Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_55.2000061760231760.0
Sklu_1676.265062015840.0
AER391C63261413091e-174
YDR266C63960811881e-156
KLLA0E16698g65655811381e-148
CAGL0M08668g65762411231e-146
Scas_699.3861265010541e-136
Scas_615.1267462810301e-132
AAR147W158066840.061
Kwal_47.1771963587780.23
AGL289C24150750.32
Scas_672.226350730.77
CAGL0J03586g41194730.85
Scas_573.9150241740.94
Kwal_27.1072322945710.99
CAGL0B05049g147041731.1
CAGL0G03553g21045701.3
Scas_705.4142868711.5
Scas_656.3674131711.5
Scas_615.1333046701.6
YCR066W (RAD18)48743701.9
CAGL0L03960g60355702.3
KLLA0D10758g85033702.5
YMR318C (ADH6)36043692.7
YMR053C (STB2)85057675.1
AFR212W62687675.3
KLLA0F23892g51888675.3
Scas_720.8946950665.6
CAGL0E06666g142060666.3
KLLA0C08041g57456666.4
CAGL0G09493g140862667.4
KLLA0C18260g22945647.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_55.20000
         (608 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_55.20000                                                        1228   0.0  
Sklu_1676.2 YDR266C, Contig c1676 743-2695                            614   0.0  
AER391C [2891] [Homologous to ScYDR266C - SH] (1371409..1373307)...   508   e-174
YDR266C (YDR266C) [1099] chr4 complement(1000096..1002015) Prote...   462   e-156
KLLA0E16698g 1479322..1481292 weakly similar to sgd|S0002674 Sac...   442   e-148
CAGL0M08668g 862981..864954 similar to tr|Q05580 Saccharomyces c...   437   e-146
Scas_699.38                                                           410   e-136
Scas_615.12                                                           401   e-132
AAR147W [335] [Homologous to ScYOR191W (RIS1) - SH] complement(6...    37   0.061
Kwal_47.17719                                                          35   0.23 
AGL289C [4023] [Homologous to ScYER116C (SLX8) - SH] (164204..16...    33   0.32 
Scas_672.2                                                             33   0.77 
CAGL0J03586g complement(341290..342525) similar to sp|P10862 Sac...    33   0.85 
Scas_573.9                                                             33   0.94 
Kwal_27.10723                                                          32   0.99 
CAGL0B05049g 487186..491598 some similarities with tr|Q06554 Sac...    33   1.1  
CAGL0G03553g complement(345057..345689) weakly similar to sp|P40...    32   1.3  
Scas_705.41                                                            32   1.5  
Scas_656.3                                                             32   1.5  
Scas_615.13                                                            32   1.6  
YCR066W (RAD18) [592] chr3 (231495..232958) Multifunctional DNA ...    32   1.9  
CAGL0L03960g complement(461754..463565) similar to sp|P53924 Sac...    32   2.3  
KLLA0D10758g 917125..919677 similar to sp|P47156 Saccharomyces c...    32   2.5  
YMR318C (ADH6) [4272] chr13 complement(911059..912141) NADPH-dep...    31   2.7  
YMR053C (STB2) [4013] chr13 complement(380345..382897) Protein o...    30   5.1  
AFR212W [3404] [Homologous to ScYMR119W (ASI1) - SH; ScYNL008C (...    30   5.3  
KLLA0F23892g complement(2229493..2231049) some similarities with...    30   5.3  
Scas_720.89                                                            30   5.6  
CAGL0E06666g complement(670193..674455) some similarities with s...    30   6.3  
KLLA0C08041g complement(705516..707240) gi|24741192|emb|CAD56154...    30   6.4  
CAGL0G09493g complement(902228..906454) similar to tr|Q08562 Sac...    30   7.4  
KLLA0C18260g 1613311..1614000 similar to sp|P53769 Saccharomyces...    29   7.5  

>Kwal_55.20000
          Length = 617

 Score = 1228 bits (3176), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 589/602 (97%), Positives = 589/602 (97%)

Query: 1   MSAKPEQKRSFRRTQGTQSRPRKESGKNTESSWKRTFNQGTEGENELDEDDICIICAEKL 60
           MSAKPEQKRSFRRTQGTQSRPRKESGKNTESSWKRTFNQGTEGENELDEDDICIICAEKL
Sbjct: 1   MSAKPEQKRSFRRTQGTQSRPRKESGKNTESSWKRTFNQGTEGENELDEDDICIICAEKL 60

Query: 61  TYVTLSPCNHVTCNRCTFRQRALYNKKSCLVCRTESDLVIFSADRNAVFDDFDEKNLVET 120
           TYVTLSPCNHVTCNRCTFRQRALYNKKSCLVCRTESDLVIFSADRNAVFDDFDEKNLVET
Sbjct: 61  TYVTLSPCNHVTCNRCTFRQRALYNKKSCLVCRTESDLVIFSADRNAVFDDFDEKNLVET 120

Query: 121 NVDLGVSFTSQDVASKTLGLLIYSCPFGDTGGTNHENFKKYNAHLKNEHNKTLCMICASH 180
           NVDLGVSFTSQDVASKTLGLLIYSCPFGDTGGTNHENFKKYNAHLKNEHNKTLCMICASH
Sbjct: 121 NVDLGVSFTSQDVASKTLGLLIYSCPFGDTGGTNHENFKKYNAHLKNEHNKTLCMICASH 180

Query: 181 KKAFPSELRIYTPSQLRIHQSKGDSEGFKGHPMCGFCSGQRFYSDDELNVHMRDRHEKCH 240
           KKAFPSELRIYTPSQLRIHQSKGDSEGFKGHPMCGFCSGQRFYSDDELNVHMRDRHEKCH
Sbjct: 181 KKAFPSELRIYTPSQLRIHQSKGDSEGFKGHPMCGFCSGQRFYSDDELNVHMRDRHEKCH 240

Query: 241 ICDQTNINSPQYFKDYDQLFEHFKFDHYVCGVQSCLDSKFVVFRDDLDLQAHILKEHGGI 300
           ICDQTNINSPQYFKDYDQLFEHFKFDHYVCGVQSCLDSKFVVFRDDLDLQAHILKEHGGI
Sbjct: 241 ICDQTNINSPQYFKDYDQLFEHFKFDHYVCGVQSCLDSKFVVFRDDLDLQAHILKEHGGI 300

Query: 301 LRNGNNNLSMKGGRKYQSQLXXXXXXXXXXXXXQDVRDNTAKNNSSENSLEVKRLRMEER 360
           LRNGNNNLSMKGGRKYQSQL             QDVRDNTAKNNSSENSLEVKRLRMEER
Sbjct: 301 LRNGNNNLSMKGGRKYQSQLSTFSRPPSRSSSTQDVRDNTAKNNSSENSLEVKRLRMEER 360

Query: 361 ARHYLKYSHTDFEQFLAINSSYQNGLITAQDVLSAYEGLFKSPEAQVGLLLYDFSELFPQ 420
           ARHYLKYSHTDFEQFLAINSSYQNGLITAQDVLSAYEGLFKSPEAQVGLLLYDFSELFPQ
Sbjct: 361 ARHYLKYSHTDFEQFLAINSSYQNGLITAQDVLSAYEGLFKSPEAQVGLLLYDFSELFPQ 420

Query: 421 SSKLHQDLRVIYDTVQKKENRHTNFPSLSALNPTLLPGSVASGSWGRSTGSNKAARQYNF 480
           SSKLHQDLRVIYDTVQKKENRHTNFPSLSALNPTLLPGSVASGSWGRSTGSNKAARQYNF
Sbjct: 421 SSKLHQDLRVIYDTVQKKENRHTNFPSLSALNPTLLPGSVASGSWGRSTGSNKAARQYNF 480

Query: 481 PSLKKPASPQPPIITKKPSSTKVNNVQPKAKAVPVTRKPSSNESSFKPTYLDGKQKSASS 540
           PSLKKPASPQPPIITKKPSSTKVNNVQPKAKAVPVTRKPSSNESSFKPTYLDGKQKSASS
Sbjct: 481 PSLKKPASPQPPIITKKPSSTKVNNVQPKAKAVPVTRKPSSNESSFKPTYLDGKQKSASS 540

Query: 541 SPALDREKFPPLPKSQARKFRAPLVNEASIPNPSQWGKSSNESTGGLRMQSSNSTQELIS 600
           SPALDREKFPPLPKSQARKFRAPLVNEASIPNPSQWGKSSNESTGGLRMQSSNSTQELIS
Sbjct: 541 SPALDREKFPPLPKSQARKFRAPLVNEASIPNPSQWGKSSNESTGGLRMQSSNSTQELIS 600

Query: 601 SG 602
           SG
Sbjct: 601 SG 602

>Sklu_1676.2 YDR266C, Contig c1676 743-2695
          Length = 650

 Score =  614 bits (1584), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/620 (52%), Positives = 415/620 (66%), Gaps = 51/620 (8%)

Query: 1   MSAKPEQK--RSFRRTQGTQSRPRKESGKNTESS---WKRTF--------NQGTEGENEL 47
           MS K +QK  R+FRRTQ +Q+ PRK    ++ S+   WKR F        NQ +   + L
Sbjct: 1   MSTKLQQKQQRNFRRTQDSQA-PRKSDTNSSRSNGGKWKRAFADENLSSLNQTSSPGDNL 59

Query: 48  DEDD--ICIICAEKLTYVTLSPCNHVTCNRCTFRQRALYNKKSCLVCRTESDLVIFSADR 105
           +EDD  ICIICA    Y+ LS C+H TC++CTFRQRALY KK CL+CRTE++ +IF+   
Sbjct: 60  EEDDGEICIICANPRKYIALSACSHTTCHKCTFRQRALYGKKGCLICRTENEQLIFTDKF 119

Query: 106 NAVFDDFDEKNLVETNVDLGVSFTSQDVASKTLGLLIYSCPFGDTGGTNHENFKKYNAHL 165
           +  F DF  ++  +T+ + G++FTS+ V + TL LL Y+CPFGD    + E+FKKYN HL
Sbjct: 120 DHQFADFTPRDFAKTSEEYGIAFTSEAVYTATLQLLKYNCPFGDVADKDFESFKKYNEHL 179

Query: 166 KNEHNKTLCMICASHKKAFPSELRIYTPSQLRIHQSKGDSEGFKGHPMCGFCSGQRFYSD 225
           K  HNKT+CMICA++KKAFPSEL+I+TP+QLR HQS+GDS GFKGHPMCGFC+GQRFYSD
Sbjct: 180 KTSHNKTICMICANNKKAFPSELKIFTPNQLRNHQSRGDSHGFKGHPMCGFCTGQRFYSD 239

Query: 226 DELNVHMRDRHEKCHICDQTNINSPQYFKDYDQLFEHFKFDHYVCGVQSCLDSKFVVFRD 285
           DEL VHMRDRHE+CHICDQ +  +PQYFK+YDQLFEHF+  HYVC VQ+CL+SKFVVFRD
Sbjct: 240 DELYVHMRDRHERCHICDQIDSTNPQYFKNYDQLFEHFRNSHYVCTVQTCLESKFVVFRD 299

Query: 286 DLDLQAHILKEHGGILRNGNNNLSMKGGRKYQSQLXXXXXXXXXXXXXQDVRDN------ 339
           D+DLQAHILKEH  IL N   N+ +  GR++QS+L             +D  D       
Sbjct: 300 DIDLQAHILKEHRTILANDKGNIPV-AGRRFQSELSTFSATPARAVHERDTFDTPALRSS 358

Query: 340 ----TAKNNSSENSLEVKRLRMEERARHYLKYSHTDFEQFLAINSSYQNGLITAQDVLSA 395
               +A   +S +S EVKR+RMEERARHYL YS  +FE FLAIN  Y+   ++A+DV +A
Sbjct: 359 SAARSANTTNSNSSPEVKRMRMEERARHYLNYSQPEFEAFLAINEDYRKNTLSAEDVFTA 418

Query: 396 YEGLFKSPEAQVGLLLYDFSELFPQSSKLHQDLRVIYDTVQKKENRHTNFPSLSALNPTL 455
           Y+ LF SP A V LL+YDFS +FPQ+S  H+DL  IY+  QKK N   NFPSL+      
Sbjct: 419 YQKLFNSPSADVPLLIYDFSGMFPQNSAKHKDLFAIYEAEQKKNNHQINFPSLAP----- 473

Query: 456 LPGSVASGS----------WGRSTGSNKAARQYNFPSLKKPASPQPPIITKKPSSTKVNN 505
            P SVA+ +             S  S+K++ +YNFP+L KP + QP    KK S   +N 
Sbjct: 474 -PSSVAAANVIGGSWGRSSSPSSASSSKSSGRYNFPALSKPVNSQPLFTPKKASFKSLNT 532

Query: 506 VQPKAKAVPVTRKPSSNE-SSFKPTYLDGK----QKSASSSPALDREKFPPLPKSQARKF 560
                +  PV +K S+N  +++ PTYL  K       +SSS ++  EKFPPLPK+Q +KF
Sbjct: 533 ---NVRTAPVVKKASANNGTNYTPTYLQNKSTSSGSLSSSSASISEEKFPPLPKAQKKKF 589

Query: 561 RAPLVNEASIPNPSQWGKSS 580
           RAPLVNE +IPNP QWG SS
Sbjct: 590 RAPLVNEPNIPNPQQWGVSS 609

>AER391C [2891] [Homologous to ScYDR266C - SH] (1371409..1373307)
           [1899 bp, 632 aa]
          Length = 632

 Score =  508 bits (1309), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 272/614 (44%), Positives = 366/614 (59%), Gaps = 65/614 (10%)

Query: 9   RSFRRTQGTQSRPRKESGK----NTESSWKRTFNQGTE------------GENELDEDDI 52
           R+FRRTQG + +  +        N    W+++    +             G+ E D  ++
Sbjct: 6   RNFRRTQGRKPQTAQTQADSADWNGSGRWRKSSGYASGGGSSAGPPHSPCGDTEEDNGEM 65

Query: 53  -CIICAEKLTYVTLSPCNHVTCNRCTFRQRALYNKKSCLVCRTESDLVIFSADRNAVFDD 111
            C+ICA+ L YV LSPCNH TC++C FRQRALY KK+CLVCRTE + +IF+    A    
Sbjct: 66  TCLICADTLRYVALSPCNHTTCHKCAFRQRALYEKKACLVCRTEHEYLIFTDQIKAEHAR 125

Query: 112 FDEKNLVETNVDLGVSFTSQDVASKTLGLLIYSCPFGDTGGTNHENFKKYNAHLKNEHNK 171
           F  +++V  +   G+ FTS +  S TL LL Y+CP+GD    + ++FK YN HLKNEH +
Sbjct: 126 FGPRDIVAVDDRYGIQFTSLNAESVTLSLLKYNCPYGDVPEFDLDSFKNYNEHLKNEHKR 185

Query: 172 TLCMICASHKKAFPSELRIYTPSQLRIHQSKGDSEGFKGHPMCGFCSGQRFYSDDELNVH 231
           ++C ICA H+K FP+E++  TP+QL+IH + GDS+GF GHP+CGFCSG+RFYSDDEL +H
Sbjct: 186 SICTICARHRKQFPAEMKTLTPNQLKIHNTIGDSKGFTGHPLCGFCSGKRFYSDDELYIH 245

Query: 232 MRDRHEKCHICDQTNINSPQYFKDYDQLFEHFKFDHYVCGVQSCLDSKFVVFRDDLDLQA 291
           MR+RHEKCHICDQ +   PQYFKDYDQLFEHFK  HY+C V+SCLDSKFVVF DDLDLQA
Sbjct: 246 MRERHEKCHICDQVDSTQPQYFKDYDQLFEHFKHSHYICAVRSCLDSKFVVFADDLDLQA 305

Query: 292 HILKEHGGILRNGNNNLSMKGGRKYQSQLXXXXXXXXXXXXXQDVRDN------TAKNNS 345
           H+LKEH  I+ N  + +S+  GR+Y+S+L             +    N      +    +
Sbjct: 306 HMLKEHPNIMGN-KSTISLTAGRRYRSELSSGFTPNVSRAVHETSSSNALALGPSVSPVA 364

Query: 346 SENSLEVKRLRMEERARHYLKYSHTDFEQFLAINSSYQNGLITAQDVLSAYEGLFKSPEA 405
           +  S E+KR R+EERARHYL YS ++ + F  IN+ Y N +I+A  V   Y+ LF++PEA
Sbjct: 365 TAESPEMKRKRLEERARHYLNYSQSEMKLFEQINNDYNNNVISATSVQRRYDQLFRNPEA 424

Query: 406 QVGLLLYDFSELFPQSSKLHQDLRVIYDTVQKKENRHTNFPSLSALNPTLLPGSVASGSW 465
              LLL +F++ FP+ S  +++L  IY   Q+K  R   FPSLS  NP      V   +W
Sbjct: 425 DTHLLLRNFADTFPEGSLKYKELNAIYQAEQEKRERQAKFPSLST-NP-WYSAPVVGAAW 482

Query: 466 GRSTGSNKAARQYNFPSLKKP-------ASPQP-------PIITKKPSSTKVNNVQPKAK 511
           G++ G + ++R  NFPSL           +PQP       P      SST+V N +    
Sbjct: 483 GKNGGKSSSSR--NFPSLSSALTDSYQNVTPQPKKPVPYRPTSPVASSSTQVQNTK---- 536

Query: 512 AVPVTRKPSSNESSFKPTYLDGKQKS---ASSSPALDREKFPPLPKSQARKFRAPLVNEA 568
                       S++ PTYL  K K    A S+ AL    FPPL     +KFRAP VNE 
Sbjct: 537 ----------RNSNYTPTYLKSKTKGESRAQSNAAL----FPPLSSPDTKKFRAPPVNE- 581

Query: 569 SIPNPSQWGKSSNE 582
            +P+P QWGKS  E
Sbjct: 582 -LPDPKQWGKSKRE 594

>YDR266C (YDR266C) [1099] chr4 complement(1000096..1002015) Protein
           of unknown function, contains a RING finger domain [1920
           bp, 639 aa]
          Length = 639

 Score =  462 bits (1188), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 265/608 (43%), Positives = 373/608 (61%), Gaps = 53/608 (8%)

Query: 9   RSFRRTQGTQ--SRP-------RKESGKNTESSWKRTFNQGTEGENELDED-DICIICAE 58
           R+FRRTQG Q  ++P       R++  KN  S+     N  T   ++ DE+ ++C+ICA 
Sbjct: 13  RNFRRTQGPQNNTKPHNDRKNFRRKQKKNNLSAEP---NLTTSSADDTDEENELCVICAR 69

Query: 59  KLTYVTLSPCNHVTCNRCTFRQRALYNKKSCLVCRTESDLVIFSADRNAVFDDFDEKNLV 118
           KLTYV+L+PC+H TC+ C FRQRALYNKKSCL+CRTE++ V+F+   +   D  D+ N  
Sbjct: 70  KLTYVSLTPCHHKTCHICGFRQRALYNKKSCLICRTENEEVMFTDRIDG--DISDKYNFC 127

Query: 119 ETNVDLGVSFTSQDVASKTLGLLIYSCPFG-DTGGTNHENFKKYNAHLKNEHNKTLCMIC 177
           E N   G++FTS++VA++TL LL + CP   D    +  +FKKYN HLK+EHN+ +C+IC
Sbjct: 128 EKNEKYGINFTSEEVATETLNLLKFFCPLSKDEQVCDFGSFKKYNEHLKSEHNRMICLIC 187

Query: 178 ASHKKAFPSELRIYTPSQLRIHQSKGDSEGFKGHPMCGFCSGQRFYSDDELNVHMRDRHE 237
           A+HK AFP EL I+T +QLR HQ+KG+SEGFKGHPMC FCSG+RFYSDDEL +HMR++HE
Sbjct: 188 ATHKHAFPCELEIFTQNQLRNHQTKGNSEGFKGHPMCAFCSGKRFYSDDELYIHMRNQHE 247

Query: 238 KCHICDQTNINSPQYFKDYDQLFEHFKFDHYVCGVQSCLDSKFVVFRDDLDLQAHILKEH 297
           KCHICD+ N  SPQYFKDY+QLF+HFK  HYVC VQ+CLD+KFVVF+D+L+LQAHIL+EH
Sbjct: 248 KCHICDKMNPASPQYFKDYNQLFDHFKHSHYVCTVQTCLDNKFVVFKDELELQAHILQEH 307

Query: 298 GGILRNGNNNLSMKGGRK-YQSQLXXXXXXXXXXXXXQDVRD------------NTAKNN 344
           G IL         KG  K +QS+L             +D  D             +  + 
Sbjct: 308 GNIL---------KGKPKFFQSELSTFISAPSRVIRERDDYDLPSISSLPGSSSGSRTDV 358

Query: 345 SSENSLEVKRLRMEERARHYLKYSHTDFEQFLAINSSYQNGLITAQDVLSAYEGLFKSPE 404
            S +S E  RLR+ ERA++YL+ S  DF +F + N  Y  G ++A+ +L +Y+ LF  P 
Sbjct: 359 RSASSPEESRLRLAERAKYYLENSKEDFNKFSSYNEDYSKGRLSAEKLLESYKLLFTKPN 418

Query: 405 AQVGLLLYDFSELFPQSSKLHQDLRVIYDTVQKKENRHTNFPSLSALNPTLLPGSVASGS 464
           A V LL+++ +E FP++S  + +L  IY+  ++   R T+    S  + + L  S+  G 
Sbjct: 419 ADVYLLIHNLAETFPKNSSKYNNLNAIYEQREQTLARQTS--LPSLSSDSSLSMSIGRGH 476

Query: 465 W-----GRSTGSNKAARQY-NFPSLKKPASPQPPIIT--KKPSSTKVNNVQPKAKAVPVT 516
           W     G S G+    R   N P+LK P++   P  T  KK +   V N++ +     V+
Sbjct: 477 WGGTNDGGSAGAALGVRNIKNLPTLKSPSASYDPFATTVKKNTLRPVQNIK-RTTPQSVS 535

Query: 517 RKPSSNESSFKPTYLDGKQKSASSSPALDREKFPPL----PKSQARKFRAPLVNEASIPN 572
            + S+N  +F PTYL+ K+ S+S+S    ++K   L          K + P +N   I +
Sbjct: 536 YRTSTNTVAFSPTYLESKKGSSSTSLNNSKDKLKSLNLPQLPPPKPKVQIPGLNRPQIAD 595

Query: 573 PSQWGKSS 580
           P QWGK S
Sbjct: 596 PKQWGKKS 603

>KLLA0E16698g 1479322..1481292 weakly similar to sgd|S0002674
           Saccharomyces cerevisiae YDR266c, start by similarity
          Length = 656

 Score =  442 bits (1138), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 244/558 (43%), Positives = 336/558 (60%), Gaps = 31/558 (5%)

Query: 43  GENELDEDDICIICAEKLTYVTLSPCNHVTCNRCTFRQRALYNKKSCLVCRTESDLVIFS 102
           G ++ D  ++C+ICAEKL  + LSPCNH TC++C  RQRALY KK CL CR+E + +IF+
Sbjct: 79  GTDDDDSSNVCLICAEKLHIIALSPCNHPTCHKCCLRQRALYEKKQCLFCRSEVEDIIFT 138

Query: 103 ADRNAVFDDFDEKNLVE-TNVDLGVSFTSQDVASKTLGLLIYSCPFGDTGGTNHENFKKY 161
                 ++  D+K  +E  N  LG+ FTS++V +  + LL Y  PFGD    +  +FKK 
Sbjct: 139 DKIKETYEHLDKKAKLEFKNEKLGIRFTSKNVMNDAMNLLKYVSPFGD-ANKDFGSFKKL 197

Query: 162 NAHLKNEHNKTLCMICASHKKAFPSELRIYTPSQLRIHQSKGD-SEGFKGHPMCGFCSGQ 220
           N  L+ EHNKT+CMICA HKKAFP EL++ T  QL+IH+S+GD  +GFKGHPMCGFCSG+
Sbjct: 198 NEFLRQEHNKTICMICAGHKKAFPGELKVMTVKQLKIHESRGDPKDGFKGHPMCGFCSGK 257

Query: 221 RFYSDDELNVHMRDRHEKCHICDQTNINSPQYFKDYDQLFEHFKFDHYVCGVQSCLDSKF 280
           RFYSDDEL  HM+  HE+CHICDQ + + PQYFK+Y+ LFEHFK  HYVC V SCLD+KF
Sbjct: 258 RFYSDDELYKHMKLSHERCHICDQLDPSQPQYFKNYEDLFEHFKSAHYVCTVPSCLDAKF 317

Query: 281 VVFRDDLDLQAHILKEHGGILRNGNNNLSM--KGGRKYQSQLXXXXXXXXXXXXXQDVRD 338
           VVF D+LDL+AHI+KEH  +  +    +++     +K++SQ+               + D
Sbjct: 318 VVFSDELDLRAHIIKEHPHLAGDSRRAMTLIDNTSKKFRSQITTFSNPTR-------IID 370

Query: 339 NTAKNNSSENSLEVKRLRMEERARHYLKYSHTDFEQFLAINSSYQNGLITAQDVLSAYEG 398
              + ++S NS +VKR RME+RARHYL  S  DF+ FL IN  +    I+AQ++ S YE 
Sbjct: 371 AQNEESNSANSRDVKRRRMEQRARHYLGNSEPDFQSFLIINDLFNKNEISAQELQSKYED 430

Query: 399 LFKSPEAQVGLLLYDFSELFPQSSKLHQDLRVIYDTVQKKENRHTNFPSLSALNPTLLPG 458
           LFK     + LL+YD SEL+  +S  H+ LR IY+ + KK+     F  L A + + +  
Sbjct: 431 LFKQHADDIQLLIYDLSELYHSTSDKHKRLRAIYEGIMKKKENAGKFKPLVADSSSSV-- 488

Query: 459 SVASGSWGRSTGSNKAARQYNFPSLKKPASPQPPIITKKPSSTKVNNVQPKAKAVPVTRK 518
           +V  G WG+ + S        F SL  PA  + PI + K S T +      + + PV R 
Sbjct: 489 NVVYGKWGKKSSSGVGGSNVKFTSL--PAVSE-PIFSSKASYTNLRKNGSSSPSSPVIRS 545

Query: 519 PSSNESSFKPTYLDGKQKSA---------SSSPALDREKFP---PLPKSQA--RKFRAPL 564
             ++ SS   +    K+  +         +S P +   K P     PK QA  +KF AP 
Sbjct: 546 GLTSNSSSSTSLNYAKKNQSPPGSSTVVVNSQPNVTAIKSPNPTSFPKLQATKKKFVAPP 605

Query: 565 VNEASIPNPSQWGKSSNE 582
           V + +IPNPS WGK  N+
Sbjct: 606 VKQTTIPNPSTWGKPQND 623

>CAGL0M08668g 862981..864954 similar to tr|Q05580 Saccharomyces
           cerevisiae YDR266c, start by similarity
          Length = 657

 Score =  437 bits (1123), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 250/624 (40%), Positives = 352/624 (56%), Gaps = 65/624 (10%)

Query: 3   AKPEQKRSFRRTQGTQSRPRKESG----------------KNTESSWKRTFNQGTEGENE 46
           +KP + R+FRRTQ T  R   ESG                K  +S  K    +  E  N 
Sbjct: 10  SKP-KNRNFRRTQ-TGGRSNGESGNGRKAKKITGNPDFLQKEIKSGKKSNIEKKVEEFNA 67

Query: 47  LDEDD---ICIICAEKLTYVTLSPCNHVTCNRCTFRQRALYNKKSCLVCRTESDLVIFSA 103
            +EDD   +CIICA  L Y +LSPCNH TC+ C+FRQRALY KKSCL+CRTE+D + F+ 
Sbjct: 68  REEDDDTELCIICARVLVYASLSPCNHTTCHVCSFRQRALYEKKSCLICRTENDRLTFTD 127

Query: 104 DRNAVFDDFDEKNLVETNVDLGVSFTSQDVASKTLGLLIYSCPF-GDTGGTNHENFKKYN 162
           + +A + +    +   ++   G+ FTS +V + TL LL Y+CP   D        +KKYN
Sbjct: 128 NIDAQYSEI--TDFSGSDDKFGIDFTSDEVKNATLDLLKYACPLCPDNEQHVSTTYKKYN 185

Query: 163 AHLKNEHNKTLCMICASHKKAFPSELRIYTPSQLRIHQSKGDSEGFKGHPMCGFCSGQRF 222
            HLK+ HN+ +C+ICA +K +FP E++IYT +QL+ H S+GDSEGFKGHPMC FC+G+RF
Sbjct: 186 EHLKSAHNRMICLICAGNKHSFPREMKIYTANQLKNHHSRGDSEGFKGHPMCAFCTGKRF 245

Query: 223 YSDDELNVHMRDRHEKCHICDQTNINSPQYFKDYDQLFEHFKFDHYVCGVQSCLDSKFVV 282
           YSDDEL +HMR+ HEKCHICD+ +   PQYFKDY+QLFEHF+  HYVC VQSCLD KFVV
Sbjct: 246 YSDDELYIHMRNDHEKCHICDRIDHTQPQYFKDYEQLFEHFRTSHYVCTVQSCLDDKFVV 305

Query: 283 FRDDLDLQAHILKEHGGILRNGNNNLSMKGGRKYQSQLXXXXXXXXXXXXXQDVRD---- 338
           F+DD++LQAHILKEHG ILR           + +QS+L             +D  +    
Sbjct: 306 FKDDMELQAHILKEHGDILRG--------KPKFFQSELSTFISAPSQVIRERDSYNYDMG 357

Query: 339 NTAKNNSSENS-LEVKRLRMEERARHYLKYSHTDFEQFLAINSSYQNGLITAQDVLSAYE 397
           +   +N  E+S  EV RLRM ERA+HYL  S   F++F  +N +Y + ++TA  ++  Y+
Sbjct: 358 SVGSSNIEESSNPEVNRLRMNERAKHYLNSSLEGFQKFETLNENYDSSVLTASQLVQEYK 417

Query: 398 GLFKSPEAQVGLLLYDFSELFPQSSKLHQDLRVIYDTVQKKENRHTNFPSLSALNPTLLP 457
            LF    A + LL+++ S L+P++SK  +DL VIY   ++ E R    PSL   +   +P
Sbjct: 418 KLFTDTHADIYLLVHNLSALYPKNSKKFKDLDVIYQEYEQTEKRKNALPSLLDDHIQTVP 477

Query: 458 GSVASGSWGRSTGSNKAARQY----NFPSLKKPASPQPPIITKKPSSTKVNNVQPKAKAV 513
           G    G+WG STG +K+          PSL   +S   P      +       Q     V
Sbjct: 478 G----GAWGSSTGRSKSHSSIKNLNQLPSLGGVSSSFDPFKNPNKAPVYKGLRQSPKPVV 533

Query: 514 PVTRKPSSNESSFKPTY-----LDGKQKSASSSPALDRE--------------KFPPLPK 554
             T++ +    S +PT       +G   + +++P+   +                P LP 
Sbjct: 534 SATQRQTPMRISARPTASNRVEFNGGSTTKAATPSWGSQPSSNSSSKNKLADLNLPTLPA 593

Query: 555 SQARKFRAPLVNEASIPNPSQWGK 578
            + + +  P V+E  IP+P +WG+
Sbjct: 594 PKPKVYIPP-VHEPVIPDPKKWGQ 616

>Scas_699.38
          Length = 612

 Score =  410 bits (1054), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 247/650 (38%), Positives = 367/650 (56%), Gaps = 100/650 (15%)

Query: 8   KRSFRRTQGTQSRPRKESGKNTESSWKRTFNQGTEGENELDEDD--ICIICAEKLTYVTL 65
           +R+FRRTQG         G NT ++  +   Q +    E+++DD  +C+ICA  + +   
Sbjct: 7   RRNFRRTQG---------GSNTTTTDNKK-KQHSHRHEEINDDDENVCVICANPIKFAAW 56

Query: 66  SPCNHVTCNRCTFRQRALYNKKSCLVCRTESD--LVIFSADRNA-VFDDFDEKNLVET-- 120
           SPCNH TC++C+FRQ AL++KKSCL+CRT+ D   +IF+   N+  ++DF+  N+ +T  
Sbjct: 57  SPCNHKTCHKCSFRQLALFDKKSCLICRTDFDNNSMIFTEKLNSQAYEDFNS-NMWQTDL 115

Query: 121 -NVDLGVSFTSQDVASKTLGLLIYSCPF-------GDTGGTNHENFKKYNAHLKNEHN-K 171
            N   G+ FTS DVA +TL L  + C              T++++FKK N HLK EHN K
Sbjct: 116 INTKYGIKFTSDDVAKETLNLSKFICSVCIIEDKENVMNATDYKSFKKLNEHLKLEHNNK 175

Query: 172 TLCMICASHKKAFPSELRIYTPSQLRIHQSKG-DSEGFKGHPMCGFCSGQRFYSDDELNV 230
           T+CMICA H  +FPSEL+IYT +QL+ H +KG +++GFKGHPMC FCS +RFYS DEL  
Sbjct: 176 TICMICADHHFSFPSELKIYTTNQLKNHNNKGSETDGFKGHPMCKFCSNKRFYSQDELMS 235

Query: 231 HMRDRHEKCHICDQTNINSPQYFKDYDQLFEHFKFDHYVCGVQSCLDSKFVVFRDDLDLQ 290
           HMR++HE+CHICD+ + N+PQ+FK+YDQLF HFK  HY+C  Q+CLD KF+VF+DD++LQ
Sbjct: 236 HMREKHERCHICDKIDHNNPQFFKNYDQLFHHFKNSHYICTFQTCLDDKFIVFKDDMELQ 295

Query: 291 AHILKEHGGILRNGNNNLSMKGGRKYQSQLXXXXXXXXXXXXXQDV-------------- 336
           AHIL+EHG ++R           + +QS+L              +               
Sbjct: 296 AHILQEHGDLIRG--------KPKFFQSELSTFISTPSRVITDDNAFTSQHSFSDSSLPS 347

Query: 337 ---RDNTAKNNSSENSLEVKRLRMEERARHYLKYSHTDFEQFLAINSSYQNGLITAQDVL 393
               ++T  NNSS+   EVK+LR++ERA+HYL  SH DF+ F+ +N  Y    +TA  +L
Sbjct: 348 LNSVNSTNANNSSQ---EVKQLRLDERAKHYLDNSHEDFQTFINLNKQYAANKLTAAQLL 404

Query: 394 SAYEGLFKSPEAQVGLLLYDFSELFPQSSKLHQDLRVIYDTVQKKENRHTNFPSLSALNP 453
           ++Y+ LF++P++ V LL+++ SEL+P +S  +++L  IY   +KK ++    PSL   N 
Sbjct: 405 NSYKNLFQTPQSDVHLLIHNLSELYPMNSLKYKELDSIYRAQEKKLSKKPQLPSL--YND 462

Query: 454 TLLPGSVASGSWGRSTGS-------NKAARQYNFPSLKKPASPQPPIITKKPSSTKVNNV 506
                S+ +  WG S  +           R  N PSL           T  PS+  +N  
Sbjct: 463 PSSSSSMVNAVWGNSNNNRNVSSLRTNTNRPLNLPSL-----------TSTPSN--LNGT 509

Query: 507 QPKAKAVPVTRKPSSNESSFKPTYLDGKQKSASSSPALDREKFPPLPKSQARKFRAPLVN 566
           +P    + V+   SS         L  K ++ ++S        P LP  + + +  P V 
Sbjct: 510 RP----LHVSHSTSS---------LTSKSRNDNASSNSRISNLPSLPTPKPKVYIPP-VR 555

Query: 567 EASIPNPSQWGKSSNESTGG--------LRMQSSNSTQELISSGKKKNKQ 608
           +  IP+P+ WG+   + T G        L M  ++S+Q    SGK+K KQ
Sbjct: 556 QTVIPDPNSWGRRGPQQTNGDVLEGISNLNMNGNSSSQTTRGSGKRKQKQ 605

>Scas_615.12
          Length = 674

 Score =  401 bits (1030), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 239/628 (38%), Positives = 358/628 (57%), Gaps = 83/628 (13%)

Query: 3   AKPEQKRSFRRTQGTQSRPRKESGKNTESSWKRTFNQGTEGENELDEDDICIICAEKLTY 62
           AK +  ++ ++ +   S+P +E  + T +      N G + +++L     C+ICA KL Y
Sbjct: 30  AKNDTAKANKKGKSRISKPIEEIARTTRN---LDINSGDDDDDDL-----CLICASKLVY 81

Query: 63  VTLSPCNHVTCNRCTFRQRALYNKKSCLVCRTESDLVIFSADRNAVFDDFDEKNLVETNV 122
            +LSPCNH TC++C+F+QR+LYNKK+CL+CRTE+D +IF+ + NA + D +  +  + N 
Sbjct: 82  ASLSPCNHTTCHKCSFKQRSLYNKKACLICRTENDKLIFTENINANYTDSNLGH-YQFNE 140

Query: 123 DLGVSFTSQDVASKTLGLLIYSCPF--GDTGGTNHENF---KKYNAHLKNEHNKTLCMIC 177
             G+ FTS++VA+ TL LL Y+C     +  G   E+F   KKYN HL+++HNK LC IC
Sbjct: 141 KYGIVFTSEEVATATLNLLKYTCSVCPANKDGIEREDFGSYKKYNEHLRSKHNKCLCTIC 200

Query: 178 ASHKKAFPSELRIYTPSQLRIHQSKGDSEGFKGHPMCGFCSGQRFYSDDELNVHMRDRHE 237
           A +   FPSEL +YT +QLR HQSKG+SEGFKGHP+C FCSGQRFY DDEL VHMR++HE
Sbjct: 201 AQNNHIFPSELPVYTQNQLRNHQSKGNSEGFKGHPLCAFCSGQRFYGDDELYVHMRNKHE 260

Query: 238 KCHICDQTNINSPQYFKDYDQLFEHFKFDHYVCGVQSCLDSKFVVFRDDLDLQAHILKEH 297
           KCHICD+ + NSPQYFKDYDQLF+HFK  HY+C VQ+CLD+KF+VF+D+L+LQAHILKEH
Sbjct: 261 KCHICDKIDHNSPQYFKDYDQLFDHFKNFHYICTVQTCLDNKFIVFKDELELQAHILKEH 320

Query: 298 GGILRNGNNNLSMKGGRKYQSQLXXXXXXXXXXXXXQDVRDNTAKNNSSENSL------- 350
           G ++R           + +QS+L               VRD  A N   ++         
Sbjct: 321 GDLIRG--------KPKLFQSELSTFMSGPSRV-----VRDRDAMNYDMDSRPSLFSSSP 367

Query: 351 ---------------------EVKRLRMEERARHYLKYSHTDFEQFLAINSSYQNGLITA 389
                                E+++LR+EERA++YL+ S   +++F+  N  Y  G +T 
Sbjct: 368 SSSATPLGTDGNDDNSDNDIPELRQLRLEERAKYYLENSQELYDKFIKCNDEYDKGYLTG 427

Query: 390 QDVLSAYEGLFKSPEAQVGLLLYDFSELFPQSSKLHQDLRVIYDTVQKKENRHTNFPSLS 449
             +L +Y+ +F +P++ V LL+ + ++L+P++S   ++L  IY+  ++K       PSLS
Sbjct: 428 LGLLDSYKEIFTTPQSNVYLLINNVAKLYPKNSPKFKELNAIYEAQEQKLYLQNGLPSLS 487

Query: 450 ALNPTLLPGSVASGSWGRSTGSNKAARQYNFPSLK---KPASPQPPIITKKPS-----ST 501
             + ++   + +  + G S   N+  R  + P+L+   K   P    + K P+      T
Sbjct: 488 GSSASISSATRSWNNSG-SVAMNRNIR--DLPTLEAKSKSFDPFATTVKKTPALRTMKKT 544

Query: 502 KVNNVQPKAKAV------------PVTRKPSSNESSFKPTYLDGKQKSASSSPALDREKF 549
            V  V P   A              V R P++N S+   T   G   +  +    D    
Sbjct: 545 VVKKVSPSPIAYTPLGGSSLSSLSTVPRLPTTNVSN---TVRMGSSTNGKNKKLADLN-L 600

Query: 550 PPLPKSQARKFRAPLVNEASIPNPSQWG 577
           P LP  + + +  PL  + +IP+P QWG
Sbjct: 601 PQLPTPKPKVYIPPL-RKTTIPDPKQWG 627

>AAR147W [335] [Homologous to ScYOR191W (RIS1) - SH]
            complement(608865..613607) [4743 bp, 1580 aa]
          Length = 1580

 Score = 37.0 bits (84), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 32/66 (48%), Gaps = 10/66 (15%)

Query: 22   RKESGKNTESSWKRTFNQ----GTEGENELD---EDDICIICAEKLTYVTLS---PCNHV 71
            R  +G +    W R +N     GTEG+  +    E+ IC  C E++   +LS   PC H+
Sbjct: 1247 RVVNGMDFIKDWLRLYNVAKRIGTEGKGTVSQSLENMICPFCMEQMEIESLSVLTPCGHL 1306

Query: 72   TCNRCT 77
             C+ C 
Sbjct: 1307 LCDACV 1312

>Kwal_47.17719
          Length = 635

 Score = 34.7 bits (78), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 37/87 (42%), Gaps = 4/87 (4%)

Query: 12  RRTQGTQSRPRKESGKNTESSWKRTFNQGTE--GENELDEDDICIICAEKLTYVTLSPCN 69
           +R   +Q     ESG   E   +R  +  T     ++ D D  C++C   +  + L PC 
Sbjct: 540 KRLTRSQYSKINESGILREIMIERLSDSKTSSNATDKSDRDLACVVCKSNIRNIVLWPCK 599

Query: 70  -HVTCNRCTFRQRALYNKKSCLVCRTE 95
               C  C     AL   K+C+ CR+E
Sbjct: 600 CFAVCEDCRV-SLALRGFKTCICCRSE 625

>AGL289C [4023] [Homologous to ScYER116C (SLX8) - SH]
           (164204..164929) [726 bp, 241 aa]
          Length = 241

 Score = 33.5 bits (75), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 21/50 (42%), Gaps = 4/50 (8%)

Query: 53  CIICAEKLTYVTLSPCNHVTCNRCTFRQ----RALYNKKSCLVCRTESDL 98
           C IC +      ++PC H+ C  C F+     R       C +CR +  L
Sbjct: 173 CPICFDPPEAALMTPCGHIYCTVCLFQMVNSSRGYRRNGQCALCRKDVKL 222

>Scas_672.2
          Length = 263

 Score = 32.7 bits (73), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 21/50 (42%), Gaps = 4/50 (8%)

Query: 53  CIICAEKLTYVTLSPCNHVTCNRCTFRQ----RALYNKKSCLVCRTESDL 98
           C IC +      ++PC HV C  C F+     R       C +CR E  L
Sbjct: 197 CPICMDPPETALIAPCGHVFCCDCLFQMVNSSRTYRKDGHCALCRKEVRL 246

>CAGL0J03586g complement(341290..342525) similar to sp|P10862
           Saccharomyces cerevisiae YCR066w RAD18 DNA repair
           protein, hypothetical start
          Length = 411

 Score = 32.7 bits (73), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 42/94 (44%), Gaps = 18/94 (19%)

Query: 46  ELDEDDICIICAEKLTYVTLSPCNHVTCNRCTFRQRALYNKKSCLVCRTE-------SDL 98
           ELD+   C IC + L    L+PC H  C+ C   +  L N+  C +C  E       S+ 
Sbjct: 20  ELDDLLRCHICKDFLKNPVLTPCGHTFCSLCI--RGYLSNEPKCPLCLHELRESMLRSEY 77

Query: 99  VI------FSADRNAVFDDFDEKNLVETNVDLGV 126
           ++      + A R  + D+    N +ETN D  V
Sbjct: 78  LVNEITETYKAARQRLLDEL---NSLETNQDNSV 108

>Scas_573.9
          Length = 1502

 Score = 33.1 bits (74), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 22/41 (53%), Gaps = 2/41 (4%)

Query: 53   CIICAEKLTYVTLSPCNHVTCNRCTFRQRALYNKKSCLVCR 93
            C IC + ++  ++  C H  C RC      L NKK+C +C+
Sbjct: 1191 CSICLQDISLGSMLKCGHFFCKRCI--TSWLKNKKNCPMCK 1229

>Kwal_27.10723
          Length = 229

 Score = 32.0 bits (71), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 19/45 (42%), Gaps = 4/45 (8%)

Query: 53  CIICAEKLTYVTLSPCNHVTCNRCTFRQ----RALYNKKSCLVCR 93
           C IC E      ++PC HV C  C F+     R       C +CR
Sbjct: 164 CPICFEPPEAALVTPCGHVFCTECLFQMVNSSRGQSRAGHCALCR 208

>CAGL0B05049g 487186..491598 some similarities with tr|Q06554
            Saccharomyces cerevisiae YLR247c, hypothetical start
          Length = 1470

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 22/41 (53%), Gaps = 2/41 (4%)

Query: 53   CIICAEKLTYVTLSPCNHVTCNRCTFRQRALYNKKSCLVCR 93
            C IC + +T   +  C H+ C  C F    L N+K+C +C+
Sbjct: 1164 CSICLQPITNGAMVNCGHLFCTSCIFSW--LKNRKTCPLCK 1202

>CAGL0G03553g complement(345057..345689) weakly similar to sp|P40072
           Saccharomyces cerevisiae YER116c YEU6, hypothetical
           start
          Length = 210

 Score = 31.6 bits (70), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 19/45 (42%), Gaps = 4/45 (8%)

Query: 53  CIICAEKLTYVTLSPCNHVTCNRCTFRQ----RALYNKKSCLVCR 93
           C IC E      ++PC HV C  C F+     R       C +CR
Sbjct: 146 CPICFEPPDVAIMTPCGHVFCCECLFQMVNNSRTPRKGGVCALCR 190

>Scas_705.41
          Length = 428

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 30/68 (44%), Gaps = 6/68 (8%)

Query: 47  LDEDDICIICAEKLTYVT-----LSPCNHVTCNRCTFRQRALYNKKSCLVCRTE-SDLVI 100
           L+ D+IC IC + L         L PCNH     C  R     +   C +CR +   +++
Sbjct: 6   LEGDNICPICFDDLNDTDILQGKLKPCNHKYHYDCIRRWHGYSDNSDCPLCRCQPKTMIV 65

Query: 101 FSADRNAV 108
            S + N V
Sbjct: 66  LSRNHNGV 73

>Scas_656.3
          Length = 674

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 37/131 (28%), Positives = 58/131 (44%), Gaps = 16/131 (12%)

Query: 432 YDTVQKKENRHTNFPSLSALNPTLLPGSVASGSWGRSTGSNK----AARQYNFPSLKKPA 487
           Y+  QK+ N   N   L  L     PG +  G  GRS  +N     A +  N PSL +  
Sbjct: 121 YEDNQKQNNDSNNKSILDDLFNLFHPGKLLWGKQGRSVTTNSSHEVAPKNSNEPSLSRKH 180

Query: 488 SPQP------PIITKK--PSSTKVNNVQPKAKAVPVTRKPSSNESSFKPTYLDGKQKSAS 539
                     P+  +K  PS+TKV N Q K +A+       +NE++ K +  D K ++ +
Sbjct: 181 LRDTDDFFYLPLKNRKINPSNTKVTNNQGKKRALANI----NNENNGKRSIPDSKSRNIT 236

Query: 540 SSPALDREKFP 550
           ++ A  +   P
Sbjct: 237 TTNANSQSTVP 247

>Scas_615.13
          Length = 330

 Score = 31.6 bits (70), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 21/46 (45%), Gaps = 2/46 (4%)

Query: 53  CIICAEKLTYVTLSPCNHVTCNRCTFRQRALYNKKSCLVCRTESDL 98
           CI+C   +T  + SPC H+ C  C         +  C +CR E  +
Sbjct: 280 CILCLAYMTDPSCSPCGHIFCWECILDWCK--ERPECPLCRQECQI 323

>YCR066W (RAD18) [592] chr3 (231495..232958) Multifunctional DNA
          repair protein, required for post-replication repair
          [1464 bp, 487 aa]
          Length = 487

 Score = 31.6 bits (70), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 2/43 (4%)

Query: 53 CIICAEKLTYVTLSPCNHVTCNRCTFRQRALYNKKSCLVCRTE 95
          C IC + L    L+PC H  C+ C   +  L N+ +C +C  E
Sbjct: 28 CHICKDFLKVPVLTPCGHTFCSLCI--RTHLNNQPNCPLCLFE 68

>CAGL0L03960g complement(461754..463565) similar to sp|P53924
           Saccharomyces cerevisiae YNL116w, start by similarity
          Length = 603

 Score = 31.6 bits (70), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 27/55 (49%), Gaps = 5/55 (9%)

Query: 48  DEDDICIICAEKL---TYVTLSPCNHVTCNRCTFRQRAL-YNKKSCLVCRTESDL 98
           DE+D C IC  K+     + +SPC H    RC  R   L Y +  C  CR+  DL
Sbjct: 511 DEED-CSICLSKIKPCQAIFISPCAHTWHFRCVRRLVMLAYPQFVCPNCRSTCDL 564

>KLLA0D10758g 917125..919677 similar to sp|P47156 Saccharomyces
           cerevisiae YJR119c, start by similarity
          Length = 850

 Score = 31.6 bits (70), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 20/33 (60%), Gaps = 1/33 (3%)

Query: 48  DEDDICIICAEKL-TYVTLSPCNHVTCNRCTFR 79
           DED+ C IC + + T VT S    VTCN C F+
Sbjct: 285 DEDEKCPICVKHVPTKVTSSSVAIVTCNSCDFK 317

>YMR318C (ADH6) [4272] chr13 complement(911059..912141)
           NADPH-dependent cinnamyl-alcohol dehydrogenase, has
           similarity to alcohol dehydrogenases [1083 bp, 360 aa]
          Length = 360

 Score = 31.2 bits (69), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 22/43 (51%)

Query: 19  SRPRKESGKNTESSWKRTFNQGTEGENELDEDDICIICAEKLT 61
           SR R+++ K     +  T  +G  GE   D  D+ ++CA  LT
Sbjct: 213 SRKREDAMKMGADHYIATLEEGDWGEKYFDTFDLIVVCASSLT 255

>YMR053C (STB2) [4013] chr13 complement(380345..382897) Protein of
           unknown function, has high similarity to uncharacterized
           S. cerevisiae Stb6p [2553 bp, 850 aa]
          Length = 850

 Score = 30.4 bits (67), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 30/57 (52%)

Query: 391 DVLSAYEGLFKSPEAQVGLLLYDFSELFPQSSKLHQDLRVIYDTVQKKENRHTNFPS 447
           D    +EG F+  + +  LLL++  EL   SS+L  D+R++   V+  E+    F S
Sbjct: 703 DGAKVFEGRFEDIDNKQQLLLHEMQELNSLSSRLKYDMRILEVRVRDIESSVAQFDS 759

>AFR212W [3404] [Homologous to ScYMR119W (ASI1) - SH; ScYNL008C
           (ASI3) - NSH] complement(814346..816226) [1881 bp, 626
           aa]
          Length = 626

 Score = 30.4 bits (67), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 35/87 (40%), Gaps = 4/87 (4%)

Query: 12  RRTQGTQSRPRKESGKNTESSWKRTFNQGTEGENELDED-DI-CIICAEKLTYVTLSPCN 69
           +R   +Q     E+G   E   +R     T      DED D+ C++C   L  + L PC 
Sbjct: 531 KRLTRSQYAHINENGILKEVLLQRYMETCTSPSKLQDEDADMSCVVCKTNLRNIVLWPCR 590

Query: 70  -HVTCNRCTFRQRALYNKKSCLVCRTE 95
               C  C      L   K+C+ CR +
Sbjct: 591 CFALCEECRV-SLGLRGFKACVCCRAD 616

>KLLA0F23892g complement(2229493..2231049) some similarities with
           sp|P38823 Saccharomyces cerevisiae YHR115c, hypothetical
           start
          Length = 518

 Score = 30.4 bits (67), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 38/88 (43%), Gaps = 3/88 (3%)

Query: 13  RTQGTQSRPRKESGKNTESSWKRTFNQGTEGENELDEDDICIICAEKLTYVTLSPCNHVT 72
           R +  +S  RK +  N E+  K    Q      EL++  IC+   +    V ++PC+H  
Sbjct: 355 RVELNKSWRRKANAFNKEAIQKMKALQKMTSGTELEDCSICLSKIKACQAVFIAPCSHSW 414

Query: 73  CNRCTFRQRA--LYNKKSCLVCRTESDL 98
             +C  RQ     Y +  C  CR   DL
Sbjct: 415 HFKC-IRQLVSKTYPQFVCPNCRAVCDL 441

>Scas_720.89
          Length = 469

 Score = 30.0 bits (66), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 24/50 (48%), Gaps = 2/50 (4%)

Query: 46 ELDEDDICIICAEKLTYVTLSPCNHVTCNRCTFRQRALYNKKSCLVCRTE 95
          E+D    C IC + L    L+PC+H  C+ C   +  L +   C +C  E
Sbjct: 21 EIDTLLRCHICKDFLKVPVLTPCSHTFCSLCI--REYLKDNSKCPLCLNE 68

>CAGL0E06666g complement(670193..674455) some similarities with
           sp|P08640 Saccharomyces cerevisiae YIR019c STA1,
           hypothetical start
          Length = 1420

 Score = 30.0 bits (66), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 31/60 (51%), Gaps = 1/60 (1%)

Query: 485 KPASPQPPIITKKPSSTKVNNVQPKAKAV-PVTRKPSSNESSFKPTYLDGKQKSASSSPA 543
           KPA P P   +  PSS   ++V P +K V P    PS N SS  P+ ++    + SS PA
Sbjct: 588 KPADPSPADPSHNPSSVNPSSVNPSSKPVDPSPADPSHNPSSVNPSSVNPSSVNPSSKPA 647

>KLLA0C08041g complement(705516..707240)
          gi|24741192|emb|CAD56154.1 Kluyveromyces lactis
          CCr4/NOT complex/transcription factor subunit, start by
          similarity
          Length = 574

 Score = 30.0 bits (66), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 25/56 (44%), Gaps = 7/56 (12%)

Query: 48 DEDDICIICAEKL----TYVTLSPCNHVTCNRC--TFRQRALYNKKSCLVCRTESD 97
          DE+D+C +C E L     +    PC +  C  C    RQ    N + C  CR + D
Sbjct: 33 DEEDLCPLCIEPLDVMDKHFKPCPCGYQICQFCYNNIRQNPELNGR-CPACRRKYD 87

>CAGL0G09493g complement(902228..906454) similar to tr|Q08562
            Saccharomyces cerevisiae YOR191w RIS1, hypothetical start
          Length = 1408

 Score = 30.0 bits (66), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 16/62 (25%), Positives = 27/62 (43%), Gaps = 10/62 (16%)

Query: 25   SGKNTESSWKRTF-------NQGTEGENELDEDDICIICAEKL---TYVTLSPCNHVTCN 74
            +GKN  + W R +       ++  E      +   C+ C E++   +   LS C H+ CN
Sbjct: 1084 NGKNFNNDWLRLYYVIKKMKSEAVEIVKSASDSMTCLWCLEQIEPESAFVLSGCGHLICN 1143

Query: 75   RC 76
             C
Sbjct: 1144 DC 1145

>KLLA0C18260g 1613311..1614000 similar to sp|P53769 Saccharomyces
           cerevisiae YLR323c singleton, start by similarity
          Length = 229

 Score = 29.3 bits (64), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 12/45 (26%), Positives = 24/45 (53%), Gaps = 2/45 (4%)

Query: 53  CIICAEKLTYVTLSPCNHVTCNRCTFRQRALYNKKSCLVCRTESD 97
           C +C ++ T   ++ CNH  C+ C  +Q  +    +C +C  E++
Sbjct: 171 CFLCKKEYTSPVVTKCNHYFCSSCFMKQMKVST--NCPICGKETE 213

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.314    0.130    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 21,684,033
Number of extensions: 1011268
Number of successful extensions: 3176
Number of sequences better than 10.0: 131
Number of HSP's gapped: 3170
Number of HSP's successfully gapped: 162
Length of query: 608
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 501
Effective length of database: 12,891,983
Effective search space: 6458883483
Effective search space used: 6458883483
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 65 (29.6 bits)