Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_55.2030878784121e-54
Sklu_1837.2161742291e-25
KLLA0B13024g124562217e-25
CAGL0M04939g233572173e-23
ABL015C220552147e-23
YMR233W226722149e-23
CAGL0G07557g241551633e-15
YOR295W (UAF30)228741521e-13
Scas_665.2624940915e-05
YGR065C (VHT1)59359581.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_55.20308
         (78 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_55.20308                                                         163   1e-54
Sklu_1837.2 YMR233W, Contig c1837 1803-2288 reverse complement         93   1e-25
KLLA0B13024g complement(1138572..1138946) some similarities with...    90   7e-25
CAGL0M04939g 539988..540689 similar to sp|Q05024 Saccharomyces c...    88   3e-23
ABL015C [577] [Homologous to ScYMR233W (TRI1) - SH; ScYOR295W (U...    87   7e-23
YMR233W (YMR233W) [4189] chr13 (739184..739864) Protein containi...    87   9e-23
CAGL0G07557g 715354..716079 similar to tr|Q08747 Saccharomyces c...    67   3e-15
YOR295W (UAF30) [5079] chr15 (869205..869891) Component of the U...    63   1e-13
Scas_665.26                                                            40   5e-05
YGR065C (VHT1) [2027] chr7 complement(618079..619860) H+/biotin ...    27   1.5  

>Kwal_55.20308
          Length = 78

 Score =  163 bits (412), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 78/78 (100%), Positives = 78/78 (100%)

Query: 1  MARTQIVKKVWEHIKDNQLQNPDDRREIFCDDLMKPVFGEKTTMFALNKSLSNHILKEDE 60
          MARTQIVKKVWEHIKDNQLQNPDDRREIFCDDLMKPVFGEKTTMFALNKSLSNHILKEDE
Sbjct: 1  MARTQIVKKVWEHIKDNQLQNPDDRREIFCDDLMKPVFGEKTTMFALNKSLSNHILKEDE 60

Query: 61 TVQPSKTAEDSPTVDSSA 78
          TVQPSKTAEDSPTVDSSA
Sbjct: 61 TVQPSKTAEDSPTVDSSA 78

>Sklu_1837.2 YMR233W, Contig c1837 1803-2288 reverse complement
          Length = 161

 Score = 92.8 bits (229), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 56/74 (75%)

Query: 1   MARTQIVKKVWEHIKDNQLQNPDDRREIFCDDLMKPVFGEKTTMFALNKSLSNHILKEDE 60
           + RTQ+VKKVW++IK++ LQNP+DRREI CDD M+P+FG+K TMF++NK LS H+   ++
Sbjct: 68  LPRTQVVKKVWDYIKEHDLQNPNDRREILCDDAMEPIFGKKMTMFSMNKILSKHLFNPED 127

Query: 61  TVQPSKTAEDSPTV 74
            V  SK  E+   V
Sbjct: 128 VVNGSKEKEELQEV 141

>KLLA0B13024g complement(1138572..1138946) some similarities with
           sp|Q05024 Saccharomyces cerevisiae YMR233w, hypothetical
           start
          Length = 124

 Score = 89.7 bits (221), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 38/56 (67%), Positives = 46/56 (82%)

Query: 1   MARTQIVKKVWEHIKDNQLQNPDDRREIFCDDLMKPVFGEKTTMFALNKSLSNHIL 56
           M RTQ+VK VW++IK++ LQNP+DRREI CDD MKP+FGEK TMF LNK LS H+ 
Sbjct: 50  MPRTQVVKSVWDYIKEHDLQNPEDRREIICDDAMKPIFGEKMTMFTLNKILSKHLF 105

>CAGL0M04939g 539988..540689 similar to sp|Q05024 Saccharomyces
           cerevisiae YMR233w or tr|Q08747 Saccharomyces cerevisiae
           YOR295w, hypothetical start
          Length = 233

 Score = 88.2 bits (217), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 49/57 (85%)

Query: 1   MARTQIVKKVWEHIKDNQLQNPDDRREIFCDDLMKPVFGEKTTMFALNKSLSNHILK 57
           + RTQ+VK+VW++IK++ LQ+P+DRREI CDD M+P+FG+K TMFALNK LS H+ K
Sbjct: 154 LPRTQVVKQVWDYIKEHNLQSPEDRREIICDDRMRPIFGDKMTMFALNKILSKHLTK 210

>ABL015C [577] [Homologous to ScYMR233W (TRI1) - SH; ScYOR295W
           (UAF30) - SH] (371210..371872) [663 bp, 220 aa]
          Length = 220

 Score = 87.0 bits (214), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 46/55 (83%)

Query: 1   MARTQIVKKVWEHIKDNQLQNPDDRREIFCDDLMKPVFGEKTTMFALNKSLSNHI 55
           + RTQ+VK VW++IK +QLQNPDDRREI CD  M+PVFG+K TMF++NK LS H+
Sbjct: 142 LPRTQVVKAVWDYIKQHQLQNPDDRREILCDAAMEPVFGKKMTMFSMNKILSQHL 196

>YMR233W (YMR233W) [4189] chr13 (739184..739864) Protein containing
           a BAF60b domain of the SWIB complex, has moderate
           similarity to S. cerevisiae Uaf30p, which is a component
           of the Upstream Activation Factor (UAF) complex and is
           involved in activation of RNA polymerase I [681 bp, 226
           aa]
          Length = 226

 Score = 87.0 bits (214), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 35/72 (48%), Positives = 54/72 (75%)

Query: 1   MARTQIVKKVWEHIKDNQLQNPDDRREIFCDDLMKPVFGEKTTMFALNKSLSNHILKEDE 60
           + RTQ+VK +W++IK++ LQNP DRREI CD+ M+P+FG+K TMF++NK L+ H+   DE
Sbjct: 139 LPRTQVVKMIWQYIKEHDLQNPKDRREILCDEKMEPIFGKKMTMFSMNKLLTKHLFNPDE 198

Query: 61  TVQPSKTAEDSP 72
            V+  +  + +P
Sbjct: 199 IVKHEEEQKQTP 210

>CAGL0G07557g 715354..716079 similar to tr|Q08747 Saccharomyces
           cerevisiae YOR295w, hypothetical start
          Length = 241

 Score = 67.4 bits (163), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 45/55 (81%)

Query: 2   ARTQIVKKVWEHIKDNQLQNPDDRREIFCDDLMKPVFGEKTTMFALNKSLSNHIL 56
           +RT+IV+ +W++IK++ LQNPDD+R+I  D +++PV G+ + +F ++++L +HIL
Sbjct: 144 SRTEIVRNLWKYIKEHNLQNPDDKRQIISDAMLEPVLGKTSDIFMMHRALKHHIL 198

>YOR295W (UAF30) [5079] chr15 (869205..869891) Component of the
           Upstream Activation Factor (UAF) complex, involved in
           activation of RNA polymerase I [687 bp, 228 aa]
          Length = 228

 Score = 63.2 bits (152), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 50/74 (67%), Gaps = 6/74 (8%)

Query: 1   MARTQIVKKVWEHIKDNQLQNPDDRREIFCDDLMKPVFGEKTTMFALNKSLSNHILKEDE 60
           + RT++V+++W +IK + LQNP++++EI CD+ ++ + G+ T MF ++K L++H+     
Sbjct: 139 LTRTEVVRRLWAYIKAHNLQNPNNKKEILCDEKLELILGKSTNMFEMHKILASHM----- 193

Query: 61  TVQPSKTAEDSPTV 74
             +P K ++  P +
Sbjct: 194 -TEPKKISDCPPLI 206

>Scas_665.26
          Length = 249

 Score = 39.7 bits (91), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 29/40 (72%)

Query: 1   MARTQIVKKVWEHIKDNQLQNPDDRREIFCDDLMKPVFGE 40
           + +++I+ ++W++I+ ++L+  ++  EI CDD +  VFGE
Sbjct: 138 LTKSEIMNRIWDYIELHKLKRSNNSEEILCDDKLGLVFGE 177

>YGR065C (VHT1) [2027] chr7 complement(618079..619860) H+/biotin
          symporter, member of the allantoate permease family of
          the major facilitator superfamily (MFS) [1782 bp, 593
          aa]
          Length = 593

 Score = 26.9 bits (58), Expect = 1.5,   Method: Composition-based stats.
 Identities = 13/59 (22%), Positives = 26/59 (44%)

Query: 6  IVKKVWEHIKDNQLQNPDDRREIFCDDLMKPVFGEKTTMFALNKSLSNHILKEDETVQP 64
          I  K W     +  + P+D + ++ DD    +  E+    +++KS    +  E   V+P
Sbjct: 3  ISNKSWRSYFPHLRKLPEDDQYLYSDDTNSSIIAEEELHHSVDKSSKTDVTAETTAVEP 61

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.312    0.127    0.362 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 2,742,904
Number of extensions: 99576
Number of successful extensions: 250
Number of sequences better than 10.0: 16
Number of HSP's gapped: 250
Number of HSP's successfully gapped: 16
Length of query: 78
Length of database: 16,596,109
Length adjustment: 50
Effective length of query: 28
Effective length of database: 14,865,209
Effective search space: 416225852
Effective search space used: 416225852
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 54 (25.4 bits)