Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_55.1999127527113380.0
YOR035C (SHE4)7892805561e-65
Scas_699.377682855164e-60
KLLA0E16742g6612784433e-50
AER389C7582694085e-45
CAGL0I01034g7832934008e-44
YNR053C (NOG2)48682710.56
AEL122W351105690.80
Sklu_2275.666156681.2
Sklu_2346.118832624.0
CAGL0K12892g73771644.1
YIR033W (MGA2)111365628.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_55.19991
         (271 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_55.19991                                                         520   0.0  
YOR035C (SHE4) [4847] chr15 complement(397734..400103) Protein r...   218   1e-65
Scas_699.37                                                           203   4e-60
KLLA0E16742g 1482505..1484490 weakly similar to sp|P51534 Saccha...   175   3e-50
AER389C [2889] [Homologous to ScYOR035C (SHE4) - SH] (1367924..1...   161   5e-45
CAGL0I01034g 84159..86510 similar to sp|P51534 Saccharomyces cer...   158   8e-44
YNR053C (NOG2) [4636] chr14 complement(721119..721769,722301..72...    32   0.56 
AEL122W [2384] [Homologous to ScYJL167W (ERG20) - SH] complement...    31   0.80 
Sklu_2275.6 YLL007C, Contig c2275 9583-11568                           31   1.2  
Sklu_2346.1 YOL067C, Contig c2346 1124-1690 reverse complement         28   4.0  
CAGL0K12892g complement(1274085..1276298) similar to sp|P43556 S...    29   4.1  
YIR033W (MGA2) [2697] chr9 (416121..419462) Transcription factor...    28   8.0  

>Kwal_55.19991
          Length = 275

 Score =  520 bits (1338), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/271 (95%), Positives = 259/271 (95%)

Query: 1   MVVLANLSSPLDESSSRQRALQGLQAYADLKRPDNLKDVASPTNEEVLAFNKKYILDLNT 60
           MVVLANLSSPLDESSSRQRALQGLQAYADLKRPDNLKDVASPTNEEVLAFNKKYILDLNT
Sbjct: 1   MVVLANLSSPLDESSSRQRALQGLQAYADLKRPDNLKDVASPTNEEVLAFNKKYILDLNT 60

Query: 61  LGLLKSGFRDQSSGSNLQLVRIIHNLSRNKEFINESVQQGSVAVLLETLASIKMPADFKX 120
           LGLLKSGFRDQSSGSNLQLVRIIHNLSRNKEFINESVQQGSVAVLLETLASIKMPADFK 
Sbjct: 61  LGLLKSGFRDQSSGSNLQLVRIIHNLSRNKEFINESVQQGSVAVLLETLASIKMPADFKL 120

Query: 121 XXXXXXXXXXXMVNPELVFRRFSALTAVPYLFELIPVPTQPASNDQIDPKDTYEALLALT 180
                      MVNPELVFRRFSALTAVPYLFELIPVPTQPASNDQIDPKDTYEALLALT
Sbjct: 121 LALRSLARILAMVNPELVFRRFSALTAVPYLFELIPVPTQPASNDQIDPKDTYEALLALT 180

Query: 181 NLVTIQESDSICQKIVASPVYWEQLEGLILDTTVEIQRSVLELLCNLMAGSLHLAVKFFN 240
           NLVTIQESDSICQKIVASPVYWEQLEGLILDTTVEIQRSVLELLCNLMAGSLHLAVKFFN
Sbjct: 181 NLVTIQESDSICQKIVASPVYWEQLEGLILDTTVEIQRSVLELLCNLMAGSLHLAVKFFN 240

Query: 241 FDNPQSLRNFNILVKLLNLKDIRSQMAVTGI 271
           FDNPQSLRNFNILVKLLNLKDIRSQMAVTGI
Sbjct: 241 FDNPQSLRNFNILVKLLNLKDIRSQMAVTGI 271

>YOR035C (SHE4) [4847] chr15 complement(397734..400103) Protein
           required for mother cell-specific expression of HO and
           receptor mediated as well as membrane lipid endocytosis
           [2370 bp, 789 aa]
          Length = 789

 Score =  218 bits (556), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 122/280 (43%), Positives = 174/280 (62%), Gaps = 9/280 (3%)

Query: 1   MVVLANLSSPLDESSSRQRALQGLQAYADLKRPDNLKDVASP-TNEEVLAFNKKYILDLN 59
           +V++ANLS+  +ES+   +++  L+ YADLK P   K  A   + E++L FN+KYIL   
Sbjct: 409 LVIMANLSTLPEESNGSSQSINDLKNYADLKGPGADKVGAEKESKEDILLFNEKYILRTE 468

Query: 60  TLGLLKSGFRDQSSGSNLQLVRIIHNLSRNKEFINESVQQGSVAVLLETLASIK-MPADF 118
            +  LK    + S     Q+VR+I+N++R+K FI + + QG   ++LE LA+ + +    
Sbjct: 469 LISFLKREMHNLSPNCKQQVVRVIYNITRSKNFIPQCISQGGTTIILEYLANKQDIGEPI 528

Query: 119 KXXXXXXXXXXXXMVNPELVFRRFSALTAVPYLFELIPVPT----QPASND-QIDPKDTY 173
           +              NP L+F+++SAL A+P+LFEL+P  T     P  ND QI   D Y
Sbjct: 529 RILGCRALTRMLIFTNPGLIFKKYSALNAIPFLFELLPRSTPVDDNPLHNDEQIKLTDNY 588

Query: 174 EALLALTNLVTIQESDS--ICQKIVASPVYWEQLEGLILDTTVEIQRSVLELLCNLMAGS 231
           EALLALTNL + + SD   +C+ IV++ VYW  +E L+LD  V +QRS LEL+ N+M+  
Sbjct: 589 EALLALTNLASSETSDGEEVCKHIVSTKVYWSTIENLMLDENVPLQRSTLELISNMMSHP 648

Query: 232 LHLAVKFFNFDNPQSLRNFNILVKLLNLKDIRSQMAVTGI 271
           L +A KFFN +NPQSLRNFNILVKLL L D+ SQ AV  I
Sbjct: 649 LTIAAKFFNLENPQSLRNFNILVKLLQLSDVESQRAVAAI 688

>Scas_699.37
          Length = 768

 Score =  203 bits (516), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 118/285 (41%), Positives = 178/285 (62%), Gaps = 15/285 (5%)

Query: 1   MVVLANLSS-PLD---ESSSRQRALQGLQAYADLKRPD--NLKDVASPTNEEVLAFNKKY 54
           +V+L N+S+ P+D   + +   +ALQ L+ Y++LK P   +  DV    NE+V  + +KY
Sbjct: 382 LVILGNISTYPMDVTMDGAMDPQALQDLKTYSELKSPKKRDANDVIE-NNEDVTRYIQKY 440

Query: 55  ILDLNTLGLLKSGFRDQSSGSNLQLVRIIHNLSRNKEFINESVQQGSVAVLLETLASIKM 114
           IL    L  L++   + S GS  Q++RII+NL+R +E I+ SV+QG V  ++E LA+ K 
Sbjct: 441 ILKTELLSYLRTKLAEVSPGSRQQIIRIIYNLTRARENISASVEQGCVVTVIEYLANKKD 500

Query: 115 PAD-FKXXXXXXXXXXXXMVNPELVFRRFSALTAVPYLFELIPVPT----QPASNDQ-ID 168
             +  +            + +P+L+F ++S LTA+P+L+EL+  P+     P S D+ I 
Sbjct: 501 KKEPTRLLALRSLTKMLTLSDPKLIFNKYSRLTAIPFLYELLQTPSLSAENPLSTDELIT 560

Query: 169 PKDTYEALLALTNLVTIQES--DSICQKIVASPVYWEQLEGLILDTTVEIQRSVLELLCN 226
            +D+YEAL ALTNL + ++S  D +C+++V    YW  +E LILD  + +QR+ LEL+ N
Sbjct: 561 TQDSYEALCALTNLASTEDSNADDVCKQVVTDVNYWSIIENLILDDNILVQRATLELIAN 620

Query: 227 LMAGSLHLAVKFFNFDNPQSLRNFNILVKLLNLKDIRSQMAVTGI 271
           LM   L +A K FNF+NPQSLRNFNILVKLL L D+ +Q AV  I
Sbjct: 621 LMCYPLSIAAKIFNFENPQSLRNFNILVKLLELNDVAAQRAVAAI 665

>KLLA0E16742g 1482505..1484490 weakly similar to sp|P51534
           Saccharomyces cerevisiae YOR035c SHE4 required for
           mother cell-specific gene expression singleton,
           hypothetical start
          Length = 661

 Score =  175 bits (443), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 114/278 (41%), Positives = 171/278 (61%), Gaps = 17/278 (6%)

Query: 1   MVVLANLS---SPLDESSSRQRA-LQGLQAYADLKRPDNLKDVASPTNEEVLAFNKKYIL 56
           +++LAN+S   S  +++  + +A L+  Q   D    +N+KD+     EE   FN+ YI+
Sbjct: 298 LIILANVSEHPSQNEDTVDKLKASLKTNQEKNDEPTLENVKDI-----EE---FNRDYII 349

Query: 57  DLNTLGLLKSGFRDQSSGSNLQLVRIIHNLSRNKEFINESVQQGSVAVLLETLASIK--M 114
           DL+ +G LKS  +  +S  N Q +RII+N++R+K  I+E V+QG+  +LL  LA  +   
Sbjct: 350 DLDLIGSLKS-IKLSTSSYN-QAIRIIYNVTRDKTQISECVKQGAGLMLLVFLAQKRNLS 407

Query: 115 PADFKXXXXXXXXXXXXMVNPELVFRRFSALTAVPYLFELIPVPTQPA-SNDQIDPKDTY 173
             ++              VNPE  F ++S L+A P+LFE +P+P   A S  Q    DTY
Sbjct: 408 KDEWYLLSIRALSKTLIYVNPETAFSKYSPLSAAPFLFENLPLPNDNALSELQFTQLDTY 467

Query: 174 EALLALTNLVTIQESDSICQKIVASPVYWEQLEGLILDTTVEIQRSVLELLCNLMAGSLH 233
           EALLALTNL TI +   + + I+++  YW+ +E L+LD++V IQRS LEL+ NLM+  + 
Sbjct: 468 EALLALTNLATINQGVDLGKIILSNAQYWDSIENLLLDSSVRIQRSTLELISNLMSNPMA 527

Query: 234 LAVKFFNFDNPQSLRNFNILVKLLNLKDIRSQMAVTGI 271
           ++ KFF F+NP+S +NF ILVKLL L DI+SQ AV  I
Sbjct: 528 ISAKFFCFENPKSAQNFEILVKLLELHDIQSQRAVAAI 565

>AER389C [2889] [Homologous to ScYOR035C (SHE4) - SH]
           (1367924..1370200) [2277 bp, 758 aa]
          Length = 758

 Score =  161 bits (408), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 105/269 (39%), Positives = 157/269 (58%), Gaps = 5/269 (1%)

Query: 1   MVVLANLSSPLDESSSRQRALQGLQAYADLKRPDNLKDVASPTNEEVLAFNKKYILDLNT 60
           +  L NL++   E SS Q++L  L+AYADL  P + K      ++E+ AF + YILDL  
Sbjct: 374 LSTLVNLTASPSEQSSEQKSLNALKAYADLHVPASGKQEPLEDDDEIDAFIEDYILDLQV 433

Query: 61  LGLLKSGFRDQSSGSNLQLVRIIHNLSRNKEFINESVQQGSVAVLLETLASIKMPADFKX 120
           +G L+S      +    QL ++I+ +++++ FI   V+QG+   LLE L    +    + 
Sbjct: 434 IGTLRSSKNVLMANCKEQLAKLIYQVTKSRPFIQSCVKQGATTFLLEYLNDAPVHNIIQI 493

Query: 121 XXXXXXXXXXXMVNPELVFRRFSALTAVPYLFELIPVPTQPASNDQ----IDPKDTYEAL 176
                        +P+L+F R S + +VP LF LIP+      N++    +  +D+YEAL
Sbjct: 494 LAARALARILINTDPKLLFHRHSPMNSVPALFGLIPI-LDGLDNEEALSYLTTRDSYEAL 552

Query: 177 LALTNLVTIQESDSICQKIVASPVYWEQLEGLILDTTVEIQRSVLELLCNLMAGSLHLAV 236
           LALTNL     S+ + + IV++  YW +L   +LD TV+IQRS LELL NLMA  +++A 
Sbjct: 553 LALTNLAATDSSEELAKVIVSNNRYWLKLMNCVLDETVQIQRSALELLANLMARPINIAA 612

Query: 237 KFFNFDNPQSLRNFNILVKLLNLKDIRSQ 265
           KFFN  NP+S +NF+ LV LL L+DIRSQ
Sbjct: 613 KFFNLANPESRKNFDTLVCLLRLEDIRSQ 641

>CAGL0I01034g 84159..86510 similar to sp|P51534 Saccharomyces
           cerevisiae YOR035c SHE4, start by similarity
          Length = 783

 Score =  158 bits (400), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 113/293 (38%), Positives = 164/293 (55%), Gaps = 22/293 (7%)

Query: 1   MVVLANLSS-PLDESSSRQRALQG----LQAYADLKRPDN-LKDVASPTNEEVLAFNKKY 54
           ++++ANL++ P D+++   +   G    L  YA++    N LKD    + EEV  F +K+
Sbjct: 389 LIIIANLTALPNDKTNPTNQTHSGSMAQLSMYANMGADTNKLKDNVPDSEEEVKEFQEKF 448

Query: 55  ILDLNTLGLLKSGFRDQSSGSNLQLVRIIHNLSRNKEFINESVQQGSVAVLLETLASIK- 113
           IL  + L  +K+ F D S GS  Q +RI++N++R KE I+  VQQG    +LE L S + 
Sbjct: 449 ILKKDLLADMKTKFNDMSPGSKQQYMRIVYNMTRVKENISSCVQQGVTTNILEYLVSKQD 508

Query: 114 MPADFKXXXXXXXXXXXXMVNPELVFRRFSALTAVPYLFELIPV-----PTQPA------ 162
                +              +P L+F ++S L A+P+LF+LI        TQ        
Sbjct: 509 KGVAVRLLAYRSLTRILISTDPALIFNKYSPLNAIPFLFDLIGTTESGEETQEKIELNPL 568

Query: 163 --SNDQIDPKDTYEALLALTNLVTIQES--DSICQKIVASPVYWEQLEGLILDTTVEIQR 218
             ++D I+  D YEALLALTNL     S  + IC+ I  +P YW  +  L+L+  + IQR
Sbjct: 569 LENDDNIEVLDRYEALLALTNLAATPTSNGEEICKSISNTPKYWNSIVNLMLNENLLIQR 628

Query: 219 SVLELLCNLMAGSLHLAVKFFNFDNPQSLRNFNILVKLLNLKDIRSQMAVTGI 271
           S LEL+ NLM+  L +A KFFNF NPQSLRNFN LV+L+ L DI SQ A+  +
Sbjct: 629 STLELISNLMSHPLPVAAKFFNFSNPQSLRNFNTLVQLIELDDIASQRAIAAL 681

>YNR053C (NOG2) [4636] chr14
           complement(721119..721769,722301..723110) Nuclear
           protein involved in export of the 60S ribosomal subunit
           from the nucleus, has similarity to human breast
           tumor-associated autoantigen [1461 bp, 486 aa]
          Length = 486

 Score = 32.0 bits (71), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 40/82 (48%), Gaps = 13/82 (15%)

Query: 25  QAYADL-------KRP----DNLKDVASPTNEEVLAFNKKYILDLNTLGLLKSGFRDQSS 73
           ++YAD        KRP     NL+D+   TNE++  + +K +LD  TLGL+     D+ +
Sbjct: 135 ESYADAFGPKAQRKRPRLAASNLEDLVKATNEDITKYEEKQVLDA-TLGLM-GNQEDKEN 192

Query: 74  GSNLQLVRIIHNLSRNKEFINE 95
           G        I +  ++K   NE
Sbjct: 193 GWTSAAKEAIFSKGQSKRIWNE 214

>AEL122W [2384] [Homologous to ScYJL167W (ERG20) - SH]
           complement(394657..395712) [1056 bp, 351 aa]
          Length = 351

 Score = 31.2 bits (69), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 49/105 (46%), Gaps = 17/105 (16%)

Query: 2   VVLANLSSPLD--ESSSRQRALQG-----LQAY---ADLKRPDNLKDVASPTN---EEV- 47
           V+L N  SPLD      R+ AL G     LQAY   AD     ++     P     EEV 
Sbjct: 62  VILKNCKSPLDLPVDEYRRVALLGWCVELLQAYFLVADDMMDKSITRRGQPCWYRVEEVG 121

Query: 48  -LAFNKKYILDLNTLGLLKSGFRDQSSGSNLQLVRIIHNLSRNKE 91
            +A N  ++L+     LLK  FRDQ     + L+ ++H+++   E
Sbjct: 122 DMAINDAFMLEAAIYCLLKRNFRDQP--YYVDLLELLHDVTFQTE 164

>Sklu_2275.6 YLL007C, Contig c2275 9583-11568
          Length = 661

 Score = 30.8 bits (68), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/56 (25%), Positives = 33/56 (58%), Gaps = 4/56 (7%)

Query: 147 AVPYLFELIPVPTQPASNDQIDPKDTYEALLALTNLVTIQESDSICQKIVASPVYW 202
           ++ YL E+  +  +  +N     K + + ++ L +LVT   S++IC+ ++ +P++W
Sbjct: 33  SIAYLQEVTELLHKTENN----KKRSQDIIVLLAHLVTACNSEAICELLINNPMFW 84

>Sklu_2346.1 YOL067C, Contig c2346 1124-1690 reverse complement
          Length = 188

 Score = 28.5 bits (62), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 20/32 (62%)

Query: 7  LSSPLDESSSRQRALQGLQAYADLKRPDNLKD 38
          ++S LD  SS  +A+QG    +D KR DN+ D
Sbjct: 1  MASHLDSVSSSTQAVQGASMESDRKRRDNIND 32

>CAGL0K12892g complement(1274085..1276298) similar to sp|P43556
           Saccharomyces cerevisiae YFL047w, start by similarity
          Length = 737

 Score = 29.3 bits (64), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 35/71 (49%), Gaps = 3/71 (4%)

Query: 183 VTIQESDSICQKIVASPVYWEQLEGLILDTTVEIQRSVLELLCNLMAGSLH-LAVKFFNF 241
            T+    ++  KI +  +  E+L  L  + +++    +L LL N   G  H  A+ + N+
Sbjct: 428 ATLDFCSTMGNKITSLKLSSEKL--LDFEDSIDPSADMLALLTNYHTGVFHPRAITYNNY 485

Query: 242 DNPQSLRNFNI 252
            NP S +NF I
Sbjct: 486 YNPGSFQNFGI 496

>YIR033W (MGA2) [2697] chr9 (416121..419462) Transcription factor
           involved in the response to hypoxia and biosynthesis of
           unsaturated fatty acids, may be involved in the
           remodeling of chromatin structure [3342 bp, 1113 aa]
          Length = 1113

 Score = 28.5 bits (62), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 35/65 (53%), Gaps = 2/65 (3%)

Query: 3   VLANLSSPLDESSSRQRALQGLQAYADLKRPDNLKDVASPTNEEVLAFNKKYI--LDLNT 60
           V  N+S+PL+E     RAL+  +      +  N K++ +P ++E++   K+ I  + +N 
Sbjct: 85  VNQNVSTPLEEEMESNRALKEEEEDEHENKVFNEKNIGNPAHDEIVFGRKETIQSVYINP 144

Query: 61  LGLLK 65
           L  LK
Sbjct: 145 LDYLK 149

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.134    0.367 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,804,565
Number of extensions: 305408
Number of successful extensions: 915
Number of sequences better than 10.0: 20
Number of HSP's gapped: 899
Number of HSP's successfully gapped: 20
Length of query: 271
Length of database: 16,596,109
Length adjustment: 100
Effective length of query: 171
Effective length of database: 13,134,309
Effective search space: 2245966839
Effective search space used: 2245966839
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 61 (28.1 bits)