPLAHIWLNGIDVGTFDDLFKNHFLTTLRIIYMCAHPVHDYE 661

Query: 659 SMCQQMAIIVQDAIDQGV 676
           SM Q M  I+  A +QGV
Sbjct: 662 SMTQLMEQIIYQATEQGV 679

>YGR099W (TEL2) [2059] chr7 (687901..689967) Protein involved in
           controlling telomere length and telomere position effect
           [2067 bp, 688 aa]
          Length = 688

 Score =  381 bits (978), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 246/704 (34%), Positives = 381/704 (54%), Gaps = 52/704 (7%)

Query: 12  LATETLKTQPSAEVIQECLSVIQS--QASLTVESAAVLARYVIPVYTSLPSASKMLLFTI 69
           +  ETLK    +  I E L  + S  +  + ++++ VL ++VIPVY SLP  SK++L  +
Sbjct: 1   MVLETLKQGLDSSQIHEALIQLDSYPREPVDLDASMVLIKFVIPVYPSLPERSKVILRRL 60

Query: 70  FEESFLLLGHVLNFIKLLQKSS---EAKIYKRFLIEGLSHNHGCIYKYIRGAE-HITELQ 125
             +SF  L  ++ F + +       E +IY+  L + +S   GC+  Y++ +     +  
Sbjct: 61  ASKSFTFLCQIVTFSRTISGRDGLQEIRIYQEILEDIISFEPGCLTFYLKASTTSKADRD 120

Query: 126 MLRSAFFGSKILNSVGDEIDIENYLDIVRAQFKFIFDQTPQFEDKVYADFLCAFISLHSL 185
            +++ FFGSK+ N + + ID+  YL  +R Q+KF+ +           ++L +   L+ +
Sbjct: 121 SIKALFFGSKLFNVLANRIDMAKYLGYLRLQWKFLLESNETDPPGFLGEWLVSSFLLNPV 180

Query: 186 LAPEVVFGGLVLSSEDHFSKFVQILRCASLLSQKKLV-KALIFFLDSRVSQANTDSAFNI 244
           LA +++ G L L  E +F  F +I+  +SL+ QK+L+ K L+ ++   V+  N +    I
Sbjct: 181 LAADMLLGELFLLKESYFFSFQKIISASSLIDQKRLIAKFLLPYIQVIVTLENLNDVRKI 240

Query: 245 FQRVGVE-LLSTDILLKVHNEILSAVLVRNLTEEQALKLYHSLLVFFHRH-EAESDGTAC 302
            +R  ++ ++S  +L ++ +  L  V+VR ++   + K   +L+  F    + E D   C
Sbjct: 241 LRRFDLDKIISLSVLFEIQSLPLKEVIVRLMSNHSSTKFVSALVSKFADFTDEEVDTKTC 300

Query: 303 FLLCL-ALQRLPHSVKAELGHAEEFLNAVTFRLTSQDAAIRERTMYIAKKITNDSFEYES 361
            LL L A+  L HS + E+ H E FLN VT  L S +   RER M+IAK ++    +YES
Sbjct: 301 ELLVLFAVHNLNHSQREEIAHDERFLNGVTKHLGSNEREARERAMFIAKLLSGGHLKYES 360

Query: 362 DFTIETPHIKTPKSS---IIDFSTLQAVKPLHDHERNFKPSASLDNTMV-RLSLSESETD 417
           DF I  P++K   +S   IIDF +L+             PS     T V +  ++E    
Sbjct: 361 DFKINIPNVKFESNSDDKIIDFQSLK------------NPSICNTQTDVGKDKITEVSGH 408

Query: 418 ENGVTL--------------------VFLKDLIREFELLS-NQTASRLHLLKSTVRLIRQ 456
              +TL                    VFLKDL++E+E    ++ A  + LLK TV+LIRQ
Sbjct: 409 VQSLTLDCSDSDDEDENDEREIVKRIVFLKDLMKEYEKTGESRKAPLIPLLKQTVKLIRQ 468

Query: 457 KKDFTLEISTYSPQLLAVITSLANNLEEPAFEEWRINALVSILFAAPEKVIELIKILFGQ 516
           K DF LE+  Y+  +L+ I  L N  +EP FE+WRINAL SIL   PEKV   I ILF  
Sbjct: 469 KADFQLEVGYYAQGILSSIVCLNNEFDEPLFEQWRINALTSILVVLPEKVNGAINILFNS 528

Query: 517 ELSLQQRMXXXXXXXXXXRELRGIDDSVIMKLQVDFPTKRLPWDKGKPEGMKNDKLSASV 576
           ELSLQQRM          RELRG+DD  I+K + DFPT RLPWD    +   N +L   V
Sbjct: 529 ELSLQQRMSLLSALGLSARELRGLDDPTIVKPKFDFPTNRLPWDD---QSHHNSRL-VEV 584

Query: 577 PTSKSLLQENXXXXXXXXXXXXXXDILSENRFRKVAAKFFFPLAHGWLNGINMGTYDLMF 636
             S S++++               +  ++NRFRK A  FF+PLAHGWLNGI++GTY+ +F
Sbjct: 585 QESTSMIKKT-KTVWKSRKLGKDREKGTQNRFRKYAGLFFYPLAHGWLNGIDVGTYNQLF 643

Query: 637 KKHYLTTMQMVLSAAYPHHEFNSMCQQMAIIVQDAIDQGVEVDE 680
           K HYLTT++++ S A P H+F SM + M  I+  AI++G+ +++
Sbjct: 644 KSHYLTTLRIIYSCANPVHDFESMTELMNHIISSAIEEGISLNK 687

>KLLA0D15158g 1281895..1283895 similar to sp|P53038 Saccharomyces
           cerevisiae YGR099w TEL2 involved in controlling telomere
           length and position effect singleton, start by
           similarity
          Length = 666

 Score =  367 bits (943), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 213/664 (32%), Positives = 355/664 (53%), Gaps = 9/664 (1%)

Query: 17  LKTQPSAEVIQECLSVIQSQASLTVESAAVLARYVIPVYTSLPSASKMLLFTIFEESFLL 76
           L  +   + I + L  + S+   +      + + V+P+Y SLP   KM L  +   +++ 
Sbjct: 9   LNEKCDKDTIYQVLERMSSKKQHSSNEILPIIKNVVPIYPSLPRELKMALRRLCGNNYIF 68

Query: 77  LGHVLNFIKLLQKSSEAKIYKRFLIEGLSHNHGCIYKYIRGAEHITELQMLRSAFFGSKI 136
           +  V+ + K L K+ E  I+  FL + L +   C++ Y+  +    +L  ++S  FGS+ 
Sbjct: 69  ISLVIEYAKELGKNRETSIFYGFLTDVLKYESDCLFNYLEHSSR-RDLPFIKSILFGSRC 127

Query: 137 LNSVGDEIDIENYLDIVRAQFKFIFDQTPQFEDKVYADFLCAFISLHSLLAPEVVFGGLV 196
            N++   I I  YL  ++ Q++F+F +T Q+ DK + +   + + L+     ++   GL 
Sbjct: 128 YNALSSSISIVEYLKFMKMQWEFVFKETKQY-DKTHLEMFVSCLQLNIPYGVDIFIEGLA 186

Query: 197 LSSEDHFSKFVQILRCASLLSQKKL-VKALIFFLDSRVSQANTDSAFNIFQRVGVELLST 255
            +SE  ++  + +L   + + Q++  +  L+ FL+   +  N+ + F +  ++  ++ ++
Sbjct: 187 TTSEFSWNALIMMLSKGTSVQQRRFFMYHLVPFLEKVTNPDNSSTIFTLLSQLPFDIPTS 246

Query: 256 DILLKVHNEILSAVLVRNLTEEQALKLYHSLLVFFHRHEAESDGTACFLLCLALQRLPHS 315
               K  N     V +  ++E +  +L+  LL  F   +  +D +   +L + L  +   
Sbjct: 247 IDCFKWGNPYFKIVYLHGMSEAKRAQLFRELLPCFELMDLYTDDSLAEILVMILDAMSKD 306

Query: 316 VKAELGHAEEFLNAVTFRLTSQDAAIRERTMYIAKKITNDSFEYESDFTIETPHIKTPKS 375
            + EL H    LN VT RL S+D  +RERTM++AKK+TND  +YESDFTI+ P I+  K 
Sbjct: 307 SRDELSHDAISLNFVTKRLHSEDHLVRERTMFVAKKLTNDQLQYESDFTIDLPRIELIKL 366

Query: 376 SIIDFSTLQAVKPLHDHERNFKPSASLDNTMVRLSLSESETDENGVTLVFLKDLIREFEL 435
           S ++F   + ++ L              NT+      +   +E+   ++FLKDL+ EFE 
Sbjct: 367 SKLEFPIKEGLQNLPKGNSTKNELVQQFNTITLQDSDDESDEEDSRDILFLKDLLLEFEK 426

Query: 436 LSNQTASRLHLLKSTVRLIRQKKDFTLEISTYSPQLLAVITSLANNLEEPAFEEWRINAL 495
           +     S L LLK TV+L+RQKK+F  E+S YS +LL  I +++N  +E +FEEW+ NAL
Sbjct: 427 VIKNDGSELRLLKETVKLVRQKKNFPTEVSFYSKELLKKIATISNKFDEKSFEEWKANAL 486

Query: 496 VSILFAAPEKVIELIKILFGQELSLQQRMXXXXXXXXXXRELRGIDDSVIMKLQVDFPTK 555
           VSIL   P+K+++L  ILF  ELSLQQRM          RELRG DD  ++K + DFPT 
Sbjct: 487 VSILVVCPDKIVDLYAILFNNELSLQQRMVILTSAALSARELRGFDDEFVVKPKYDFPTN 546

Query: 556 RLPWDKGKPEGM-KNDKLSASVPTSKSLLQENXXXXXXXXXXXXXXDILSENRFRKVAAK 614
           RLPWD+   E   +N+K+      + S +                     +N FRK A  
Sbjct: 547 RLPWDESATEQQPENNKIQDITEITGSKVTWRSKRLETDSKITQ-----QQNNFRKYATL 601

Query: 615 FFFPLAHGWLNGINMGTYDLMFKKHYLTTMQMVLSAAYPHHEFNSMCQQMAIIVQDAIDQ 674
           FF+PLAH WLNGIN+G +D +FK+HY++ ++++L+ A PH+E   M   M  I+ DA+ Q
Sbjct: 602 FFYPLAHAWLNGINLGAFDKVFKRHYISMLKIILTCASPHYELEEMQILMQEILSDAVKQ 661

Query: 675 GVEV 678
            V+ 
Sbjct: 662 QVQT 665

>AAR090W [276] [Homologous to ScYGR099W (TEL2) - SH]
           complement(506082..508061) [1980 bp, 659 aa]
          Length = 659

 Score =  314 bits (804), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 211/670 (31%), Positives = 353/670 (52%), Gaps = 35/670 (5%)

Query: 15  ETLKTQPSAEVIQECLSVIQSQASLTVESAAVLARYVIPVYTSLPSASKMLLFTIFEESF 74
           + L+T  + EV+++ LS ++ Q+ +  E+A V+ + V+  Y SLPS  + +L  +  +S 
Sbjct: 4   QVLETTSNVEVMEQVLSELE-QSPMAPEAALVVLQRVVTAYESLPSRLQAMLRRLCGKSS 62

Query: 75  LLLGHVLNFIKLLQKSSEAKIYKRFLIEGLSHNHGCIYKYIRGAEHITELQMLRSAFFGS 134
           +L+  V+   + ++   EA IY+R L E L    G +   + G    T+ +++ + FFGS
Sbjct: 63  VLMSQVVVAAQQVRGRPEAGIYQRVLRETLEREPGALAHQLAGGGP-TQRRLVTALFFGS 121

Query: 135 KILNSVGDEIDIENYLDIVRAQFKFIFDQTPQFEDKVYADFLCAFISLHSLLAPEVVFGG 194
           ++ N +   +    Y+ ++  Q +  F++     +   A+ L A +  H   A + +   
Sbjct: 122 RVFNVLAHTLSAAAYVSLLTPQLQTWFEKGAGAPED--AEVLVALLRFHPTQAADALVD- 178

Query: 195 LVLSSEDHFSKFVQILRCASLLSQKKLVKALIFFLDSRVSQA-NTDSAFNIFQRVGVELL 253
           LVL  E  +  F +I      + Q++LV   +     R+ +A N  +A+++   +   L 
Sbjct: 179 LVLC-EVRWQIFCKICNQRVGVVQRQLVNGFLLRTLGRLVEASNVQAAYDLLLTLDYRLF 237

Query: 254 STDILLKVHNEILSAVLVRNLTEEQALKLYHSLLVFFHRHEAESDGTACFLLCLALQRLP 313
           +   L KV++  L + +V+ L E     L    L  F   + + D   C L  + + R+ 
Sbjct: 238 NLLELHKVNSVHLQSAIVQVLPESGCEALLKICLGMFGTPDTD-DEKRCNLFAILIARMA 296

Query: 314 HSVKAELGHAEEFLNAVTFRLTSQDAAIRERTMYIAKKITNDSFEYESDFTIETPHIKTP 373
                ++ H ++FL+AVTFRL S+D A+R+RTM IAK +  +S +YE+       HIK P
Sbjct: 297 GPELEKIVHDQQFLSAVTFRLASEDGAVRDRTMSIAKAVAGESLKYEAA------HIKLP 350

Query: 374 KSSIIDFSTLQAVKPLHDHERNFKPSASLDNTMVRLSLSE------------SETDENGV 421
              +    T+       +     + SA ++N+ V   L              S+ +  G 
Sbjct: 351 VPPLRPKGTI-----CFEEITTPRASAYVNNSAVEPQLGALTLEDSDDSDVDSDGERRGR 405

Query: 422 TLVFLKDLIREFELLSNQTASRLHLLKSTVRLIRQKKDFTLEISTYSPQLLAVITSLANN 481
            +VFLKDL+ E E         L LLK T++L+RQK+ F  E+S Y+P +L  + +++N+
Sbjct: 406 EIVFLKDLLVELEAPDLSERGPLRLLKLTIKLVRQKQAFVSEVSFYAPAMLTAVATISNS 465

Query: 482 LEEPAFEEWRINALVSILFAAPEKVIELIKILFGQELSLQQRMXXXXXXXXXXRELRGID 541
             E  FEE+RINALVS+L A PEKV +L+ +LF  +LSLQQRM          RELRG++
Sbjct: 466 QSEQDFEEYRINALVSLLVAVPEKVTDLLHLLFQADLSLQQRMAILSALALAARELRGLE 525

Query: 542 DSVIMKLQVDFPTKRLPWDKGKPEGMKNDKLSASVPTSKSLLQENXXXXXXXXXXXXXXD 601
           D  ++K   DFPT+RLP +      +++ +   S  +  ++   +              +
Sbjct: 526 DKYVLKPVFDFPTRRLPRNDAPSRALESRESGTS--SEGTISAHHTVWRSRKLDSAPAPE 583

Query: 602 ILSENRFRKVAAKFFFPLAHGWLNGINMGTYDLMFKKHYLTTMQMVLSAAYPHHEFNSMC 661
               N FRK A  FFFPLAH WLNGI++GT+D +FKKHYL+T++++L+AA PH EF+ M 
Sbjct: 584 --RPNAFRKHAPAFFFPLAHAWLNGIDLGTFDALFKKHYLSTLRLILAAANPHAEFDRMS 641

Query: 662 QQMAIIVQDA 671
           + M+ ++QDA
Sbjct: 642 ELMSYVLQDA 651

>CAGL0G07755g 736112..738169 similar to sp|P53038 Saccharomyces
           cerevisiae YGR099w TEL2 involved in controlling telomere
           length and position effect, hypothetical start
          Length = 685

 Score =  283 bits (725), Expect = 8e-86,   Method: Compositional matrix adjust.
 Identities = 212/677 (31%), Positives = 353/677 (52%), Gaps = 39/677 (5%)

Query: 24  EVIQECLSVIQSQASLT-VESAAVLARYVIPVYTSLPSASKMLLFTIFEESFLLLGHVLN 82
           E++    +V Q + SLT ++    + +YV+  +  +P +  + L   F  S +    ++ 
Sbjct: 19  ELVTTLDTVFQEKDSLTNIDVILTVIKYVVSHHQVMPKSVILKLNWFFAHSLIGFSQLIK 78

Query: 83  FIKLLQ-KSSEAKIYKRFLIEGLSHNHGCIYKY-IRGAEHITELQMLRSAFFGSKILNSV 140
           F   +  K SE  IY  ++ + L  +   +  Y I   E+ T+  +L+  F GS + N V
Sbjct: 79  FGSDIDAKQSEQLIYIEYVTQFLKSSTTYLQNYLIECTENRTKELILKRTFTGSTVFNFV 138

Query: 141 GDEIDIENYLDIVRAQFKFIFDQ----TPQFEDKVYADFLCAFISLHSLLAPEVVFGGLV 196
             +++   Y++++  Q  F  D+    +  F  K   + + +    H++ AP+V+     
Sbjct: 139 KGKLNPLEYIELLNNQLVFALDKLDSRSGDFH-KYLGNHIASLCDFHNIFAPDVILSKTF 197

Query: 197 LSSEDHFSKFVQILRCASLLSQKKL-VKALIFFLDSRVSQANTDSAFNIFQRVGV-ELLS 254
           L  ++        ++  S  ++ K+ +K L+ +LD   S  N     +I   +G+ +L+ 
Sbjct: 198 LIKQERLETLSLFMKKTSEYTRYKIGIKYLLPYLDKVCSDTNAQLVHHILGTLGIGKLIL 257

Query: 255 TDILLKVHNEILSAVLVRNLTEEQALKLYHSLLVFFHRHEAESDGTACFLLCLALQR-LP 313
              + ++++  L   ++  L  ++   +   LL+ FH  E ESD   C L+   L+  L 
Sbjct: 258 VQDIFRLNSFTLQKTILAILDSKKIDSVMDFLLMKFHSIEYESDNNTCQLIVTILKNHLN 317

Query: 314 HSVKAELGHAEEFLNAVTFRLTSQDAAIRERTMYIAKKITNDSFEYESDFTIET------ 367
            S K ++ H+++FLNA+T RL+ QD  IRER+MYIAK  +N   +YESDFTI+       
Sbjct: 318 DSGKIKVCHSDQFLNAITKRLSDQDKIIRERSMYIAKIASNHKIDYESDFTIDIGKSIAH 377

Query: 368 PHIKTPKSSIIDFSTL----QAVKPLHDHERNFKPSA-SLDNTMVRLSLSESETDENGVT 422
            + + P+S   D+S +     +    +  + N   S  +L+   +  S  E + + + + 
Sbjct: 378 ENYEVPES---DWSLILNSVNSNVNTNSSDTNISTSTHALEALNLDDSDDEEDEEGDQLK 434

Query: 423 LVFLKDLIREFELLSNQTASRLHLLKSTVRLIRQKKDFTLEISTYSPQLLAVITSLANNL 482
            VFLKDL    E  S +  +  ++LK+TV+L+RQKK F  E++ Y+  ++  I  L N+L
Sbjct: 435 YVFLKDLTAALENKSQRGLT--NILKNTVKLVRQKKLFRSEVAYYAGAMIRNIVILNNDL 492

Query: 483 EEPAFEEWRINALVSILFAAPEKVIELIKILFGQELSLQQRMXXXXXXXXXXRELRGIDD 542
           +E  FEE R+NALVSIL   PEK+ EL+K+LF  ELSLQQR+          RELRG DD
Sbjct: 493 DEKQFEELRVNALVSILVVVPEKIDELLKMLFTAELSLQQRLSLLLSVSMSARELRGYDD 552

Query: 543 SVIMKLQVDFPTKRLPWDKGKPEGM---KNDKLSASVPTSKSLLQENXXXXXXXXXXXXX 599
             I+K Q DFPT  LPWD+ +        +D  S +    K L + +             
Sbjct: 553 KQILKPQFDFPTSMLPWDRRQENNRIEEIDDNGSDNTSGGKVLWKSSKLTKNTEEI---- 608

Query: 600 XDILSENRFRKVAAKFFFPLAHGWLNGINMGTYDLMFKKHYLTTMQMVLSAAYPHHEFNS 659
                 NRFR+ A+KFF+PLA+GWLNGI++GT+D +FK +YL+T++ V + AY  H+F  
Sbjct: 609 -----NNRFREYASKFFYPLANGWLNGIDLGTFDKLFKTYYLSTLKTVYNCAYLVHDFED 663

Query: 660 MCQQMAIIVQDAIDQGV 676
           M   M  I+QDA++  +
Sbjct: 664 MTTTMDTILQDAVNNNI 680

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.322    0.135    0.378 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 19,331,531
Number of extensions: 766853
Number of successful extensions: 2247
Number of sequences better than 10.0: 14
Number of HSP's gapped: 2305
Number of HSP's successfully gapped: 14
Length of query: 681
Length of database: 16,596,109
Length adjustment: 108
Effective length of query: 573
Effective length of database: 12,857,365
Effective search space: 7367270145
Effective search space used: 7367270145
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 65 (29.6 bits)