Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_55.1998164563631020.0
Sklu_1321.265667314570.0
Scas_699.3570967412851e-169
YOR033C (EXO1)70256712441e-163
AER387C65536312331e-162
CAGL0H08085g67456912311e-161
KLLA0E16797g67137012141e-159
YDR263C (DIN7)43036810591e-139
Scas_538.64123849951e-129
Kwal_26.76873802851968e-16
KLLA0F02992g3812861808e-14
Sklu_2149.23812891781e-13
CAGL0K11506g3812911735e-13
Scas_717.643792871701e-12
YKL113C (RAD27)3822961673e-12
CAGL0F08327g9921421661e-11
AFR133C9701421651e-11
Scas_645.810001401534e-10
ABL052C3792771479e-10
YGR258C (RAD2)10311401481e-09
Kwal_23.434310311211427e-09
Sklu_2443.2510331401355e-08
KLLA0A09427g10111401347e-08
KLLA0A01320g5841901311e-07
AFR238W6981241151e-05
YER041W (YEN1)7591381132e-05
Kwal_47.191686732361113e-05
Scas_687.237452721024e-04
CAGL0C02255g648131950.003
AER414W76971800.16
KLLA0B05995g49091770.36
KLLA0A04884g105948740.89
CAGL0M05445g932213702.6
Scas_607.1346241683.7
YOR301W (RAX1)43578675.4
AFR290W121799667.8
Sklu_2265.446437659.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_55.19981
         (636 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_55.19981                                                        1199   0.0  
Sklu_1321.2 YOR033C, Contig c1321 793-2763                            565   0.0  
Scas_699.35                                                           499   e-169
YOR033C (EXO1) [4845] chr15 complement(392415..394523) Double-st...   483   e-163
AER387C [2887] [Homologous to ScYOR033C (EXO1) - SH; ScYDR263C (...   479   e-162
CAGL0H08085g 786770..788794 similar to sp|P39875 Saccharomyces c...   478   e-161
KLLA0E16797g 1487301..1489316 some similarities with sp|P39875 S...   472   e-159
YDR263C (DIN7) [1096] chr4 complement(994234..995526) Mitochondr...   412   e-139
Scas_538.6                                                            387   e-129
Kwal_26.7687                                                           80   8e-16
KLLA0F02992g 278441..279586 similar to sp|P26793 Saccharomyces c...    74   8e-14
Sklu_2149.2 YKL113C, Contig c2149 861-2006 reverse complement          73   1e-13
CAGL0K11506g 1114740..1115885 highly similar to sp|P26793 Saccha...    71   5e-13
Scas_717.64                                                            70   1e-12
YKL113C (RAD27) [3150] chr11 complement(224373..225521) Single-s...    69   3e-12
CAGL0F08327g complement(829426..832404) similar to sp|P07276 Sac...    69   1e-11
AFR133C [3325] [Homologous to ScYGR258C (RAD2) - SH] (675260..67...    68   1e-11
Scas_645.8                                                             64   4e-10
ABL052C [540] [Homologous to ScYKL113C (RAD27) - SH] (300564..30...    61   9e-10
YGR258C (RAD2) [2205] chr7 complement(1007676..1010771) Structur...    62   1e-09
Kwal_23.4343                                                           59   7e-09
Sklu_2443.25 YGR258C, Contig c2443 54418-57519                         57   5e-08
KLLA0A09427g complement(821244..824279) similar to sp|P07276 Sac...    56   7e-08
KLLA0A01320g complement(118369..120123) weakly similar to sp|P40...    55   1e-07
AFR238W [3430] [Homologous to ScYER041W (YEN1) - SH] complement(...    49   1e-05
YER041W (YEN1) [1467] chr5 (232460..234739) Possible DNA nucleas...    48   2e-05
Kwal_47.19168                                                          47   3e-05
Scas_687.23                                                            44   4e-04
CAGL0C02255g complement(228009..229955) similar to sp|P40028 Sac...    41   0.003
AER414W [2914] [Homologous to ScYNL085W (MKT1) - SH] complement(...    35   0.16 
KLLA0B05995g 535752..537224 some similarities with ca|CA0656|IPF...    34   0.36 
KLLA0A04884g 433581..436760 similar to sp|P32767 Saccharomyces c...    33   0.89 
CAGL0M05445g 580648..583446 similar to sp|P38308 Saccharomyces c...    32   2.6  
Scas_607.13                                                            31   3.7  
YOR301W (RAX1) [5085] chr15 (880961..882268) Protein involved in...    30   5.4  
AFR290W [3482] [Homologous to ScYIL151C - SH; ScYKR096W - SH] co...    30   7.8  
Sklu_2265.4 YHR018C, Contig c2265 7685-9079                            30   9.4  

>Kwal_55.19981
          Length = 645

 Score = 1199 bits (3102), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 581/636 (91%), Positives = 581/636 (91%)

Query: 1   MGIQGLLPQLKSIQQPVTLVRYNGQTLAIDGYAWLHRAAHSCAEELALGRPTSKYLEFFV 60
           MGIQGLLPQLKSIQQPVTLVRYNGQTLAIDGYAWLHRAAHSCAEELALGRPTSKYLEFFV
Sbjct: 1   MGIQGLLPQLKSIQQPVTLVRYNGQTLAIDGYAWLHRAAHSCAEELALGRPTSKYLEFFV 60

Query: 61  KRLNMLQNRYNIRPYLVFDGDAITVKKDTXXXXXXXXXXXXXXALALWRSGEKRQAYEYF 120
           KRLNMLQNRYNIRPYLVFDGDAITVKKDT              ALALWRSGEKRQAYEYF
Sbjct: 61  KRLNMLQNRYNIRPYLVFDGDAITVKKDTEVKRKSKRVESREKALALWRSGEKRQAYEYF 120

Query: 121 QKCVDVTPEMAKCVIEYCQVQNIDYVVAPFEADAQMVYLEKMGLVHGIISEDSDLLIFGC 180
           QKCVDVTPEMAKCVIEYCQVQNIDYVVAPFEADAQMVYLEKMGLVHGIISEDSDLLIFGC
Sbjct: 121 QKCVDVTPEMAKCVIEYCQVQNIDYVVAPFEADAQMVYLEKMGLVHGIISEDSDLLIFGC 180

Query: 181 RRLITKLNDHGEGIEICSDDFQYLPHKFPLSQLSPEEMRIMVCLSGCDYTAGIPKVGLLT 240
           RRLITKLNDHGEGIEICSDDFQYLPHKFPLSQLSPEEMRIMVCLSGCDYTAGIPKVGLLT
Sbjct: 181 RRLITKLNDHGEGIEICSDDFQYLPHKFPLSQLSPEEMRIMVCLSGCDYTAGIPKVGLLT 240

Query: 241 AMKLVRKHRTIDNIIKHIQREGKFAVPKDFVHEYQLATFAFQFQRVFCPQTNVITTLNVI 300
           AMKLVRKHRTIDNIIKHIQREGKFAVPKDFVHEYQLATFAFQFQRVFCPQTNVITTLNVI
Sbjct: 241 AMKLVRKHRTIDNIIKHIQREGKFAVPKDFVHEYQLATFAFQFQRVFCPQTNVITTLNVI 300

Query: 301 PEDLLGCSALFESIGRVISKETHAKEVIMDITKVDHEQHARIAWGELCPYNHEKDLVNRE 360
           PEDLLGCSALFESIGRVISKETHAKEVIMDITKVDHEQHARIAWGELCPYNHEKDLVNRE
Sbjct: 301 PEDLLGCSALFESIGRVISKETHAKEVIMDITKVDHEQHARIAWGELCPYNHEKDLVNRE 360

Query: 361 RKLQLSTKSEPILSRSTTSTVGKIDSFFGKXXXXXXXXXXXXXXXXXRAAIRKQEEKQIE 420
           RKLQLSTKSEPILSRSTTSTVGKIDSFFGK                 RAAIRKQEEKQIE
Sbjct: 361 RKLQLSTKSEPILSRSTTSTVGKIDSFFGKSALVSVSAASTGASAQVRAAIRKQEEKQIE 420

Query: 421 ISRKLVSTVERRKLSRHNTPVVAGVGMSRFFSKSFDGSAHEYSGNATSAPSVESSPPRXX 480
           ISRKLVSTVERRKLSRHNTPVVAGVGMSRFFSKSFDGSAHEYSGNATSAPSVESSPPR  
Sbjct: 421 ISRKLVSTVERRKLSRHNTPVVAGVGMSRFFSKSFDGSAHEYSGNATSAPSVESSPPRQS 480

Query: 481 XXXXXXXXXXXXXXXXXXXXXXIPTDIPSSLLSTDVPSSMVPTQVDVEASFLSEEDSEIL 540
                                 IPTDIPSSLLSTDVPSSMVPTQVDVEASFLSEEDSEIL
Sbjct: 481 DSDDTSKASSSGHSGESDSQEDIPTDIPSSLLSTDVPSSMVPTQVDVEASFLSEEDSEIL 540

Query: 541 SEVDEAATRRNDVAPTSKRHCKSLADLRESFGYKRAPLGEKSVNVLAAKTGVDTCAAKKS 600
           SEVDEAATRRNDVAPTSKRHCKSLADLRESFGYKRAPLGEKSVNVLAAKTGVDTCAAKKS
Sbjct: 541 SEVDEAATRRNDVAPTSKRHCKSLADLRESFGYKRAPLGEKSVNVLAAKTGVDTCAAKKS 600

Query: 601 VEPHTKKQRPIMNRSRHYVASPSSNDVQRQAVRTLS 636
           VEPHTKKQRPIMNRSRHYVASPSSNDVQRQAVRTLS
Sbjct: 601 VEPHTKKQRPIMNRSRHYVASPSSNDVQRQAVRTLS 636

>Sklu_1321.2 YOR033C, Contig c1321 793-2763
          Length = 656

 Score =  565 bits (1457), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/673 (48%), Positives = 403/673 (59%), Gaps = 62/673 (9%)

Query: 1   MGIQGLLPQLKSIQQPVTLVRYNGQTLAIDGYAWLHRAAHSCAEELALGRPTSKYLEFFV 60
           MGIQGLLPQLK IQQP TL RY+GQTLAIDGYAWLHRAAHSCA ELA  +PT+KYL+FF+
Sbjct: 1   MGIQGLLPQLKPIQQPATLRRYSGQTLAIDGYAWLHRAAHSCAMELATDQPTTKYLQFFI 60

Query: 61  KRLNMLQNRYNIRPYLVFDGDAITVKKDTXXXXXXXXXXXXXXALALWRSGEKRQAYEYF 120
           KRL ML++ +NI PYLVFDGD+I VKK+T               L LW  G+K+++ EYF
Sbjct: 61  KRLTMLRSTFNITPYLVFDGDSINVKKETDSKRREKRQENKERGLKLWHMGDKKRSLEYF 120

Query: 121 QKCVDVTPEMAKCVIEYCQVQNIDYVVAPFEADAQMVYLEKMGLVHGIISEDSDLLIFGC 180
           QKCV +TPEMAKCVIEYC+VQ + Y+VAPFEADAQMVYLE  G  HGIISEDSDLLIFGC
Sbjct: 121 QKCVAITPEMAKCVIEYCKVQKVQYIVAPFEADAQMVYLENHGFAHGIISEDSDLLIFGC 180

Query: 181 RRLITKLNDHGEGIEICSDDFQYLPHKFPLSQLSPEEMRIMVCLSGCDYTAGIPKVGLLT 240
           RRLITKLND+GE IEICSDDF +LP KFPL QL+ EE+R+MVCLSGCDYT+GIP+VGLLT
Sbjct: 181 RRLITKLNDYGECIEICSDDFNHLPSKFPLCQLNREEIRMMVCLSGCDYTSGIPQVGLLT 240

Query: 241 AMKLVRKHRTIDNIIKHIQREGKFAVPKDFVHEYQLATFAFQFQRVFCPQTNVITTLNVI 300
           AMKLV+K R +D I+  IQREGK  +P+DF  EYQLA FAFQFQRVFCP++  I TLNVI
Sbjct: 241 AMKLVKKFRNMDKILLSIQREGKLKIPQDFTQEYQLANFAFQFQRVFCPKSQRIVTLNVI 300

Query: 301 PEDLLGCSALFESIGRVISKETHAKEVIMDITKVDHEQHARIAWGELCPYNHEKDLVNRE 360
           PE L     +F+ +G+VISK+   K V+ D   +DH+ H  ++ GEL PY+  K LVNRE
Sbjct: 301 PETLYNNKLVFQCVGKVISKQHKIKTVVEDDDDIDHDLHRLVSLGELNPYDFHKPLVNRE 360

Query: 361 RKLQLSTKSEPIL---SRSTTSTVGKIDSFFGKXXXXXXXXXXXXXXXXXRAAIRKQEEK 417
            +LQL +KSEPIL     +  +    IDSFF +                    + K +E 
Sbjct: 361 HRLQLVSKSEPILINNRENENNKNNTIDSFFHRKKLST-------------PKMAKNQEI 407

Query: 418 QIE-ISRKLVSTVERRKLSRHNTPVVAGVG-MSRFFSKSFDGSAHEYSGNATS------- 468
            I+  + KL STVERRKL +    V   +G  S+FF+ +  G +    GNA         
Sbjct: 408 DIQNANNKLGSTVERRKLCK----VDDNLGSTSKFFATAKVGRS---VGNAREEKPEEEN 460

Query: 469 ------------APSVESSPPRXXXXXXXXXXXXXXXXXXXXXXXXIPTDIPSSLLSTDV 516
                        P V                                T+  SS    D+
Sbjct: 461 KTVVRLEQESIREPIVVVKEIEQENIQLSTTTTTTTAITRKRTETLTATEDGSSQDEDDI 520

Query: 517 ----PSSMVPTQVDVEASFLSEE--DSEILSEVDEAATRRNDVAPTSKRHCKSLADLRES 570
               PSSMVPTQVD + S   E+  +SE+LSEVDE   +R D     KR   S   LRE 
Sbjct: 521 ATEVPSSMVPTQVDPQESLCEEDESESEVLSEVDEIENQRAD-----KRQRTSAVGLREK 575

Query: 571 FGYKRAPLGEKSVNVLAAKTGVDTCAAKKSVEPHTK-KQRPIMN------RSRHYVASPS 623
           F Y ++ L  +    +           K S+    + +QRP +       RSR  V + S
Sbjct: 576 FSYNKSTLHAQEKGSVGCTRKSKLIVVKGSLPRSCEVQQRPALRRSVSGARSRIVVGTSS 635

Query: 624 SNDVQRQAVRTLS 636
            +     A+R+ S
Sbjct: 636 PSATPNPAIRSTS 648

>Scas_699.35
          Length = 709

 Score =  499 bits (1285), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 297/674 (44%), Positives = 379/674 (56%), Gaps = 91/674 (13%)

Query: 1   MGIQGLLPQLKSIQQPVTLVRYNGQTLAIDGYAWLHRAAHSCAEELALGRPTSKYLEFFV 60
           MGIQGLLPQLK IQ PV L RY GQTLAIDGYAWLHRAA SCA ELA+ +PT KYL+FF+
Sbjct: 1   MGIQGLLPQLKPIQNPVGLHRYEGQTLAIDGYAWLHRAACSCAYELAMEKPTQKYLQFFI 60

Query: 61  KRLNMLQNRYNIRPYLVFDGDAITVKKDTXXXXXXXXXXXXXXALALWRSGEKRQAYEYF 120
           K+ +ML+ ++NI PYLVFDGD+I VKK T              A  LW SGEK+ A +YF
Sbjct: 61  KKFSMLR-KFNIEPYLVFDGDSIPVKKGTELKRRERRVENRAIAERLWTSGEKKNAMDYF 119

Query: 121 QKCVDVTPEMAKCVIEYCQVQNIDYVVAPFEADAQMVYLEKMGLVHGIISEDSDLLIFGC 180
           QKCVD+TP+MAKCVI+YC+V  I+Y+VAPFEAD+QMVYLE+ G+V GIISEDSDLL+FGC
Sbjct: 120 QKCVDITPDMAKCVIDYCKVNQINYIVAPFEADSQMVYLEQTGIVQGIISEDSDLLVFGC 179

Query: 181 RRLITKLNDHGEGIEICSDDFQYLPHKFPLSQLSPEEMRIMVCLSGCDYTAGIPKVGLLT 240
           RRLITKLND+GE IEIC DDF  LP KFPL QL+ E  R +VCLSGCDYT GIPKVGL+T
Sbjct: 180 RRLITKLNDYGECIEICKDDFNKLPRKFPLGQLNMECFRTLVCLSGCDYTDGIPKVGLVT 239

Query: 241 AMKLVRKHRTIDNIIKHIQREGKFAVPKDFVHEYQLATFAFQFQRVFCPQTNVITTLNVI 300
           AMK+V K R +D I+  IQR+GK  +P  F  EY+LA +AFQ+QRVFCP +  I  LN I
Sbjct: 240 AMKMVYKLRNMDRILLSIQRDGKLKIPTTFKDEYKLANYAFQYQRVFCPISRRIVPLNKI 299

Query: 301 PEDLLGCSALF---ESIGRVISKETHAKEVIMDITKVDHEQHARIAWGELCPYNHEKDLV 357
           PE+      L    + IG VI +++  K+ +++   +DHE HARIA G+L PY+  + L 
Sbjct: 300 PEEKFTADDLIILSQCIGNVIHRDSQVKQCVINDEDIDHELHARIANGDLNPYDFHRPLT 359

Query: 358 NRERKLQLSTKSE---PILSRSTTSTVGKIDSFFGKXXXXXXXXXXXXXXXXXR------ 408
           NRE+KLQL +KSE    I S++   T G IDSFF K                 +      
Sbjct: 360 NREQKLQLVSKSEMGISIPSKNQGETKG-IDSFFKKTALKVTEKKAVNVVQNKKIPQFLS 418

Query: 409 -AAIRKQEEKQIEISRKLVSTVERRKLSRHNTPVV---AGVGMSRFFSKSFDGSAHEYSG 464
            ++     + +    R L + ++RRKLS  NT      +    S+FF+K   G       
Sbjct: 419 TSSFNINNKNKTHEGR-LEAMLKRRKLSNQNTKSQIEDSTTTSSKFFTK-LPGMTDVKIS 476

Query: 465 NATSAPSVESSPPRXXXXXXXXXXXXXXXXXXXXXXXXIPTDIPSSLLSTDVPSSMVPTQ 524
            +T + ++ S                            I T++P S L T VPSS     
Sbjct: 477 TSTVSQNLSSE---------------------------IETEVPESELPTQVPSSFTRIT 509

Query: 525 VDV------------EASFLSEEDSEILSEVD----------------EAATRRNDVAPT 556
            D             E +   + DSEIL+EVD                E+    +D+ P 
Sbjct: 510 PDTVTDNDDEDAKDEEETKFEDGDSEILNEVDSEEEELIVKKKEIPPIESEGVVDDMIPE 569

Query: 557 SKRHCKSLADLRESFGYK-------RAPLGEK---------SVNVLAAKTGVDTCAAKKS 600
           ++    SL   R SF  K       R PL  +         SVNV    + +     K  
Sbjct: 570 TRVSSGSLQRFRYSFTEKLKTELIERKPLEPQHPNKYNRFVSVNVKREASDMVEAGPKTG 629

Query: 601 VEPHTKKQRPIMNR 614
            E   +KQR +  R
Sbjct: 630 EEAVKEKQRTLTAR 643

>YOR033C (EXO1) [4845] chr15 complement(392415..394523)
           Double-stranded DNA 5'->3' exonuclease, involved in
           mismatch repair and recombination [2109 bp, 702 aa]
          Length = 702

 Score =  483 bits (1244), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 265/567 (46%), Positives = 338/567 (59%), Gaps = 50/567 (8%)

Query: 1   MGIQGLLPQLKSIQQPVTLVRYNGQTLAIDGYAWLHRAAHSCAEELALGRPTSKYLEFFV 60
           MGIQGLLPQLK IQ PV+L RY G+ LAIDGYAWLHRAA SCA ELA+G+PT KYL+FF+
Sbjct: 1   MGIQGLLPQLKPIQNPVSLRRYEGEVLAIDGYAWLHRAACSCAYELAMGKPTDKYLQFFI 60

Query: 61  KRLNMLQNRYNIRPYLVFDGDAITVKKDTXXXXXXXXXXXXXXALALWRSGEKRQAYEYF 120
           KR ++L+  + + PYLVFDGDAI VKK T              A  LW  GEK+ A +YF
Sbjct: 61  KRFSLLKT-FKVEPYLVFDGDAIPVKKSTESKRRDKRKENKAIAERLWACGEKKNAMDYF 119

Query: 121 QKCVDVTPEMAKCVIEYCQVQNIDYVVAPFEADAQMVYLEKMGLVHGIISEDSDLLIFGC 180
           QKCVD+TPEMAKC+I YC++  I Y+VAPFEAD+QMVYLE+  +V GIISEDSDLL+FGC
Sbjct: 120 QKCVDITPEMAKCIICYCKLNGIRYIVAPFEADSQMVYLEQKNIVQGIISEDSDLLVFGC 179

Query: 181 RRLITKLNDHGEGIEICSDDFQYLPHKFPLSQLSPEEMRIMVCLSGCDYTAGIPKVGLLT 240
           RRLITKLND+GE +EIC D+F  LP KFPL  L+ EE+  MVCLSGCDYT GIPKVGL+T
Sbjct: 180 RRLITKLNDYGECLEICRDNFIKLPKKFPLGSLTNEEIITMVCLSGCDYTNGIPKVGLIT 239

Query: 241 AMKLVRKHRTIDNIIKHIQREGKFAVPKDFVHEYQLATFAFQFQRVFCPQTNVITTLNVI 300
           AMKLVR+  TI+ II  IQREGK  +P  +++EY+ A  AFQFQRVFCP    I +LN I
Sbjct: 240 AMKLVRRFNTIERIILSIQREGKLMIPDTYINEYEAAVLAFQFQRVFCPIRKKIVSLNEI 299

Query: 301 PEDLLGCSA----LFESIGRVISKETHAKEVIMDITKVDHEQHARIAWGELCPYNHEKDL 356
           P  L    +    L+  IG VI +ET  K+++     +DH  H +IA G+L PY+  + L
Sbjct: 300 PLYLKDTESKRKRLYACIGFVIHRETQKKQIVHFDDDIDHHLHLKIAQGDLNPYDFHQPL 359

Query: 357 VNRERKLQLSTKSEPILSRSTTST----VGKIDSFFGKXXXXXXXXXXXXXXXXXRAAIR 412
            NRE KLQL++KS     ++ T+     V  I+SFF K                 R A  
Sbjct: 360 ANREHKLQLASKSNIEFGKTNTTNSEAKVKPIESFFQKMTKLDHNPKVANNIHSLRQA-- 417

Query: 413 KQEEKQIEISRKLVSTVERRKLSRHNTPVVAGV---GMSRFFSKSFDGSAHEYSGNATSA 469
                      KL   ++RRKLS  N  VV        S+FF+K        +     S 
Sbjct: 418 ---------EDKLTMAIKRRKLS--NANVVQETLKDTRSKFFNKPSMTVVENFKEKGDSI 466

Query: 470 PSVESSPPRXXXXXXXXXXXXXXXXXXXXXXXXIPTDIPSSLLSTDVPSSMVPTQVDVEA 529
              +                             +   +  S LST +PSS + T ++ + 
Sbjct: 467 QDFKED----------------------TNSQSLEEPVSESQLSTQIPSSFITTNLEDDD 504

Query: 530 SFLSEEDSEILSEVDEAATRRNDVAPT 556
           + LSEE SE++S+++E   R+N    T
Sbjct: 505 N-LSEEVSEVVSDIEE--DRKNSEGKT 528

>AER387C [2887] [Homologous to ScYOR033C (EXO1) - SH; ScYDR263C
           (DIN7) - SH] (1363438..1365405) [1968 bp, 655 aa]
          Length = 655

 Score =  479 bits (1233), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 222/363 (61%), Positives = 269/363 (74%)

Query: 1   MGIQGLLPQLKSIQQPVTLVRYNGQTLAIDGYAWLHRAAHSCAEELALGRPTSKYLEFFV 60
           MGI GLLPQLK IQQPVTL RY  Q LAIDGYAWLHR+AHSCA EL +G+PT KYL+FFV
Sbjct: 1   MGIAGLLPQLKCIQQPVTLHRYRSQALAIDGYAWLHRSAHSCATELGMGQPTEKYLQFFV 60

Query: 61  KRLNMLQNRYNIRPYLVFDGDAITVKKDTXXXXXXXXXXXXXXALALWRSGEKRQAYEYF 120
           KRL +L+++Y+I PYLVFDG  I VK  T              A+ LW  GE+R+++EYF
Sbjct: 61  KRLTILRDQYDIEPYLVFDGAGIKVKAGTEAKRHEKRAESRARAIDLWEKGERRKSFEYF 120

Query: 121 QKCVDVTPEMAKCVIEYCQVQNIDYVVAPFEADAQMVYLEKMGLVHGIISEDSDLLIFGC 180
           QKCVD+TPEM K +I+YC      YVVAP+EAD Q+VYLEK GLV GIISEDSDLL+FGC
Sbjct: 121 QKCVDITPEMTKVIIDYCIGAGFKYVVAPYEADPQLVYLEKSGLVQGIISEDSDLLVFGC 180

Query: 181 RRLITKLNDHGEGIEICSDDFQYLPHKFPLSQLSPEEMRIMVCLSGCDYTAGIPKVGLLT 240
           RRLITKLND+GEG EIC DDF +LP KFPL+ L    +R MVCL+GCDYT GIP+VGLLT
Sbjct: 181 RRLITKLNDYGEGFEICRDDFVHLPDKFPLNSLGESGLRTMVCLAGCDYTKGIPQVGLLT 240

Query: 241 AMKLVRKHRTIDNIIKHIQREGKFAVPKDFVHEYQLATFAFQFQRVFCPQTNVITTLNVI 300
           A+KLV KH+T+D I+  I+REGK+ VP +F+ EY+ A  AFQFQRV+CP  N +TTLN +
Sbjct: 241 AVKLVVKHKTMDQILLTIKREGKWKVPAEFLDEYRFADLAFQFQRVYCPLKNQLTTLNEV 300

Query: 301 PEDLLGCSALFESIGRVISKETHAKEVIMDITKVDHEQHARIAWGELCPYNHEKDLVNRE 360
           P  L     L+E IG  + K T  + VI D   +DHE H RIA G+L P NH++ L+NRE
Sbjct: 301 PSTLREDPILYECIGHAVHKITGERCVISDDMMIDHEIHTRIAIGQLNPCNHKQALINRE 360

Query: 361 RKL 363
           R+L
Sbjct: 361 RQL 363

>CAGL0H08085g 786770..788794 similar to sp|P39875 Saccharomyces
           cerevisiae YOR033c DHS1 or sp|Q12086 Saccharomyces
           cerevisiae YDR263c DIN7, start by similarity
          Length = 674

 Score =  478 bits (1231), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 257/569 (45%), Positives = 340/569 (59%), Gaps = 44/569 (7%)

Query: 1   MGIQGLLPQLKSIQQPVTLVRYNGQTLAIDGYAWLHRAAHSCAEELALGRPTSKYLEFFV 60
           MGIQGLLPQLK IQ PV+L RY GQTL IDGYAWLHRA+ SCA ELA+G PT KYL+FF+
Sbjct: 1   MGIQGLLPQLKPIQNPVSLRRYEGQTLGIDGYAWLHRASCSCAYELAMGLPTEKYLKFFI 60

Query: 61  KRLNMLQNRYNIRPYLVFDGDAITVKKDTXXXXXXXXXXXXXXALALWRSGEKRQAYEYF 120
           KR NML++ + + PYLVFDGD+I VK++T              A+ LW+SG KR A +YF
Sbjct: 61  KRFNMLKS-FGVTPYLVFDGDSINVKQETNKKRREKRQENREIAMRLWQSGNKRNAMDYF 119

Query: 121 QKCVDVTPEMAKCVIEYCQVQNIDYVVAPFEADAQMVYLEKMGLVHGIISEDSDLLIFGC 180
           QKCVDVTPEM KCVI+YC+   I Y+VAPFEAD QMVYLEK GL+ GII+EDSDLL+FGC
Sbjct: 120 QKCVDVTPEMVKCVIDYCKNNGIKYIVAPFEADPQMVYLEKKGLIQGIIAEDSDLLVFGC 179

Query: 181 RRLITKLNDHGEGIEICSDDFQYLPHKFPLSQLSPEEMRIMVCLSGCDYTAGIPKVGLLT 240
           RRL+TKLND GE IEIC D F  L  KFP+ QLS EE+R+MVCLSGCDYT GIP++GL+ 
Sbjct: 180 RRLVTKLNDFGECIEICRDSFGQLTSKFPIGQLSNEEIRMMVCLSGCDYTNGIPRIGLIK 239

Query: 241 AMKLVRKHRTIDNIIKHIQREGKFAVPKDFVHEYQLATFAFQFQRVFCPQTNVITTLNVI 300
           A+KLV  HR +D I+  +Q EGKF+VP++F  EY+ A ++FQFQRVFCP +  I +L  I
Sbjct: 240 AIKLVMTHRNMDRILMSLQTEGKFSVPENFYDEYRYADYSFQFQRVFCPLSKQIVSLTEI 299

Query: 301 PEDLLGCSALFESIGRVISKETHAKEVIMDITKVDHEQHARIAWGELCPYNHEKDLVNRE 360
           P  L     L   IG+ I +    K   ++  ++DHE H  +A G+L PY+  K LVNRE
Sbjct: 300 PMGLQSDKILHSCIGKAICRLDGTKRYCLN-DEIDHEIHGYLARGDLNPYDFTKRLVNRE 358

Query: 361 RKLQLSTKSEPILS-----RSTTSTVGKIDSFFGKXXXXXXXXXXXXXXXXXRAAIRKQE 415
            KLQL +KS+  ++        +  V  ID+FF                     +  KQ 
Sbjct: 359 HKLQLQSKSDMSITYDPSNEQKSRKVLSIDTFFSSVPEIKGQG----------TSSNKQP 408

Query: 416 EKQIEISRKLVSTVERRKLSRH---NTPVVAGVGMSRFFSKSFDGSAHEYSGNATSAPSV 472
             +  + +K    +  RKL R    N  V      S+FF+ + + ++     N  +  S+
Sbjct: 409 VYEDFVEKKYTQLISNRKLGRKSDCNNKVT-----SKFFTSNQESNSRTAGLNGCNLNSI 463

Query: 473 ESSPPRXXXXXXXXXXXXXXXXXXXXXXXXIPTDIPSSLLSTDVPSSMVPTQVDVE-ASF 531
           E +  +                          TD+P S L T V +   PT+  +  AS 
Sbjct: 464 EQATEKIIISDNESE-----------------TDLPESELPTQVEAQNTPTEFSLSIASS 506

Query: 532 LSEEDSEILSEVDEAATRRNDVAPTSKRH 560
            S+  S+  +   E  ++R+++  TS+ H
Sbjct: 507 QSKSTSDGFNSF-EVTSQRDEIGNTSEEH 534

>KLLA0E16797g 1487301..1489316 some similarities with sp|P39875
           Saccharomyces cerevisiae YOR033c DHS1 exonuclease which
           interacts with MSH2P, hypothetical start
          Length = 671

 Score =  472 bits (1214), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 224/370 (60%), Positives = 277/370 (74%), Gaps = 2/370 (0%)

Query: 1   MGIQGLLPQLKSIQQPVTLVRYNGQTLAIDGYAWLHRAAHSCAEELALGRPTSKYLEFFV 60
           MG+ GLLPQLK IQ PV+L RY G+TLAIDGYAWLHR+AHSCA ELA+ +PT KYL+FF+
Sbjct: 1   MGVSGLLPQLKPIQNPVSLARYQGETLAIDGYAWLHRSAHSCAMELAMDQPTDKYLQFFI 60

Query: 61  KRLNMLQNRYNIRPYLVFDGDAITVKKDTXXXXXXXXXXXXXXALALWRSGEKRQAYEYF 120
           KR++ML++ + I P+ VFDGD+I VKK+T              A AL+ +G++R AY+YF
Sbjct: 61  KRISMLRH-FKITPFFVFDGDSIQVKKETELKRAEKRKENREKAHALFEAGDRRLAYDYF 119

Query: 121 QKCVDVTPEMAKCVIEYCQVQNIDYVVAPFEADAQMVYLEKMGLVHGIISEDSDLLIFGC 180
           QKCV +TP+MAKCVIEY Q+ +I YVVAP+EADAQMVYLEK GLV GIISEDSDLL+FGC
Sbjct: 120 QKCVSITPDMAKCVIEYLQMNSIPYVVAPYEADAQMVYLEKQGLVQGIISEDSDLLVFGC 179

Query: 181 RRLITKLNDHGEGIEICSDDFQYLPH-KFPLSQLSPEEMRIMVCLSGCDYTAGIPKVGLL 239
            RLITKLND+ E IEI   +F+ L   KFPLS+L+ +++R +VCLSGCDYT+GIPKVGL+
Sbjct: 180 TRLITKLNDNAECIEIDRRNFERLNEGKFPLSKLTEDQLRSLVCLSGCDYTSGIPKVGLV 239

Query: 240 TAMKLVRKHRTIDNIIKHIQREGKFAVPKDFVHEYQLATFAFQFQRVFCPQTNVITTLNV 299
           TAMK V K+RT++ +I  I+REGK +VP  F  EYQ A FAFQFQRV+CP    + TLN 
Sbjct: 240 TAMKYVVKNRTMEQMIMAIKREGKLSVPHTFWEEYQYANFAFQFQRVWCPLNERLVTLNA 299

Query: 300 IPEDLLGCSALFESIGRVISKETHAKEVIMDITKVDHEQHARIAWGELCPYNHEKDLVNR 359
           IP +LL    LF  IG  I KE   K+VI D   VDH  H RI+ GEL PY+  K LVNR
Sbjct: 300 IPNELLNNEKLFNCIGHAIHKEWKIKDVIFDFEDVDHHLHKRISLGELNPYDFNKPLVNR 359

Query: 360 ERKLQLSTKS 369
           E KL+L ++S
Sbjct: 360 EHKLRLKSQS 369

>YDR263C (DIN7) [1096] chr4 complement(994234..995526) Mitochondrial
           inner membrane nuclease with a role in stabilizing the
           mitochondrial genome, expression is induced by DNA
           damage [1293 bp, 430 aa]
          Length = 430

 Score =  412 bits (1059), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 193/368 (52%), Positives = 261/368 (70%), Gaps = 5/368 (1%)

Query: 1   MGIQGLLPQLKSIQQPVTLVRYNGQTLAIDGYAWLHRAAHSCAEELALGRPTSKYLEFFV 60
           MGI GLLPQLK IQ+ V+L +Y  QTLAIDGYAWLHRA+ +CA EL + +PT+KYL+FF+
Sbjct: 1   MGIPGLLPQLKRIQKQVSLKKYMYQTLAIDGYAWLHRASCACAFELVMNKPTNKYLQFFI 60

Query: 61  KRLNMLQNRYNIRPYLVFDGDAITVKKDTXXXXXXXXXXXXXXALALWRSGEKRQAYEYF 120
           KRL +L+ R  I+PY+VFDGD++ VK  T              A  LW +G +  A EYF
Sbjct: 61  KRLQLLK-RLKIKPYIVFDGDSLFVKNHTETRRRKKRLENEMIAKKLWSAGNRYNAMEYF 119

Query: 121 QKCVDVTPEMAKCVIEYCQVQNIDYVVAPFEADAQMVYLEKMGLVHGIISEDSDLLIFGC 180
           QK VD+TPEMAKC+I+YC++ +I Y+VAPFEAD QMVYLEKMGL+ GIISEDSDLL+FGC
Sbjct: 120 QKSVDITPEMAKCIIDYCKLHSIPYIVAPFEADPQMVYLEKMGLIQGIISEDSDLLVFGC 179

Query: 181 RRLITKLNDHGEGIEICSDDFQYLPHKFPLSQLSPEEMRIMVCLSGCDYTAGIPKVGLLT 240
           + LITKLND G+ +EI  DDF  LP  FPL +LS ++ R +VCL+GCDYT+GI KVG++T
Sbjct: 180 KTLITKLNDQGKALEISKDDFSALPENFPLGELSEQQFRNLVCLAGCDYTSGIWKVGVVT 239

Query: 241 AMKLVRKHRTIDNIIKHIQREGKFAVPKDFVHEYQLATFAFQFQRVFCPQTNVITTLNVI 300
           AMK+V+++  + +I+  I+R  K    K F  + + A +AFQ+QRVFCP +N ITTLN I
Sbjct: 240 AMKIVKRYSEMKDILIQIERTEKLCFSKAFKQQVEFANYAFQYQRVFCPLSNQITTLNNI 299

Query: 301 PEDLLGCSA----LFESIGRVISKETHAKEVIMDITKVDHEQHARIAWGELCPYNHEKDL 356
           P+ +    A    + + IG V+ + +  ++ +++   +DH+ H  IA GEL P +    L
Sbjct: 300 PKAVTNSHAEIIKIMKCIGSVVERGSGVRKDVINTKNIDHKVHEMIAKGELHPVDMASKL 359

Query: 357 VNRERKLQ 364
           +NRERKL+
Sbjct: 360 INRERKLK 367

>Scas_538.6
          Length = 412

 Score =  387 bits (995), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 189/384 (49%), Positives = 266/384 (69%), Gaps = 15/384 (3%)

Query: 1   MGIQGLLPQLKSIQQPVTLVRYNGQTLAIDGYAWLHRAAHSCAEELALGRPTSKYLEFFV 60
           MG+ GLLP LK+IQ+ VTL +Y G TL ID Y+WLH+AA SCA ELA+ +PT KYL++F+
Sbjct: 1   MGVAGLLPHLKTIQKHVTLKKYAGMTLGIDAYSWLHKAACSCAYELAMDKPTEKYLQYFI 60

Query: 61  KRLNMLQNRYNIRPYLVFDGDAITVKKDTXXXXXXXXXXXXXXALALWRSGEKRQAYEYF 120
           ++ N+++ + NI+PYL+FDGDAI VK +                  LWR GE++ A E+F
Sbjct: 61  RKFNLMK-KLNIKPYLIFDGDAILVKGEVESSRLNKRKTNKLMGEKLWRIGERKAATEFF 119

Query: 121 QKCVDVTPEMAKCVIEYCQVQNIDYVVAPFEADAQMVYLEKMGLVHGIISEDSDLLIFGC 180
           QK V++T +MAK +I YC+  +I YVVAPFEAD+QMVYLEK   V GIISEDSDL++FG 
Sbjct: 120 QKSVNITTQMAKHIINYCRENSIQYVVAPFEADSQMVYLEKTVQVQGIISEDSDLIVFGS 179

Query: 181 RRLITKLNDHGEGIEICSDDFQYLPHKFPLSQLSPEEMRIMVCLSGCDYTAGIPKVGLLT 240
           +RLITKLN+ GE IEI S DF  L  KFP  +LS +++R++VCLSGCDYT GI K+GL+T
Sbjct: 180 KRLITKLNEFGECIEIASCDFGDLTGKFPFGELSMDQIRMLVCLSGCDYTVGIWKIGLVT 239

Query: 241 AMKLVRKHRTIDNIIKHIQREGKFAVPKDFVHEYQLATFAFQFQRVFCPQTNVITTLNVI 300
           A+KLVR+   +D+I+ HI+  GK+++  +F+ EY+ A ++FQ+QRVF P+ N I TLN I
Sbjct: 240 AIKLVRQFDNMDDIVNHIKESGKYSLNCNFLQEYKYANYSFQYQRVFDPKENRIVTLNRI 299

Query: 301 PEDL------LGCSALFESIGRVISKETHAKEVIMDITKVDHEQHARIAWGELCPYNHEK 354
           P +L      LG     + IG VISK++  K ++++   +DH  H  IA G+L P+N ++
Sbjct: 300 PTELKNDRKELGIVG--QCIGNVISKKSGIKSIVVNDDDIDHNIHTMIANGDLDPHNWKE 357

Query: 355 DLVNR------ERKLQLSTKSEPI 372
            L++R      ER + L+  + P+
Sbjct: 358 TLISREEYLHSERSITLNNLTNPL 381

>Kwal_26.7687
          Length = 380

 Score = 80.1 bits (196), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 78/285 (27%), Positives = 131/285 (45%), Gaps = 24/285 (8%)

Query: 1   MGIQGLLPQLKSIQQPVTLVR-----YNGQTLAIDG----YAWLHRAAHSCAEELAL--G 49
           MGI+GL   + S   P  + +     + G+ +AID     Y +L         +LA   G
Sbjct: 1   MGIKGL-NAIISEHVPTAVRKSEIKHFFGRKVAIDASMSLYQFLIAVRQQDGVQLASESG 59

Query: 50  RPTSKYLEFFVKRLNMLQNRYNIRPYLVFDGDAITVKKDTXXXXXXXXXXXXXXALALWR 109
             TS  +  F + L M+ N   I+P  VFDG    +K                    L  
Sbjct: 60  ETTSHLMGIFYRTLRMIDN--GIKPCYVFDGKPPILKSHELDKRSARRATTEEK---LKE 114

Query: 110 SGEKRQAYEYFQKCVDVTPEMAKCVIEYCQVQNIDYVVAPFEADAQMVYLEKMGLVHGII 169
           + E+ +  ++ ++ V VTPE      +  ++  + YV AP EA+AQ   L K G V+   
Sbjct: 115 AVEEAEKLKHERRLVRVTPEHNDEAKKLLRLMGLPYVEAPCEAEAQCAELAKAGKVYAAA 174

Query: 170 SEDSDLLIFGCRRLITKLN-DHGEGIEICSDDFQYLPHKFPLSQLSPEEMRIMVCLSGCD 228
           SED D L +    L+  L     +   I   + + L     L+     ++ IM+   GCD
Sbjct: 175 SEDMDTLCYRTPYLLRHLTFSEAKKEPIHEINVEVLLQGLELTIEQFIDLGIML---GCD 231

Query: 229 YTAGIPKVGLLTAMKLVRKHRTIDNIIKHIQR---EGKFAVPKDF 270
           Y   I  VG +TA+KL+++H+T++NI+++I+      K+ +P+++
Sbjct: 232 YCDSIRGVGPVTALKLIKEHKTLENIVQYIESGEANTKWKIPENW 276

>KLLA0F02992g 278441..279586 similar to sp|P26793 Saccharomyces
           cerevisiae YKL113c RAD27 ssDNA endonuclease and 5 -3
           exonuclease, start by similarity
          Length = 381

 Score = 73.9 bits (180), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 77/286 (26%), Positives = 129/286 (45%), Gaps = 25/286 (8%)

Query: 1   MGIQGLLPQLKSIQQPVTL----VRY-NGQTLAIDG----YAWLHRAAHSCAEELAL--G 49
           MGI+ L   L S Q P  +    ++Y +G+ +AID     Y +L         +LA   G
Sbjct: 1   MGIKNL-ATLISEQVPNAIKSRDIKYFHGRKVAIDASMSLYQFLIAVRQQDGVQLAGEDG 59

Query: 50  RPTSKYLEFFVKRLNMLQNRYNIRPYLVFDGDAITVKKDTXXXXXXXXXXXXXXALALWR 109
             TS  +  F + L M+   + I+P  VFDG    +KK                   L  
Sbjct: 60  ETTSHLMGMFYRTLRMID--HGIKPCYVFDGSPPELKK---YELDKRKVRREDTEAKLKE 114

Query: 110 SGEKRQAYEYFQKCVDVTPEMAKCVIEYCQVQNIDYVVAPFEADAQMVYLEKMGLVHGII 169
           + E+ +  ++ ++ V V P   +   +   +  I YVVAP EA+AQ   L K G V    
Sbjct: 115 ATEQAEIIKHERRLVKVLPWHNEEAQKLLSLMGIPYVVAPAEAEAQCAELAKSGKVFAAA 174

Query: 170 SEDSDLLIFGCRRLITKLN-DHGEGIEICSDDFQYLPHKFPLSQLSPEEMRIMVCLSGCD 228
           SED D L +    L+  L       + I   D   + +   L+Q    ++ I++   GCD
Sbjct: 175 SEDMDTLCYQTPVLLRHLTFSEARKLPIQEFDTDVIYNTLDLTQTQFIDLGIIL---GCD 231

Query: 229 YTAGIPKVGLLTAMKLVRKHRTIDNIIKHIQR----EGKFAVPKDF 270
           Y  GI  VG + A+KL+++H +++ I++  +      G++ +P+ +
Sbjct: 232 YCEGIKGVGPVNALKLIKEHGSLEAIVEKFENGDISSGRWKIPEGW 277

>Sklu_2149.2 YKL113C, Contig c2149 861-2006 reverse complement
          Length = 381

 Score = 73.2 bits (178), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 82/289 (28%), Positives = 127/289 (43%), Gaps = 32/289 (11%)

Query: 1   MGIQGLLPQLKSIQQPVTLVR-----YNGQTLAIDG----YAWLHRAAHSCAEELAL--G 49
           MGI+GL   + S   P  + +     + G+ +AID     Y +L         +LA   G
Sbjct: 1   MGIKGL-NAIISEHVPTAIRKSEIKSFFGRKVAIDASMSLYQFLIAVRQQDGVQLASESG 59

Query: 50  RPTSKYLEFFVKRLNMLQNRYNIRPYLVFDGDAITVKKDTXXXXXXXXXXXXXXALALWR 109
             TS  +  F + L M+ N   I+P  VFDG   T+K                   A   
Sbjct: 60  ETTSHLMGMFYRTLRMVDN--GIKPCYVFDGKPPTLKSHELGKRSQKRDETQKKLEAATD 117

Query: 110 SGEKRQAYEYFQKCVDVTP---EMAKCVIEYCQVQNIDYVVAPFEADAQMVYLEKMGLVH 166
             EKR    + ++ V VTP   E AK ++E   +  I YV AP EA+AQ   L K   V+
Sbjct: 118 EAEKRM---HERRLVKVTPLHNEEAKRLLE---LMGIPYVNAPGEAEAQCAALAKADKVY 171

Query: 167 GIISEDSDLLIFGCRRLITKLNDHGEGIEICSDDFQYLPHKFPLS--QLSPEEMRIMVCL 224
              SED D L +    L+  L       E   +    +  +  L    L+ E+   +  +
Sbjct: 172 AAASEDMDTLCYRTPFLLRHLTFS----EAKKEPIHEIDTELVLKGLDLTLEQFIDLCIM 227

Query: 225 SGCDYTAGIPKVGLLTAMKLVRKHRTIDNIIKHIQR---EGKFAVPKDF 270
            GCDY   I  VG +TA+KL+++H ++D I++ I+      K+ +P+ +
Sbjct: 228 LGCDYCDNIRGVGPVTALKLIKEHGSLDKIVEFIESGEANNKWKIPEHW 276

>CAGL0K11506g 1114740..1115885 highly similar to sp|P26793
           Saccharomyces cerevisiae YKL113c RAD27 ssDNA
           endonuclease and 5 -3 exonuclease, start by similarity
          Length = 381

 Score = 71.2 bits (173), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 75/291 (25%), Positives = 126/291 (43%), Gaps = 36/291 (12%)

Query: 1   MGIQGL----LPQLKSIQQPVTLVRYNGQTLAIDG----YAWLHRAAHSCAEELAL--GR 50
           MGI+GL       + S  +   +  + G+ +AID     Y +L         +L+   G 
Sbjct: 1   MGIKGLNSIITEHVPSAIRKSDIKAFFGRKVAIDASMSLYQFLIAVRQQDGGQLSTETGE 60

Query: 51  PTSKYLEFFVKRLNMLQNRYNIRPYLVFDGDAITVKKDTXXXXXXXXXXXXXXALALWRS 110
            TS  +  F + L M+ N   I+P  VFDG    +K                    L  +
Sbjct: 61  TTSHLMGMFYRTLRMIDN--GIKPCYVFDGKPPVLKSHELDKRTSRREETEKK---LAEA 115

Query: 111 GEKRQAYEYFQKCVDVTPEMAKCVIEYCQVQNIDYVVAPFEADAQMVYLEKMGLVHGIIS 170
            E+ +  ++ ++ V V+ E      +  ++  I YV AP EA+AQ   L K G V+   S
Sbjct: 116 TEEAEKMKHERRLVKVSKEHNDEAKKLLELMGIPYVNAPGEAEAQCAELAKKGKVYAAAS 175

Query: 171 EDSDLLIFGCRRLITKLN--------DHGEGIEICSDDFQYLPHKFPLSQLSPEEMRIMV 222
           ED D L +    L+  L          H    EI     +    +F        ++ IM+
Sbjct: 176 EDMDTLCYRTPYLLRHLTFSEARKEPIHEINTEIVLQGLELTIDQFI-------DLGIML 228

Query: 223 CLSGCDYTAGIPKVGLLTAMKLVRKHRTIDNIIKHIQR---EGKFAVPKDF 270
              GCDY   I  VG +TA+KL+++H +++ I+++I+      K+ VP+++
Sbjct: 229 ---GCDYCDSIKGVGPVTALKLMKEHGSLEKIVEYIESGEANNKWKVPENW 276

>Scas_717.64
          Length = 379

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 78/287 (27%), Positives = 132/287 (45%), Gaps = 28/287 (9%)

Query: 1   MGIQGLLPQLKSIQQPVTLVR-----YNGQTLAIDG----YAWLHRAAHSCAEELA--LG 49
           MGI+GL   + S   P+ + +     + G+ +AID     Y +L         +L    G
Sbjct: 1   MGIKGLTAII-SENAPLAIRKSEIKAFFGRKVAIDASMSLYQFLIAVRQQDGGQLTNEAG 59

Query: 50  RPTSKYLEFFVKRLNMLQNRYNIRPYLVFDGDAITVKK-DTXXXXXXXXXXXXXXALALW 108
             TS  +  F + L M+ N   I+P  VFDG   T+K  +               A A+ 
Sbjct: 60  ETTSHLMGMFYRTLRMIDN--GIKPCYVFDGKPPTLKSHELSKRTSRREETEKKLAEAVD 117

Query: 109 RSGEKRQAYEYFQKCVDVTPEMAKCVIEYCQVQNIDYVVAPFEADAQMVYLEKMGLVHGI 168
           ++ + +Q     ++ V V+ E      +  ++  I YV AP EA++Q   L K G V+  
Sbjct: 118 QAEKMKQE----RRLVKVSKEHNDEAKKLLELMGIPYVNAPGEAESQCAELAKKGKVYAA 173

Query: 169 ISEDSDLLIFGCRRLITKLNDHGEGIEICSDDFQYLPHKFPLS--QLSPEEMRIMVCLSG 226
            SED D L +    L+  L       E   +  Q +  +  L    L+ E+   +  + G
Sbjct: 174 ASEDMDTLCYRTPYLLRHLTFS----EAKKEPIQEINTEQVLQGLDLTLEQFIDLGIMLG 229

Query: 227 CDYTAGIPKVGLLTAMKLVRKHRTIDNIIKHIQR-EG--KFAVPKDF 270
           CDY   I  VG +TA+KL+++H +++ I++ I+  EG  K+ VP+++
Sbjct: 230 CDYCDNIRGVGPVTALKLIKEHGSLEKIVEFIESDEGNKKWKVPENW 276

>YKL113C (RAD27) [3150] chr11 complement(224373..225521)
           Single-stranded DNA endonuclease and 5'-3' exonuclease
           that functions in the MSH2-MLH1-PMS1-dependent mismatch
           repair system [1149 bp, 382 aa]
          Length = 382

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 75/296 (25%), Positives = 126/296 (42%), Gaps = 25/296 (8%)

Query: 1   MGIQGL----LPQLKSIQQPVTLVRYNGQTLAIDG----YAWLHRAAHSCAEELA--LGR 50
           MGI+GL       + S  +   +  + G+ +AID     Y +L         +L    G 
Sbjct: 1   MGIKGLNAIISEHVPSAIRKSDIKSFFGRKVAIDASMSLYQFLIAVRQQDGGQLTNEAGE 60

Query: 51  PTSKYLEFFVKRLNMLQNRYNIRPYLVFDGDAITVKKDTXXXXXXXXXXXXXXALALWRS 110
            TS  +  F + L M+ N   I+P  VFDG    +K                    L  +
Sbjct: 61  TTSHLMGMFYRTLRMIDN--GIKPCYVFDGKPPDLKSHELTKRSSRRVETEKK---LAEA 115

Query: 111 GEKRQAYEYFQKCVDVTPEMAKCVIEYCQVQNIDYVVAPFEADAQMVYLEKMGLVHGIIS 170
             + +  +  ++ V V+ E  +   +   +  I Y++AP EA+AQ   L K G V+   S
Sbjct: 116 TTELEKMKQERRLVKVSKEHNEEAQKLLGLMGIPYIIAPTEAEAQCAELAKKGKVYAAAS 175

Query: 171 EDSDLLIFGCRRLITKLN-DHGEGIEICSDDFQYLPHKFPLSQLSPEEMRIMVCLSGCDY 229
           ED D L +    L+  L     +   I   D + +        L+ E+   +  + GCDY
Sbjct: 176 EDMDTLCYRTPFLLRHLTFSEAKKEPIHEIDTELVLRGL---DLTIEQFVDLCIMLGCDY 232

Query: 230 TAGIPKVGLLTAMKLVRKHRTIDNIIKHIQ----REGKFAVPKDFVHEYQLATFAF 281
              I  VG +TA+KL++ H +I+ I++ I+       K+ +P+D+   Y+ A   F
Sbjct: 233 CESIRGVGPVTALKLIKTHGSIEKIVEFIESGESNNTKWKIPEDW--PYKQARMLF 286

>CAGL0F08327g complement(829426..832404) similar to sp|P07276
           Saccharomyces cerevisiae YGR258c RAD2 structure-specific
           nuclease of the nucleotide excision repairosome, start
           by similarity
          Length = 992

 Score = 68.6 bits (166), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 73/142 (51%), Gaps = 10/142 (7%)

Query: 125 DVTPEMAKCVIEYCQVQNIDYVVAPFEADAQMVYLEKMGLVHGIISEDSDLLIFGCRRLI 184
           +VT +M K V E      I Y+ AP EA+AQ   L  + LV GII++DSD+ +FG +++ 
Sbjct: 727 EVTMDMIKDVQELLARFGIPYITAPMEAEAQCAELVNLKLVDGIITDDSDVFLFGGKKVY 786

Query: 185 TKLNDHGEGIEI--CSDDFQYLPHKFPLSQLSPEEMRIMVCLSGCDYTAGIPKVGLLTAM 242
             +      +E     D +Q L        L+ E M  +  L G DYT GI  +G +++M
Sbjct: 787 KNMFQEKNYVEYYDSEDIYQGL-------GLTRETMIELAQLLGSDYTTGIKGMGPVSSM 839

Query: 243 KLVRKHRTIDNIIKHIQREGKF 264
           +++ +   + N  K    EG+F
Sbjct: 840 EILAEFGDLKN-FKRWYNEGQF 860

 Score = 33.1 bits (74), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 19/89 (21%), Positives = 40/89 (44%), Gaps = 2/89 (2%)

Query: 1  MGIQGLLPQLKSIQQPVTLVRYNGQTLAIDGYAWLHRAAHSCAEELALGRPTSKYLEFFV 60
          MG+      +    +PV L   + + +A+D   W+++   +  ++      ++    FF 
Sbjct: 1  MGVHSFWDIVGPTAKPVRLESLHDRRMAVDASIWIYQFLKAVRDKEGNAIKSAHITGFFR 60

Query: 61 KRLNMLQNRYNIRPYLVFDGDAITVKKDT 89
          +   +L   + I+P  VFDG    +K+ T
Sbjct: 61 RVCKLLY--FGIKPVFVFDGGVPVLKRKT 87

>AFR133C [3325] [Homologous to ScYGR258C (RAD2) - SH]
           (675260..678172) [2913 bp, 970 aa]
          Length = 970

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 38/142 (26%), Positives = 75/142 (52%), Gaps = 10/142 (7%)

Query: 125 DVTPEMAKCVIEYCQVQNIDYVVAPFEADAQMVYLEKMGLVHGIISEDSDLLIFGCRRLI 184
           +VTPEM + + +   +  I Y+ AP EA+AQ   L ++ L+ GII++DSD+ +FG  ++ 
Sbjct: 704 EVTPEMIRDIQQLLSIFGIPYLTAPMEAEAQCAELLRLKLIDGIITDDSDVFLFGGSKVF 763

Query: 185 TKLNDHGEGIEICSDDFQYLPHKFPLSQLSPEEMRIMVC--LSGCDYTAGIPKVGLLTAM 242
             +      +E       Y   +   ++L  + ++ +    L G DYT GI  +G ++ +
Sbjct: 764 KNMFQEKNYVE-------YYNTETISAELGLDRLKFIALAQLMGSDYTNGIKGIGPVSGI 816

Query: 243 KLVRKHRTIDNIIKHIQREGKF 264
           +++  + T++   +    EG+F
Sbjct: 817 EILANYNTLEE-FRTWYNEGQF 837

 Score = 37.0 bits (84), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 21/89 (23%), Positives = 41/89 (46%), Gaps = 2/89 (2%)

Query: 1  MGIQGLLPQLKSIQQPVTLVRYNGQTLAIDGYAWLHRAAHSCAEELALGRPTSKYLEFFV 60
          MG+  L   L    +PV L   +   +A+D   W+++   +  ++       +  + FF 
Sbjct: 1  MGVHALWDILGPTARPVKLESLSNNRMAVDASIWIYQFLKAARDKNGNRLKGAHIIGFFR 60

Query: 61 KRLNMLQNRYNIRPYLVFDGDAITVKKDT 89
          +   +L   + I+P  VFDG    +K++T
Sbjct: 61 RICKLLY--FGIKPVFVFDGGVPPLKRET 87

>Scas_645.8
          Length = 1000

 Score = 63.5 bits (153), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 39/140 (27%), Positives = 73/140 (52%), Gaps = 6/140 (4%)

Query: 125 DVTPEMAKCVIEYCQVQNIDYVVAPFEADAQMVYLEKMGLVHGIISEDSDLLIFGCRRLI 184
           +VTPEM + V E      + Y+ AP EA+AQ   L ++ LV G++++DSD+ +FG  ++ 
Sbjct: 735 EVTPEMIQDVQELLSRFGVPYITAPMEAEAQCAELLQLKLVDGVVTDDSDVFLFGGSKIY 794

Query: 185 TKLNDHGEGIEICSDDFQYLPHKFPLSQLSPEEMRIMVCLSGCDYTAGIPKVGLLTAMKL 244
             +      +E    D + +     L +   E M  +  L G DYT GI  +G ++++++
Sbjct: 795 KNMFHEKNYVEFY--DSESILRNLGLDR---ENMIELAELLGSDYTNGIKGMGPVSSLEV 849

Query: 245 VRKHRTIDNIIKHIQREGKF 264
           + +   +    ++   EG+F
Sbjct: 850 LAEFGNLKE-FRNWYNEGQF 868

 Score = 37.4 bits (85), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 21/89 (23%), Positives = 43/89 (48%), Gaps = 2/89 (2%)

Query: 1  MGIQGLLPQLKSIQQPVTLVRYNGQTLAIDGYAWLHRAAHSCAEELALGRPTSKYLEFFV 60
          MG+      +    +PV L     + +A+D   W+++   +  ++    R ++ ++  F 
Sbjct: 1  MGVHSFWDVVGPTARPVRLKSLQDKKMAVDASIWIYQFMKAVRDQDG-NRVSNSHITGFF 59

Query: 61 KRLNMLQNRYNIRPYLVFDGDAITVKKDT 89
          +R+  L   + I+P  VFDG    +K+DT
Sbjct: 60 RRICKLL-YFGIQPVFVFDGGVPALKRDT 87

>ABL052C [540] [Homologous to ScYKL113C (RAD27) - SH]
           (300564..301703) [1140 bp, 379 aa]
          Length = 379

 Score = 61.2 bits (147), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 75/277 (27%), Positives = 115/277 (41%), Gaps = 26/277 (9%)

Query: 1   MGIQGL----LPQLKSIQQPVTLVRYNGQTLAIDGYAWLH------RAAHSCAEELALGR 50
           MGI+GL      Q+ S  +P  + ++ G+ +AID    L+      R A       A G 
Sbjct: 1   MGIKGLNSIIQQQVPSAIRPREMKQFFGRRVAIDASMSLYQFLIAVRQADGVQLASADGE 60

Query: 51  PTSKYLEFFVKRLNMLQNRYNIRPYLVFDGDAITVK---KDTXXXXXXXXXXXXXXALAL 107
            TS  +  F + L M+   + ++P  VFDG    +K   K T              A   
Sbjct: 61  TTSHLMGMFYRTLWMVD--HGLKPCYVFDGSRRCLKAPPKLTKRTNAKEPEQKLAEADLN 118

Query: 108 WRSGEKR-QAYEYFQKCVDVTPEMAKCVIEYCQVQNIDYVVAPFEADAQMVYLEKMGLVH 166
            R  E R + +  +   +    E+A          +      P EA+AQ   L K G V 
Sbjct: 119 SRDYEARTRGWSRWSNGMWRGQEIAG------PDGHTRMWTLPGEAEAQCAELAKKGKVF 172

Query: 167 GIISEDSDLLIFGCRRLITKLN-DHGEGIEICSDDFQYLPHKFPLSQLSPEEMRIMVCLS 225
              SED D L +    L+  L         I   D + +     LSQ    ++ IM+   
Sbjct: 173 AAASEDMDTLCYRTPYLLRHLTFSEARKEPIHEIDTELVLQGLGLSQEQLVDLGIML--- 229

Query: 226 GCDYTAGIPKVGLLTAMKLVRKHRTIDNIIKHIQREG 262
           GCDY   I  VG +TA+KL+++H +++NI++ I   G
Sbjct: 230 GCDYCESIKGVGPVTALKLIKEHGSLENIVEFISSGG 266

>YGR258C (RAD2) [2205] chr7 complement(1007676..1010771)
           Structure-specific single-stranded DNA endonuclease of
           the nucleotide excision repairosome [3096 bp, 1031 aa]
          Length = 1031

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 69/140 (49%), Gaps = 6/140 (4%)

Query: 125 DVTPEMAKCVIEYCQVQNIDYVVAPFEADAQMVYLEKMGLVHGIISEDSDLLIFGCRRLI 184
           +VT +M K V E      I Y+ AP EA+AQ   L ++ LV GII++DSD+ +FG  ++ 
Sbjct: 766 EVTMDMIKEVQELLSRFGIPYITAPMEAEAQCAELLQLNLVDGIITDDSDVFLFGGTKIY 825

Query: 185 TKLNDHGEGIEICSDDFQYLPHKFPLSQLSPEEMRIMVCLSGCDYTAGIPKVGLLTAMKL 244
             +      +E     F        L  L  + M  +  L G DYT G+  +G ++++++
Sbjct: 826 KNMFHEKNYVE-----FYDAESILKLLGLDRKNMIELAQLLGSDYTNGLKGMGPVSSIEV 880

Query: 245 VRKHRTIDNIIKHIQREGKF 264
           + +   + N  K     G+F
Sbjct: 881 IAEFGNLKN-FKDWYNNGQF 899

 Score = 35.8 bits (81), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 21/89 (23%), Positives = 38/89 (42%), Gaps = 2/89 (2%)

Query: 1  MGIQGLLPQLKSIQQPVTLVRYNGQTLAIDGYAWLHRAAHSCAEELALGRPTSKYLEFFV 60
          MG+           +PV L     + +A+D   W+++   +  ++       S    FF 
Sbjct: 1  MGVHSFWDIAGPTARPVRLESLEDKRMAVDASIWIYQFLKAVRDQEGNAVKNSHITGFFR 60

Query: 61 KRLNMLQNRYNIRPYLVFDGDAITVKKDT 89
          +   +L   + IRP  VFDG    +K++T
Sbjct: 61 RICKLLY--FGIRPVFVFDGGVPVLKRET 87

>Kwal_23.4343
          Length = 1031

 Score = 59.3 bits (142), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 62/121 (51%), Gaps = 5/121 (4%)

Query: 125 DVTPEMAKCVIEYCQVQNIDYVVAPFEADAQMVYLEKMGLVHGIISEDSDLLIFGCRRLI 184
           +VT  M   V E      I Y+ AP EA+AQ   L  + LV GII++DSD+ +FG  ++ 
Sbjct: 763 EVTAAMVSEVQELLTRFGIPYMTAPMEAEAQCAELLALKLVDGIITDDSDIFLFGGDKVY 822

Query: 185 TKLNDHGEGIEICSDDFQYLPHKFPLSQLSPEEMRIMVCLSGCDYTAGIPKVGLLTAMKL 244
             +      +E    +   +  +  L +   E+   M  L G DYT+G+  VG ++AM++
Sbjct: 823 KNMFHEKNYVEYYVTEL--IKRELGLDR---EKFIEMAQLLGSDYTSGVKSVGPVSAMEI 877

Query: 245 V 245
           +
Sbjct: 878 L 878

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 42/89 (47%), Gaps = 2/89 (2%)

Query: 1  MGIQGLLPQLKSIQQPVTLVRYNGQTLAIDGYAWLHRAAHSCAEELALGRPTSKYLEFFV 60
          MG+  L   +    +PV L   + + LA+D   W+++   +  ++       S  + FF 
Sbjct: 1  MGVHALWDVIGPTAKPVRLESLSNKRLAVDASIWIYQFLKAVRDKEGNAMRYSHVIGFFR 60

Query: 61 KRLNMLQNRYNIRPYLVFDGDAITVKKDT 89
          +   +L   + I+P  VFDG A  +K+ T
Sbjct: 61 RICKLL--YFGIKPVFVFDGGAPALKRRT 87

>Sklu_2443.25 YGR258C, Contig c2443 54418-57519
          Length = 1033

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 67/140 (47%), Gaps = 6/140 (4%)

Query: 125 DVTPEMAKCVIEYCQVQNIDYVVAPFEADAQMVYLEKMGLVHGIISEDSDLLIFGCRRLI 184
           +VT  M K + E      I Y+ AP EA+AQ   L ++ LV GII++DSD+ +FG  R+ 
Sbjct: 767 EVTAVMIKEIQELLSRFGIPYITAPMEAEAQCAELIRLELVDGIITDDSDVFLFGGDRVY 826

Query: 185 TKLNDHGEGIEICSDDFQYLPHKFPLSQLSPEEMRIMVCLSGCDYTAGIPKVGLLTAMKL 244
             +      +E     F           L+ + M  +  L G DYT G+  +G +  M++
Sbjct: 827 KNMFHEKNYVE-----FYESGAILRDLGLNRDRMIELAQLLGSDYTEGVKGIGPVYGMEV 881

Query: 245 VRKHRTIDNIIKHIQREGKF 264
           + +   +   +K    EG+F
Sbjct: 882 LAEFGNLVK-LKEWYNEGQF 900

 Score = 34.7 bits (78), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 20/89 (22%), Positives = 40/89 (44%), Gaps = 2/89 (2%)

Query: 1  MGIQGLLPQLKSIQQPVTLVRYNGQTLAIDGYAWLHRAAHSCAEELALGRPTSKYLEFFV 60
          MG+      +    +PV L     + +A+D   W+++   +  ++       S  + FF 
Sbjct: 1  MGVYAFWDIVGPTARPVRLESLADKRMAVDASIWIYQFLKAVRDKEGNAMRHSHVVGFFR 60

Query: 61 KRLNMLQNRYNIRPYLVFDGDAITVKKDT 89
          +   +L   + I+P  +FDG A  +K+ T
Sbjct: 61 RVCKLLY--FGIKPVFIFDGGAPALKRQT 87

>KLLA0A09427g complement(821244..824279) similar to sp|P07276
           Saccharomyces cerevisiae YGR258c RAD2 structure-specific
           nuclease of the nucleotide excision repairosome, start
           by similarity
          Length = 1011

 Score = 56.2 bits (134), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 38/140 (27%), Positives = 68/140 (48%), Gaps = 6/140 (4%)

Query: 125 DVTPEMAKCVIEYCQVQNIDYVVAPFEADAQMVYLEKMGLVHGIISEDSDLLIFGCRRLI 184
           +VT EM   +        I Y+ AP EA+AQ   L ++ LV G+I++DSD+ +FG   + 
Sbjct: 745 EVTIEMIHEIQSLLSRFGIPYITAPMEAEAQCATLLQLKLVDGVITDDSDVFLFGGTHVY 804

Query: 185 TKLNDHGEGIEICSDDFQYLPHKFPLSQLSPEEMRIMVCLSGCDYTAGIPKVGLLTAMKL 244
             +      +E  S D      K  L +   +++  +  L G DYT G+  +G +  +++
Sbjct: 805 KNMFQEKNYVEYYSLDL--FDQKLGLDR---DKLIQLAQLLGSDYTPGLRGIGPVMGVEI 859

Query: 245 VRKHRTIDNIIKHIQREGKF 264
           + +  ++    K    EG+F
Sbjct: 860 LAEFGSLKEFAKWYN-EGQF 878

 Score = 38.5 bits (88), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 41/89 (46%), Gaps = 2/89 (2%)

Query: 1  MGIQGLLPQLKSIQQPVTLVRYNGQTLAIDGYAWLHRAAHSCAEELALGRPTSKYLEFFV 60
          MG+  L   +  + +PV L   N + +A+D   W+++   +   +       +  + FF 
Sbjct: 1  MGVHSLWDIVSPVAKPVRLESLNERRMAVDASIWIYQFLKAMRNKEGDALRNAHIIGFFR 60

Query: 61 KRLNMLQNRYNIRPYLVFDGDAITVKKDT 89
          +   +L   Y I+P  VFDG    +K +T
Sbjct: 61 RICKLL--YYGIKPVFVFDGGVPVLKLNT 87

>KLLA0A01320g complement(118369..120123) weakly similar to sp|P40028
           Saccharomyces cerevisiae YER041w YEN1 singleton, start
           by similarity
          Length = 584

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 51/190 (26%), Positives = 81/190 (42%), Gaps = 26/190 (13%)

Query: 7   LPQLKSIQQPVTLVRYNGQ--TLAIDGYAWLHRAAHSCAEELALGRPTSK---YLEFFVK 61
           +P++   Q     V  NG+   +AIDGY WL    +          P +K    L +  K
Sbjct: 15  VPRVAFKQFVAEFVEKNGRFPRIAIDGYLWLFECGY-------FDEPQNKSKTLLNWLRK 67

Query: 62  RLNMLQNRYNIRPYLVFDGDAITVKKDTXXXXXXXXXXXXXXALALWRSGEKRQAYEYFQ 121
              ML  +  I   ++FDG   T K D                  LW S    ++   F 
Sbjct: 68  LKEMLHLQCFI--VIIFDG---TFKLDGKRRKKRK-------VATLWDSYWLMRSMNRFN 115

Query: 122 KCVDVTPEMAKCVIEYCQVQNIDYVVAPFEADAQMVYLEKMGLVHGIISEDSDLLIFGCR 181
              D    +   +IE C++ NI  + AP E +AQ  +L+ +G V  ++S D+D+L FG  
Sbjct: 116 H--DSVSYVDDYIIECCKLFNIQTINAPGEGEAQCAFLQLVGQVDFVLSNDADVLSFGAS 173

Query: 182 RLITKLNDHG 191
           +++   + HG
Sbjct: 174 KVLKNYSKHG 183

>AFR238W [3430] [Homologous to ScYER041W (YEN1) - SH]
           complement(869659..871755) [2097 bp, 698 aa]
          Length = 698

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 52/124 (41%), Gaps = 17/124 (13%)

Query: 138 CQVQNIDYVVAPFEADAQMVYLEKMGLVHGIISEDSDLLIFGCRRLITKLNDHGEGIE-- 195
           C+  N+DY+ A  E +A+   L+  G V  I++ DSD  IFG  R++   + H + +   
Sbjct: 144 CRAFNVDYITAAGEGEAECAALQVAGSVDYILTNDSDAAIFGASRILRNFSKHAQDLPSS 203

Query: 196 -------------ICSDDFQYLPHKFPLSQLSPEEMRIMVCLSGCDYTAGIPKVGLLTAM 242
                        +   D +    + P    S +   +   L+G DY  G+  +G   A 
Sbjct: 204 GVSPVKKHVSEYFVTVVDIRAATEEHP--TFSRKAFALFAILTGADYGTGLQHLGYKRAW 261

Query: 243 KLVR 246
            L +
Sbjct: 262 ALTQ 265

>YER041W (YEN1) [1467] chr5 (232460..234739) Possible DNA nuclease,
           has similarity to DNA repair nucleases Rad2p and Rad27p
           [2280 bp, 759 aa]
          Length = 759

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/138 (28%), Positives = 61/138 (44%), Gaps = 8/138 (5%)

Query: 52  TSKYLEFFVKRLNMLQNRYNIRPYLVFDG-DAITVKKDTXXXXXXXXXXXXXXALALWRS 110
           T K +  F+ RL  L +  N+   LVFDG    + K+                  + W  
Sbjct: 92  TGKAVINFISRLKELLS-LNVEFLLVFDGVMKPSFKRKFNHEQNATTCDDEKEYYSSWEQ 150

Query: 111 GEKRQAYEYFQKCVDV----TPEMAKCVIEYCQVQNIDYVVAPFEADAQMVYLEKMGLVH 166
             K   +E +  C  +     PE    V +   + NI YV+A  E +AQ V+L+  G V 
Sbjct: 151 HVKN--HEVYGNCKGLLAPSDPEFISLVRKLLDLMNISYVIACGEGEAQCVWLQVSGAVD 208

Query: 167 GIISEDSDLLIFGCRRLI 184
            I+S DSD L+FG  +++
Sbjct: 209 FILSNDSDTLVFGGEKIL 226

>Kwal_47.19168
          Length = 673

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 53/236 (22%), Positives = 90/236 (38%), Gaps = 20/236 (8%)

Query: 27  LAIDGYAWLHRAAHSCAEELALGRPTSKY-LEFFVKRLNMLQNRYNIRPYLVFDGDAITV 85
           +AID + WL         +      T  + +  F+ RL +  +  ++   LVFDG     
Sbjct: 38  IAIDAFTWLFECGFISEFQPEKAYKTDAHSVISFLNRLKLFLS-LDVTFILVFDGPMKPS 96

Query: 86  KKDTXXXXXXXXXXXXXXALALWRSGEKRQAYEYFQKCV-----DVTPEMAKCVIEYCQV 140
            K+                       E  + +E    C+       TP + K   E  + 
Sbjct: 97  FKNKFKSKTAVQSPIEVEEDYFGVYNEHHRQHEQSGTCIGGPGIQSTPTIVK---EILKA 153

Query: 141 QNIDYVVAPFEADAQMVYLEKMGLVHGIISEDSDLLIFGCRRLITKLNDHGEGIEICS-- 198
            NI Y+ +  E +A+   L+K+ LV  ++S DSD  +FG  +++  ++   E +   S  
Sbjct: 154 MNISYIESCSEGEAECARLQKLNLVDYVLSNDSDAFVFGANKVLRNMSKFWEDLPATSSS 213

Query: 199 -----DDFQYLPHKFPLSQLSPEEMRIMV---CLSGCDYTAGIPKVGLLTAMKLVR 246
                D  +       L Q+S      +V    L G DY  G+  +G   A KL +
Sbjct: 214 PVKKRDHKEMFVTIVDLQQISDWNRASIVFFCTLLGADYNQGVRGLGSKKAAKLAQ 269

>Scas_687.23
          Length = 745

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 58/272 (21%), Positives = 97/272 (35%), Gaps = 53/272 (19%)

Query: 27  LAIDGYAWLHR----AAHSCAEELALGRPTSKYLEFFVKRLNMLQNRYNIRPYLVFDGDA 82
           +AID Y WL       +H  + +        K +  F+ RL  L +  ++   LVFDG  
Sbjct: 38  IAIDAYNWLFECGFIKSHGNSIKYNSQGTLPKAILNFISRLKDLLS-LDVTFLLVFDGPM 96

Query: 83  I-TVKKDTXXXXXXXXXXXXXXALALWRSGEKRQAY--EYFQKCVDVT---PEMAKCVIE 136
             + K +                +   +  E    Y  +    C+  T   PE   C+  
Sbjct: 97  KPSFKNNFMNESDATLDFNQIDMIEYMKQWELHIQYHKDNATGCLTSTNHQPEFMSCITT 156

Query: 137 YCQVQNIDYVVAPFEADAQMVYLEKMGLVHGIISEDSDLLIFGCRRLITKLNDHGEGIEI 196
             +  NI ++ +  E +AQ  +L+  G V  I + DSD LIFG  +L+   +   + + +
Sbjct: 157 ILRAMNISFLESCGEGEAQCAWLQINGYVDFIWTNDSDTLIFGGTKLLKNYSKSLDDVGM 216

Query: 197 CSDDF----------------------------------QYLPHKFPLSQLSPEE----- 217
            S                                     +Y   +  L+++S E      
Sbjct: 217 TSTKASPSKSRSPSRSPSKSPSRSPTRIPQQETTGGLSREYFVTEVDLNRISLETEGRLG 276

Query: 218 ---MRIMVCLSGCDYTAGIPKVGLLTAMKLVR 246
              +     LSG DY  G+  +G   AMKL +
Sbjct: 277 RWPLLFFSILSGADYNQGVKGLGKAKAMKLAQ 308

>CAGL0C02255g complement(228009..229955) similar to sp|P40028
           Saccharomyces cerevisiae YER041w YEN1, start by
           similarity
          Length = 648

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/131 (24%), Positives = 56/131 (42%), Gaps = 18/131 (13%)

Query: 132 KCVIEYCQVQNIDYVVAPFEADAQMVYLEKMGLVHGIISEDSDLLIFGCRRLITKLNDHG 191
           K V E   +  ++Y  A  E ++   +L+    V  ++S DSD L+FG  R++  L+ + 
Sbjct: 156 KKVQELLNLLKVNYTFAYGEGESHCAWLQISDHVDYVMSNDSDTLMFGATRVLRNLSKNL 215

Query: 192 EG-----------------IEICSDDFQYLPHKFPLSQLSPEEMRIMVCLSGCDYTAGIP 234
           E                    I   + Q +  K+ L QLS   +     + G DY +G+ 
Sbjct: 216 EDKSPSSRQGNNSTSSEAEYYITEVNLQEINQKYGL-QLSSASLLFFSLIIGGDYNSGLS 274

Query: 235 KVGLLTAMKLV 245
            +G   A+ L+
Sbjct: 275 GLGKTKALTLM 285

>AER414W [2914] [Homologous to ScYNL085W (MKT1) - SH]
           complement(1431488..1433797) [2310 bp, 769 aa]
          Length = 769

 Score = 35.4 bits (80), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 37/71 (52%), Gaps = 7/71 (9%)

Query: 134 VIEYCQVQNIDYVVAPFEADAQMVYLEKMGLVHGIISEDSDLLIFGCRRLITKLNDHGEG 193
           +I+Y   + I+Y+VAP+ +  Q+ YL + G V GI      LL+    + I        G
Sbjct: 166 LIQYFISKGINYMVAPYSSWIQLAYLLEDGYVDGIYGPTDLLLVESVPKFIL-------G 218

Query: 194 IEICSDDFQYL 204
           +E  + +F+++
Sbjct: 219 MEFPNREFRFV 229

>KLLA0B05995g 535752..537224 some similarities with
           ca|CA0656|IPF12470 Candida albicans unknown function,
           hypothetical start
          Length = 490

 Score = 34.3 bits (77), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 42/91 (46%), Gaps = 10/91 (10%)

Query: 267 PKDFVHEYQLATFAFQFQRVFCPQTNVITTLNVIPEDLLGCSALFESIGRV----ISKET 322
           P D  H  +L +   QF +  C        +++IPE+L   S LF+ +GR+      K  
Sbjct: 226 PVDAFHYLKLQSTDLQFLKYRC------CNIDIIPEELKDPSNLFDEVGRIAIVTTEKTK 279

Query: 323 HAKEVIMDITKVDHEQHARIAWGELCPYNHE 353
            A E+I+ + ++  E    ++      YN+E
Sbjct: 280 RAHELILAVQRMVEEDLVLLSPNANGQYNNE 310

>KLLA0A04884g 433581..436760 similar to sp|P32767 Saccharomyces
           cerevisiae YGL016w PDR6 Member of the karyopherin-beta
           family, nuclear import singleton, start by similarity
          Length = 1059

 Score = 33.1 bits (74), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 27/48 (56%), Gaps = 9/48 (18%)

Query: 191 GEGIEICSDDFQYLPH--KFPLSQLSPEEMRIMVCLSGCDYTAGIPKV 236
           G+ I +  D    +PH  ++PLS++       M C+S CDY +G+P +
Sbjct: 810 GKAITLPDD----IPHFLRYPLSEMMS---FYMTCISNCDYASGLPYI 850

>CAGL0M05445g 580648..583446 similar to sp|P38308 Saccharomyces
           cerevisiae YBR203w, hypothetical start
          Length = 932

 Score = 31.6 bits (70), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 48/213 (22%), Positives = 79/213 (37%), Gaps = 34/213 (15%)

Query: 175 LLIFGCRRLITKLNDHGEGIEICSDDFQYLPHK-----FPLSQLSPEEMRIMVCLSGCDY 229
           L+    ++LITKL +HG      SD F    HK      P  +L  EE  I+  L     
Sbjct: 93  LITASSKKLITKLYEHGSN----SDSFSIFSHKTSQSHHPAQRLGTEEDLIINDLFKRKE 148

Query: 230 TAGIPKVGLLTAMKLVR-KHRTIDNII------KHIQREGKFAVPKDFVHEYQLATFAFQ 282
            + +P   L   +  V+   RT+ N +       +  +   +  PK F   Y++A F   
Sbjct: 149 ISDLPDEVLRNILSNVKDDQRTLVNCLYVNKAFYNATKPTLYERPK-FTSTYRVAQF--- 204

Query: 283 FQRVFCPQTNVITTLNVIPEDLLGCSALFES---IGRVISKETHAKEVIMDITKVDHEQH 339
                      +T++   P++ L    L  S    G +  K T    V+ D   VD    
Sbjct: 205 -----------VTSIRTNPQNGLYVRELDLSKLKNGSLNGKSTSNTGVVADSPDVDEYNP 253

Query: 340 ARIAWGELCPYNHEKDLVNRERKLQLSTKSEPI 372
            R   G +  +       N    L ++T ++ +
Sbjct: 254 MRTRTGSVTSFTSVTSTANSNTALSITTNNKDV 286

>Scas_607.13
          Length = 462

 Score = 30.8 bits (68), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 22/41 (53%)

Query: 229 YTAGIPKVGLLTAMKLVRKHRTIDNIIKHIQREGKFAVPKD 269
           YT+G+ K+GLLT  +L + H  +D I K    +     P D
Sbjct: 45  YTSGLQKIGLLTEEELAKIHVGLDQIKKEWDEDKFVRHPND 85

>YOR301W (RAX1) [5085] chr15 (880961..882268) Protein involved in
           determination of budding pattern [1308 bp, 435 aa]
          Length = 435

 Score = 30.4 bits (67), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 35/78 (44%), Gaps = 6/78 (7%)

Query: 116 AYEYFQKCVDVTPEMAKCVIEYCQVQNIDYVVAPFEADAQMVYLEK-MGLVHGIISEDSD 174
           AY    + V V P    C    C +  +D V + F    ++++  K  G   G  S D+D
Sbjct: 319 AYSRAIRVVTVVPFTLGCYCIVCGMYQVDIVYSWFGVTQRLLHRHKNAGNDEGDASSDTD 378

Query: 175 -----LLIFGCRRLITKL 187
                L +FG RR +T++
Sbjct: 379 HVPMILAVFGGRRRLTRI 396

>AFR290W [3482] [Homologous to ScYIL151C - SH; ScYKR096W - SH]
           complement(960782..964435) [3654 bp, 1217 aa]
          Length = 1217

 Score = 30.0 bits (66), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 42/99 (42%), Gaps = 6/99 (6%)

Query: 543 VDEAATRRNDVAPTSKRHCKSLADLRESFGYKRAPLGEKS-----VNVLAAKTGVDTCAA 597
           ++E+ TR  D A   KRH  +L   R+    +R P G  +     V+ + A+ G  +   
Sbjct: 8   MEESGTRM-DTALHQKRHSSALGGCRDGLAKRRGPRGGLTACGLVVDAIGAEPGSPSYLP 66

Query: 598 KKSVEPHTKKQRPIMNRSRHYVASPSSNDVQRQAVRTLS 636
             S        R I N S   V+S + +D + +    LS
Sbjct: 67  TTSSSNLDAAARAIDNSSLRQVSSTTLHDTRLELPSRLS 105

>Sklu_2265.4 YHR018C, Contig c2265 7685-9079
          Length = 464

 Score = 29.6 bits (65), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 23/37 (62%), Gaps = 1/37 (2%)

Query: 229 YTAGIPKVGLLTAMKLVRKHRTIDNIIKHIQREGKFA 265
           YT G+ K+GLLT+ +L + H  ++ I K     G+FA
Sbjct: 46  YTEGLQKIGLLTSDELTKVHHGLEQIEKEWA-AGEFA 81

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.133    0.386 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 18,261,231
Number of extensions: 719316
Number of successful extensions: 2133
Number of sequences better than 10.0: 43
Number of HSP's gapped: 2147
Number of HSP's successfully gapped: 54
Length of query: 636
Length of database: 16,596,109
Length adjustment: 108
Effective length of query: 528
Effective length of database: 12,857,365
Effective search space: 6788688720
Effective search space used: 6788688720
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 65 (29.6 bits)