Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_55.1992631230816480.0
Sklu_1927.13453089011e-121
AEL226W3243116911e-89
KLLA0A07106g3103056134e-78
Scas_617.63303146121e-77
CAGL0H08217g3253145544e-69
YOR026W (BUB3)3413355242e-64
Scas_510.53622882452e-23
AGL301C3612852372e-22
KLLA0E20779g3712692355e-22
Sklu_2332.73672892312e-21
CAGL0G03399g3692892293e-21
YER107C (GLE2)3652862232e-20
Kwal_27.107853672922223e-20
CAGL0G09845g500193820.028
YNL006W (LST8)303143780.067
KLLA0F13750g620105780.10
YMR093W (UTP15)513135770.11
Kwal_26.862842246770.11
KLLA0A04653g700201770.14
Sklu_2442.2303117740.23
CAGL0A00561g412155740.30
Kwal_23.642975065740.31
AGL234W62965730.38
KLLA0C08547g515277720.55
Kwal_26.773650759720.56
KLLA0E04741g45953710.62
YMR116C (ASC1)319209700.66
Scas_660.8510148710.66
AAL157C479104700.75
CAGL0J01265g517137700.78
Kwal_14.2258699198700.82
Scas_397.241065700.92
Scas_713.50983125691.1
CAGL0M13409g1527157701.1
CAGL0H03729g303132681.1
Scas_512.353440691.3
CAGL0H08932g902257681.5
KLLA0D08514g411202681.5
YGR111W40076681.5
Scas_695.15327133671.6
Scas_630.662165681.6
YCR072C515123671.8
AER263C513123671.8
Scas_575.6701146672.2
KLLA0F08811g636130662.4
YBR246W387134662.4
KLLA0D12232g113031662.6
KLLA0F10263g68265662.7
Scas_629.376925662.7
AEL314W715100662.9
Scas_720.95515123662.9
Kwal_23.386941462652.9
CAGL0J03476g517123662.9
KLLA0D04840g303152653.2
Sklu_2233.280986653.5
KLLA0E07942g39089653.7
YJL112W (MDV1)71454653.8
Scas_721.732597643.9
YKR036C (CAF4)65959654.0
KLLA0D09086g39965644.1
Kwal_27.1038553654644.2
YKL012W (PRP40)58362644.3
CAGL0F07337g621192636.0
CAGL0D04862g919154637.0
Kwal_14.2415597123637.0
YHR186C (KOG1)1557154637.5
KLLA0D16390g936181627.8
YGL213C (SKI8)39762627.8
CAGL0M06193g316105627.8
YCR084C (TUP1)71365628.0
AGR207C32085618.4
ABL044C518138628.4
Scas_592.4*318179618.9
Scas_706.2446078619.6
ADL322C501119619.6
KLLA0A09471g1506249629.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_55.19926
         (308 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_55.19926                                                         639   0.0  
Sklu_1927.1 YOR026W, Contig c1927 98-1135 reverse complement          351   e-121
AEL226W [2280] [Homologous to ScYOR026W (BUB3) - SH] complement(...   270   1e-89
KLLA0A07106g complement(640536..641468) similar to sp|P26449 Sac...   240   4e-78
Scas_617.6                                                            240   1e-77
CAGL0H08217g complement(806660..807637) similar to sp|P26449 Sac...   218   4e-69
YOR026W (BUB3) [4839] chr15 (379780..380805) Checkpoint protein ...   206   2e-64
Scas_510.5                                                             99   2e-23
AGL301C [4011] [Homologous to ScYER107C (GLE2) - SH] (137221..13...    96   2e-22
KLLA0E20779g complement(1841092..1842207) similar to sp|P40066 S...    95   5e-22
Sklu_2332.7 YER107C, Contig c2332 14211-15314 reverse complement       94   2e-21
CAGL0G03399g complement(325879..326988) highly similar to sp|P40...    93   3e-21
YER107C (GLE2) [1539] chr5 complement(373444..374541) Nuclear po...    91   2e-20
Kwal_27.10785                                                          90   3e-20
CAGL0G09845g 940598..942100 similar to sp|P20053 Saccharomyces c...    36   0.028
YNL006W (LST8) [4579] chr14 (620066..620977) Protein required fo...    35   0.067
KLLA0F13750g complement(1274110..1275972) similar to sp|P46680 S...    35   0.10 
YMR093W (UTP15) [4051] chr13 (454014..455555) Protein component ...    34   0.11 
Kwal_26.8628                                                           34   0.11 
KLLA0A04653g complement(417313..419415) similar to sp|P48234 Sac...    34   0.14 
Sklu_2442.2 YNL006W, Contig c2442 3831-4742                            33   0.23 
CAGL0A00561g complement(63710..64948) similar to sp|P53196 Sacch...    33   0.30 
Kwal_23.6429                                                           33   0.31 
AGL234W [4078] [Homologous to ScYCR084C (TUP1) - SH] complement(...    33   0.38 
KLLA0C08547g 749737..751284 highly similar to sp|P25382 Saccharo...    32   0.55 
Kwal_26.7736                                                           32   0.56 
KLLA0E04741g 428278..429657 similar to sp|P20053 Saccharomyces c...    32   0.62 
YMR116C (ASC1) [4073] chr13 complement(499455..499877,500151..50...    32   0.66 
Scas_660.8                                                             32   0.66 
AAL157C [30] [Homologous to ScYLL011W (SOF1) - SH] (70077..71516...    32   0.75 
CAGL0J01265g complement(118375..119928) highly similar to sp|Q04...    32   0.78 
Kwal_14.2258                                                           32   0.82 
Scas_397.2                                                             32   0.92 
Scas_713.50                                                            31   1.1  
CAGL0M13409g complement(1316268..1320851) similar to sp|P38873 S...    32   1.1  
CAGL0H03729g 342948..343859 highly similar to sp|P41318 Saccharo...    31   1.1  
Scas_512.3                                                             31   1.3  
CAGL0H08932g join(871668..871685,872089..874779) highly similar ...    31   1.5  
KLLA0D08514g complement(726710..727945) weakly similar to sp|P53...    31   1.5  
YGR111W (YGR111W) [2070] chr7 (715830..717032) Protein with simi...    31   1.5  
Scas_695.15                                                            30   1.6  
Scas_630.6                                                             31   1.6  
YCR072C (YCR072C) [597] chr3 complement(240800..242347) Protein ...    30   1.8  
AER263C [2765] [Homologous to ScYCR072C - SH] (1118228..1119769)...    30   1.8  
Scas_575.6                                                             30   2.2  
KLLA0F08811g complement(819834..821744) some similarities with s...    30   2.4  
YBR246W (YBR246W) [425] chr2 (711548..712711) Protein of unknown...    30   2.4  
KLLA0D12232g complement(1041135..1044527) some similarities with...    30   2.6  
KLLA0F10263g 949926..951974 gi|2494900|sp|P56094|TUP1_KLULA Kluy...    30   2.7  
Scas_629.3                                                             30   2.7  
AEL314W [2191] [Homologous to ScYJL112W (MDV1) - SH; ScYKR036C (...    30   2.9  
Scas_720.95                                                            30   2.9  
Kwal_23.3869                                                           30   2.9  
CAGL0J03476g 331933..333486 highly similar to sp|P25382 Saccharo...    30   2.9  
KLLA0D04840g 413362..414273 highly similar to sp|P41318 Saccharo...    30   3.2  
Sklu_2233.2 YMR049C, Contig c2233 5630-8059 reverse complement         30   3.5  
KLLA0E07942g 717476..718648 similar to sp|P20484 Saccharomyces c...    30   3.7  
YJL112W (MDV1) [2803] chr10 (205222..207366) Protein involved in...    30   3.8  
Scas_721.7                                                             29   3.9  
YKR036C (CAF4) [3289] chr11 complement(508344..510323) Protein t...    30   4.0  
KLLA0D09086g 763408..764607 weakly similar to sgd|S0006289 Sacch...    29   4.1  
Kwal_27.10385                                                          29   4.2  
YKL012W (PRP40) [3244] chr11 (417953..419704) U1 snRNA-associate...    29   4.3  
CAGL0F07337g complement(714870..716735) similar to sp|P26309 Sac...    29   6.0  
CAGL0D04862g 472577..475336 similar to sp|Q01454 Saccharomyces c...    29   7.0  
Kwal_14.2415                                                           29   7.0  
YHR186C (KOG1) [2471] chr8 complement(475997..480670) Component ...    29   7.5  
KLLA0D16390g 1378884..1381694 similar to sp|Q12220 Saccharomyces...    28   7.8  
YGL213C (SKI8) [1783] chr7 complement(90057..91250) Protein invo...    28   7.8  
CAGL0M06193g 643917..644867 similar to sp|P38123 Saccharomyces c...    28   7.8  
YCR084C (TUP1) [608] chr3 complement(260307..262448) General rep...    28   8.0  
AGR207C [4518] [Homologous to ScYBR175W (SWD3) - SH] (1146710..1...    28   8.4  
ABL044C [548] [Homologous to ScYMR093W - SH] (312378..313934) [1...    28   8.4  
Scas_592.4*                                                            28   8.9  
Scas_706.24                                                            28   9.6  
ADL322C [1419] [Homologous to ScYBR103W (SIF2) - SH] (128830..13...    28   9.6  
KLLA0A09471g complement(827264..831784) similar to sp|P38873 Sac...    28   9.7  

>Kwal_55.19926
          Length = 312

 Score =  639 bits (1648), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/308 (100%), Positives = 308/308 (100%)

Query: 1   MPFECFDSPPNDYISGLVIKGITPHVNVTAWDGTLSLYNYEDNDLVLRMRYNDALTSCAY 60
           MPFECFDSPPNDYISGLVIKGITPHVNVTAWDGTLSLYNYEDNDLVLRMRYNDALTSCAY
Sbjct: 1   MPFECFDSPPNDYISGLVIKGITPHVNVTAWDGTLSLYNYEDNDLVLRMRYNDALTSCAY 60

Query: 61  SEVGSKIFVGSVSGEVLEVDFESERFNLISEPAELGISALCCSQNNIIAGSWDGSLQIVD 120
           SEVGSKIFVGSVSGEVLEVDFESERFNLISEPAELGISALCCSQNNIIAGSWDGSLQIVD
Sbjct: 61  SEVGSKIFVGSVSGEVLEVDFESERFNLISEPAELGISALCCSQNNIIAGSWDGSLQIVD 120

Query: 121 SRSGDRWFRERLDNCKILGMDCADNNKLVVSLTGGKVAIYDLRNMIKPQIRESGLKFQTR 180
           SRSGDRWFRERLDNCKILGMDCADNNKLVVSLTGGKVAIYDLRNMIKPQIRESGLKFQTR
Sbjct: 121 SRSGDRWFRERLDNCKILGMDCADNNKLVVSLTGGKVAIYDLRNMIKPQIRESGLKFQTR 180

Query: 181 DIKLMPAANGYVQSSLDGRVAVEYFDQESSRFAFRCHRMNLPDTQFVFPVNSLCFNSNDG 240
           DIKLMPAANGYVQSSLDGRVAVEYFDQESSRFAFRCHRMNLPDTQFVFPVNSLCFNSNDG
Sbjct: 181 DIKLMPAANGYVQSSLDGRVAVEYFDQESSRFAFRCHRMNLPDTQFVFPVNSLCFNSNDG 240

Query: 241 TLYTGGSDGRVYGWNLSTRKKSHEFPKFEDSIVKLAYKNDVLCVATGDDSFKTLPTVEGA 300
           TLYTGGSDGRVYGWNLSTRKKSHEFPKFEDSIVKLAYKNDVLCVATGDDSFKTLPTVEGA
Sbjct: 241 TLYTGGSDGRVYGWNLSTRKKSHEFPKFEDSIVKLAYKNDVLCVATGDDSFKTLPTVEGA 300

Query: 301 EIQPGKVY 308
           EIQPGKVY
Sbjct: 301 EIQPGKVY 308

>Sklu_1927.1 YOR026W, Contig c1927 98-1135 reverse complement
          Length = 345

 Score =  351 bits (901), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 172/308 (55%), Positives = 219/308 (71%), Gaps = 3/308 (0%)

Query: 1   MPFECFDSPPNDYISGLVIKGITPHVNVTAWDGTLSLYNYEDNDLVLRMRYNDALTSCAY 60
           MPF        DYIS LV+     H+  T+WDG++S+Y+Y+  + +  +R+   L S   
Sbjct: 37  MPFHKLQDVTKDYISDLVLLESYSHIVCTSWDGSISMYDYDSMNRLTSLRHKFPLLSTGV 96

Query: 61  SEVGSKIFVGSVSGEVLEVDFESERFNLISEPAELGISALCCSQNNIIAGSWDGSLQIVD 120
              G KI+VGSV GE+LEVD ESE+F  +SE AELGIS++C    ++IAGSWDGSL+IVD
Sbjct: 97  VHNG-KIYVGSVQGEMLEVDLESEKFGTVSESAELGISSICIQDASVIAGSWDGSLRIVD 155

Query: 121 SRSGDRWFRERLDNCKILGMDCADNNKLVVSLTGGKVAIYDLRNMIKPQIRESGLKFQTR 180
           SR+ D  F   L + K+L MDC +N KL +SLT G+V I+DLR +  P  R++GLKFQ R
Sbjct: 156 SRNNDTQFETALGH-KVLSMDCHEN-KLCISLTAGEVKIFDLRKLGAPVSRKAGLKFQAR 213

Query: 181 DIKLMPAANGYVQSSLDGRVAVEYFDQESSRFAFRCHRMNLPDTQFVFPVNSLCFNSNDG 240
           DIK+MP+  GYVQSSLDGRVAVEYFDQE  +FAFRCHRM+L D QFVFPVN++CF  +  
Sbjct: 214 DIKIMPSYEGYVQSSLDGRVAVEYFDQEEKKFAFRCHRMSLQDAQFVFPVNTICFKPHSS 273

Query: 241 TLYTGGSDGRVYGWNLSTRKKSHEFPKFEDSIVKLAYKNDVLCVATGDDSFKTLPTVEGA 300
           TL+TGGSDGR+Y WNLSTRKKS E PK + S+VK+A  + V+  AT DDSFKT  TVE  
Sbjct: 274 TLFTGGSDGRIYAWNLSTRKKSDELPKLDSSVVKVACNDRVVVAATSDDSFKTSATVEDL 333

Query: 301 EIQPGKVY 308
            +QP  +Y
Sbjct: 334 PLQPSDIY 341

>AEL226W [2280] [Homologous to ScYOR026W (BUB3) - SH]
           complement(204812..205786) [975 bp, 324 aa]
          Length = 324

 Score =  270 bits (691), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 147/311 (47%), Positives = 192/311 (61%), Gaps = 6/311 (1%)

Query: 1   MPFECFDSPPNDYISGL-VIKGITPHVNVTAWDGTLSLYNYEDNDLVLRMRYNDALTSCA 59
           M +        DY+SG+ ++      + V++WDGT SLY++E N  + R+ +   LTS A
Sbjct: 13  MAYVELKDVSKDYLSGVCLVDEEGSQLIVSSWDGTASLYDWEKNKRMGRLSHEWPLTSVA 72

Query: 60  YSEVGSKIFVGSVSGEVLEVDFESERF-NLISEPAELGISALCCSQNNIIAGSWDGSLQI 118
                 + +VGS  GEVLE+D+ESER   L      LGISA+      ++ GSWDGSL +
Sbjct: 73  VCAGTRRAYVGSAQGEVLELDWESERMVALQGVQCGLGISAMGSYGQFVVVGSWDGSLAV 132

Query: 119 VDSRSGDRWFRERLDNCKILGMDCADNNKLVVSLTGGKVAIYDLRNM-IKPQIRESGLKF 177
           VD+R        RL   KIL +DC      VV +T   V ++   ++   P+ RESGLK+
Sbjct: 133 VDTRRNTVRHIRRLTG-KILSLDCGAAR--VVCMTTDGVYVFRTSDIDAAPERRESGLKY 189

Query: 178 QTRDIKLMPAANGYVQSSLDGRVAVEYFDQESSRFAFRCHRMNLPDTQFVFPVNSLCFNS 237
           Q+R ++L+P   GYVQSS+DGRVAVEYF  E  +FAFRCHRMNL DTQ VFPVN+LCF+ 
Sbjct: 190 QSRCVRLVPDEEGYVQSSVDGRVAVEYFGDEGRKFAFRCHRMNLKDTQLVFPVNALCFHP 249

Query: 238 NDGTLYTGGSDGRVYGWNLSTRKKSHEFPKFEDSIVKLAYKNDVLCVATGDDSFKTLPTV 297
               LYTGGSDGRV+ WNL+TRKK+ E PK EDS+VKL      L +A  DDSFKT   V
Sbjct: 250 KTALLYTGGSDGRVFAWNLTTRKKAEELPKVEDSVVKLCCNRRALVIAASDDSFKTSAVV 309

Query: 298 EGAEIQPGKVY 308
           E   +Q  +VY
Sbjct: 310 EDIALQRSRVY 320

>KLLA0A07106g complement(640536..641468) similar to sp|P26449
           Saccharomyces cerevisiae YOR026w BUB3 cell cycle arrest
           protein, start by similarity
          Length = 310

 Score =  240 bits (613), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 134/305 (43%), Positives = 186/305 (60%), Gaps = 15/305 (4%)

Query: 10  PNDYISGLVIKGITPHVNVTAWDGTLSLYNYEDNDLVLRMRYNDALTSCAYSEVGSKIFV 69
           P DYIS + I      V V+ WDG+LSL++     L+++++++  LTSC  S+ G +I+ 
Sbjct: 11  PKDYISDIRIISSDNRVVVSCWDGSLSLFDITQQQLLMKLQHSWPLTSCHVSKDG-RIWA 69

Query: 70  GSVSGEVLEVDFESERFNLISEPA---ELGISALCCSQNNIIAGSWDGSLQIVD---SRS 123
           GSV GEVLE D+ESER  LI        LG+S +    + IIA SWDGSL ++D   ++ 
Sbjct: 70  GSVQGEVLEADWESER--LIPNDTMSFSLGVSGITSIDHFIIASSWDGSLIVLDYLRNQI 127

Query: 124 GDRWFRERLDNCKILGMDCADNNKLVVSLTGGKVAIYDLRNMIKPQIRESGLKFQTRDIK 183
             +W  E     KI  + CA   +++ SL+ GKV +    +    +  ESGLK+Q R   
Sbjct: 128 VKQWKFEE----KIFQL-CASEVRVMCSLSSGKVKLIQFPSWDITET-ESGLKYQCRSCT 181

Query: 184 LMPAANGYVQSSLDGRVAVEYFDQESSRFAFRCHRMNLPDTQFVFPVNSLCFNSNDGTLY 243
           L+P   G+VQ S+DGRV+VE+FD +S +FAFRCHRMNL D Q VFPV +L F  N   L+
Sbjct: 182 LIPNNRGFVQGSVDGRVSVEFFDDQSPKFAFRCHRMNLEDVQMVFPVTALAFQPNSLNLF 241

Query: 244 TGGSDGRVYGWNLSTRKKSHEFPKFEDSIVKLAYKNDVLCVATGDDSFKTLPTVEGAEIQ 303
           TGG+DG++  WNL TRKK  EF K +D+I+KL    D L +A  DDSFKT    +  E+ 
Sbjct: 242 TGGADGKIVSWNLVTRKKQEEFHKLDDTIMKLCCTEDYLVIAVSDDSFKTCAVPQDIELH 301

Query: 304 PGKVY 308
           P  +Y
Sbjct: 302 PSAIY 306

>Scas_617.6
          Length = 330

 Score =  240 bits (612), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 145/314 (46%), Positives = 194/314 (61%), Gaps = 16/314 (5%)

Query: 10  PNDYISGLVIKGITPHVNVTAWDGTLSLYNYEDNDLVLRMR----YNDALTSCAYSEVGS 65
           P++YIS +V+        VTAWDG+LS + Y  N   +++     +  AL  C Y+ V  
Sbjct: 13  PSEYISDIVLIDEKSQFLVTAWDGSLSQFEYNPNLKKVKLIKKVVHEYALLCCCYAFVLG 72

Query: 66  K--IFVGSVSGEVLEVDFESERFN-LISEPAELGISALCCSQN-NIIAGSWDGSLQIVDS 121
           K  ++VG+V GE+  VDFE+  F  ++    +LG+S +    N   IA SWDG LQ +D 
Sbjct: 73  KLRVYVGTVQGEIFLVDFENSDFKPVLGNSTQLGVSKMVNVGNYTFIASSWDGILQEIDM 132

Query: 122 RSGDRWFRERLDN-CKILGMDCADNNKLVVSLTGGKVAIYDL--RNMIKPQIRE--SGLK 176
           +        +L+N  K+L MDC  NN L+++LTG K+   +L   N  + ++ E  +GLK
Sbjct: 133 QDNAVIRTTKLENNTKVLAMDCV-NNLLILALTGKKIRWLNLPLNNNDRGEVTEVETGLK 191

Query: 177 FQTRDIKLMPAANGYVQSSLDGRVAVEYFDQESSRFAFRCHRMNLPDTQFVFPVNSLCFN 236
           +Q RDIKL    +GYV SS+DGRVAVEYF+ +S  FAFRCHRMNL D QFVFPVNSL F+
Sbjct: 192 YQVRDIKLTLEGDGYVTSSIDGRVAVEYFEDDSRNFAFRCHRMNLVDMQFVFPVNSLAFS 251

Query: 237 SNDGTLYTGGSDGRVYGWNLSTRKKSHEFPKF-EDSIVKLAYKNDVLCVATGDDSFKTLP 295
                L+TGGSDG V  WNL T KK  +FPKF E+S+VKLA   D+L V T DDSFKT  
Sbjct: 252 PASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNENSVVKLACNEDILVVGTSDDSFKTNA 311

Query: 296 TV-EGAEIQPGKVY 308
            V E  E+Q  ++Y
Sbjct: 312 VVAEPLELQSSRLY 325

>CAGL0H08217g complement(806660..807637) similar to sp|P26449
           Saccharomyces cerevisiae YOR026w BUB3, hypothetical
           start
          Length = 325

 Score =  218 bits (554), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 122/314 (38%), Positives = 185/314 (58%), Gaps = 18/314 (5%)

Query: 10  PNDYISGLVIKGITPHVNVTAWDGTLSLYNYEDN----DLVLRMRYNDALTSCAYSEVGS 65
           P +YISG+ I      + + ++DGTLS+Y  +      +L +R++Y  +LTS A   +  
Sbjct: 9   PREYISGIEIISEQNQIIIVSYDGTLSVYTVDRELKQVNLTVRLQYESSLTSVAQLNIQG 68

Query: 66  K--IFVGSVSGEVLEVDFESERFNLISE-PAELGISALCCSQNNIIAGSWDGSLQIVDSR 122
           +  I+ GSV G++L VD E+  F  + +  +  GIS +    + +IAGSWDGS+ +V+ +
Sbjct: 69  RQFIYAGSVDGQLLSVDLENSLFVKVDQIESSAGISCIAMHGDRVIAGSWDGSIYVVNPK 128

Query: 123 SGDRWFRERL----DNCKILGMDCADNNKLVVSLTGGKVAIYDL--RNMIKPQIRESGLK 176
           S    F   L      C  L +     +KL++S    K+AI+ L      KP I +SG  
Sbjct: 129 SNSLEFTLELPSEYKKCFKLSVQA---HKLLISTIKCKIAIFKLPLTPTTKPHILDSGQI 185

Query: 177 FQTRDIKLMPAANGYVQSSLDGRVAVEYFDQESSRFAFRCHRMNLPDTQFVFPVNSLCFN 236
           FQ RD +L P  +G+V + +DGRV+VEYFD  S RFAFRCH+ +L DT   +P+N++ F 
Sbjct: 186 FQIRDSQLTPEGDGFVCTGIDGRVSVEYFDDTSKRFAFRCHKYDLDDTVMTYPINAIRFI 245

Query: 237 SNDGTLYTGGSDGRVYGWNLSTRKKSHEFPKF-EDSIVKLAYKNDVLCVATGDDSFKTLP 295
            N    YTGGSDG V  W+L  + K  + PK+ E+S+V+LA   ++LCVAT DDSFKT  
Sbjct: 246 PNTSEFYTGGSDGCVSAWHLHKKTKIKQLPKYNENSVVQLACNENILCVATSDDSFKTNA 305

Query: 296 TVEG-AEIQPGKVY 308
            ++   E++P ++Y
Sbjct: 306 VIDSNLELEPSRIY 319

>YOR026W (BUB3) [4839] chr15 (379780..380805) Checkpoint protein
           required for cell cycle arrest in response to loss of
           microtubule function [1026 bp, 341 aa]
          Length = 341

 Score =  206 bits (524), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 131/335 (39%), Positives = 191/335 (57%), Gaps = 28/335 (8%)

Query: 1   MPFECFDSPPNDYISGLVIKGITPHVNVTAWDGTLSLYNYE----DNDLVLRMRYNDALT 56
           M     +  P DYIS + I      + +T+WDG+L++Y ++    + DL+  +RY   L 
Sbjct: 1   MQIVQIEQAPKDYISDIKIIPSKSLLLITSWDGSLTVYKFDIQAKNVDLLQSLRYKHPLL 60

Query: 57  SCAYSE-VGSKIFVGSVSGEVLEVDF-ESERFN-LISEPAELGISALC-CSQNNIIAGSW 112
            C + +    +I+VG+V GE+L+VD   S  F  L +  A LGI  +C    + +IA SW
Sbjct: 61  CCNFIDNTDLQIYVGTVQGEILKVDLIGSPSFQALTNNEANLGICRICKYGDDKLIAASW 120

Query: 113 DGSLQIVDSRS-GDRWFRERLDNC-------KILGMDCADNNKLVVSLTGGKVAIYDLR- 163
           DG ++++D R+ GD     +  N        KI  MD  ++++L+V +   +V  + L  
Sbjct: 121 DGLIEVIDPRNYGDGVIAVKNLNSNNTKVKNKIFTMD-TNSSRLIVGMNNSQVQWFRLPL 179

Query: 164 -NMIKPQIRESGLKFQTRDIKLMPAAN-GYVQSSLDGRVAVEYFDQE------SSRFAFR 215
                  I ESGLK+Q RD+ L+P    GY  SS+DGRVAVE+FD +      S RFAFR
Sbjct: 180 CEDDNGTIEESGLKYQIRDVALLPKEQEGYACSSIDGRVAVEFFDDQGDDYNSSKRFAFR 239

Query: 216 CHRMNLPDTQFVFPVNSLCFNSNDGTLYTGGSDGRVYGWNLSTRKKSHEFPKF-EDSIVK 274
           CHR+NL DT   +PVNS+ F+     LYT GSDG +  WNL TRKK   F KF EDS+VK
Sbjct: 240 CHRLNLKDTNLAYPVNSIEFSPRHKFLYTAGSDGIISCWNLQTRKKIKNFAKFNEDSVVK 299

Query: 275 LAYKNDVLCVATGDDSFKTLPTVEGA-EIQPGKVY 308
           +A  +++LC+AT DD+FKT   ++   E+    +Y
Sbjct: 300 IACSDNILCLATSDDTFKTNAAIDQTIELNASSIY 334

>Scas_510.5
          Length = 362

 Score = 99.0 bits (245), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 81/288 (28%), Positives = 135/288 (46%), Gaps = 26/288 (9%)

Query: 6   FDSPPNDYISGLVIKGITPHV-NVTAWDGTLSLYNYEDNDLVLRMRYNDA--LTSCAYSE 62
            ++P  D IS +        + +V++WDG + +++ +      R +Y  A  + S  +S 
Sbjct: 29  LNNPAEDSISDIAFSPQQDFIFSVSSWDGKVRIWDVQGGVAQGRSQYEHAGPVLSTRWSN 88

Query: 63  VGSKIFVGSVSGEVLEVDF---ESERFNLISEPAELGISALCCSQNN---IIAGSWDGSL 116
            GSK+  G     V   D    +S++  +   P +  +  + C  +N   ++ GSWD S+
Sbjct: 89  DGSKVASGGCDNIVKLFDVASGQSQQIGMHDAPVK-AVRFVNCGPSNTECLVTGSWDKSI 147

Query: 117 QIVDSRSGDRWFRERLDNCKILGMDCADNNKLVVSLTGGKVAIYDLRN---MIKPQIRES 173
           +  D R         + + ++  MD +    LVV      +AI +L N   + K  +  S
Sbjct: 148 KYWDMRQPQAISTVIMPD-RVYTMD-SKQQLLVVGTAERHIAIINLNNPGSIFKTTL--S 203

Query: 174 GLKFQTRDIKLMPAANGYVQSSLDGRVAVEYFD---QESSRFAFRCHRMNLPD------T 224
            LK+QTR +      +GY   S++GR A+ Y D   Q+ S F+F+CHR N P+       
Sbjct: 204 PLKWQTRVVSCYNEGDGYAIGSIEGRCAIRYVDDEMQKKSGFSFKCHRQNNPNRTAGSQQ 263

Query: 225 QFVFPVNSLCFNSNDGTLYTGGSDGRVYGWNLSTRKKSHEFPKFEDSI 272
             V+PVNS+ F+   GT  T G DG  + W+ + R +   FP    SI
Sbjct: 264 SLVYPVNSIAFHPIYGTFATAGGDGCFHFWDKNHRHRLKAFPSLRSSI 311

>AGL301C [4011] [Homologous to ScYER107C (GLE2) - SH]
           (137221..138306) [1086 bp, 361 aa]
          Length = 361

 Score = 95.9 bits (237), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 74/285 (25%), Positives = 129/285 (45%), Gaps = 20/285 (7%)

Query: 6   FDSPPNDYISGLVIKGITPHV-NVTAWDGTLSLYNYEDNDLVLRMRYNDA--LTSCAYSE 62
            ++P ND +S +        + +V AWD T+ +++ ++     R +Y     + +  +S 
Sbjct: 28  INNPANDSVSDIAFSPQQDFLFSVAAWDNTVRIWDVQNGMTQGRAQYEHQAPVLTTRWSS 87

Query: 63  VGSKIFVGSVSGEVLEVDFESERFNLI--SEPAELGISALCCSQNN---IIAGSWDGSLQ 117
            G+K+  G     +   D  S +   I   + A   +  + C  +N   I+ GSWD +++
Sbjct: 88  DGTKVASGGCDNILKLYDVASGQAQQIGSHDSAVRALRFVQCGPSNQECIVTGSWDKTIK 147

Query: 118 IVDSRSGDRWFRERLDNCKILGMDCADNNKLVVSLTGGKVAIYDLRNMIKP-QIRESGLK 176
             D R         +   ++  +D +    LVV      + + DL N  +  +   S LK
Sbjct: 148 YWDMRQPQPISTVAMPE-RVYALD-SKQKLLVVGTAERHIVVIDLNNPAQVFRTSMSPLK 205

Query: 177 FQTRDIKLMPAANGYVQSSLDGRVAVEYFDQESSR---FAFRCHRMNLPDT------QFV 227
           +QTR +      NG+   S++GR A++Y D++  R   F+F+CHR   P +        V
Sbjct: 206 WQTRTVACYIEGNGFAIGSVEGRCAIQYVDEQEQRKNGFSFKCHRQQQPASGRASSESLV 265

Query: 228 FPVNSLCFNSNDGTLYTGGSDGRVYGWNLSTRKKSHEFPKFEDSI 272
           +PVNS+ F+   GT  T G DG    W+ + R +   FP    SI
Sbjct: 266 YPVNSIVFHPQYGTFATAGGDGSCNFWDKNQRHRLKGFPSMNASI 310

>KLLA0E20779g complement(1841092..1842207) similar to sp|P40066
           Saccharomyces cerevisiae YER107c GLE2 required for
           nuclear pore complex structure and function, start by
           similarity
          Length = 371

 Score = 95.1 bits (235), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 73/269 (27%), Positives = 125/269 (46%), Gaps = 27/269 (10%)

Query: 27  NVTAWDGTLSLYNYEDNDLVLRMRYNDA--LTSCAYSEVGSKIFVGSVSGEVLEVDFESE 84
           +V++WD  + +++ +      R +Y+    + +  +S  G+K+  G     +   D  + 
Sbjct: 52  SVSSWDSKVRIWDVQSGSPQGRAQYDHQAPVLTTRWSIDGTKVASGGCDNVLKVFDVTTG 111

Query: 85  RFNLISE--PAELGISALCCSQNN---IIAGSWDGSLQIVDSRSGDRWFRERLDNCKILG 139
           +   I +   A   +  + C   N   I  GSWD +++  D RS       ++   ++  
Sbjct: 112 QAQQIGQHNSAVQSLRFVSCGPTNQECIATGSWDKTVKYWDLRSPQPIMTLQMPE-RVYC 170

Query: 140 MDCADNNKLVVSLTGGKVAIYDLRN---MIKPQIRESGLKFQTRDIKLMPAANGYVQSSL 196
           MD A    +VV +    +A+ DL N   + K  +  S LK+QTR I      NG+   S+
Sbjct: 171 MD-ASQKLMVVGMAERHIAVIDLNNPGQIFKTSL--SPLKWQTRSISCYNEGNGFAIGSI 227

Query: 197 DGRVAVEYFDQESSR---FAFRCHRMNLPDTQF----------VFPVNSLCFNSNDGTLY 243
           +GR AV+Y D++  R   F+F+CHR  + +             V+PVNS+ F+   GT  
Sbjct: 228 EGRCAVQYIDEQEQRKDGFSFKCHRQQVQNNGAAGGRTSTEVQVYPVNSIVFHPIHGTFA 287

Query: 244 TGGSDGRVYGWNLSTRKKSHEFPKFEDSI 272
           T G DG  + W+ + R +   FPK   SI
Sbjct: 288 TAGGDGSFHFWDKNHRHRLKGFPKLNYSI 316

>Sklu_2332.7 YER107C, Contig c2332 14211-15314 reverse complement
          Length = 367

 Score = 93.6 bits (231), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 75/289 (25%), Positives = 129/289 (44%), Gaps = 24/289 (8%)

Query: 6   FDSPPNDYISGLVIKGITPHV-NVTAWDGTLSLYNYEDNDLVLRMRYNDA--LTSCAYSE 62
            ++P  D IS +        + +V++WD  + +++        R +Y     + +  +S 
Sbjct: 30  INNPAEDSISDIAFSSQQDFLFSVSSWDNKVRIWDVNGGMAQGRAQYEHQAPVLTTRWSN 89

Query: 63  VGSKIFVGSVSGEVLEVDFESERFNLI--SEPAELGISALCCSQNN---IIAGSWDGSLQ 117
            G+K+  G     V   D +S +   +   + A   +  + C   N   ++ GSWD +++
Sbjct: 90  DGTKVASGGCDNVVKLFDVQSGQAQQVGAHDSAIRHLRFIQCGPTNTECLVTGSWDKTIK 149

Query: 118 IVDSRSGDRWFRERLDNCKILGMDCADNNKLVVSLTGGKVAIYDLRNMIKP-QIRESGLK 176
             D R         + + ++  MD +    LVV+     +AI DL N     +   S LK
Sbjct: 150 YWDMRQPQPVSTLMMPD-RVYAMD-SKQKLLVVATAERHIAIIDLNNPATIFKTATSPLK 207

Query: 177 FQTRDIKLMPAANGYVQSSLDGRVAVEYFDQESSR---FAFRCHRMNLPDT--------- 224
           +QTR +      NGY   S++GR A++Y D++  R   F+F+CHR     T         
Sbjct: 208 WQTRSVSCYIEGNGYAIGSIEGRCAIQYVDEQEQRKSGFSFKCHRQQQQSTGTAGGRSNT 267

Query: 225 -QFVFPVNSLCFNSNDGTLYTGGSDGRVYGWNLSTRKKSHEFPKFEDSI 272
              V+PVNS+ F+   GT  T G DG  + W+ + R +   FP  + SI
Sbjct: 268 ESHVYPVNSIVFHPVYGTFATAGGDGSFHFWDKNQRHRLKGFPSMKASI 316

>CAGL0G03399g complement(325879..326988) highly similar to sp|P40066
           Saccharomyces cerevisiae YER107c GLE2, start by
           similarity
          Length = 369

 Score = 92.8 bits (229), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 76/289 (26%), Positives = 132/289 (45%), Gaps = 27/289 (9%)

Query: 6   FDSPPNDYISGLVIKGITPH----VNVTAWDGTLSLYNYEDNDLVLRMRY--NDALTSCA 59
            ++P +D IS +     +P      +V++WDG + +++ ++     + +Y  N  +    
Sbjct: 30  INNPADDSISDIAF---SPQHDFLFSVSSWDGKVRIWDAQNGVPQGKAQYEHNGPVLCTR 86

Query: 60  YSEVGSKIFVGSVSGEVLEVDFESERFNLISEP--AELGISALCCSQNN---IIAGSWDG 114
           +S  G++I  G     V   D  S +   I     A   +  + C   N   ++ GSWD 
Sbjct: 87  WSLDGARIASGGCDNTVKLYDVASGQSQQIGSHNDAVKSLRFVQCGPTNTECLVTGSWDK 146

Query: 115 SLQIVDSRSGDRWFRERLDNCKILGMDCADNNKLVVSLTGGKVAIYDLRNMIKP-QIRES 173
           +++  D+R         +   ++  MD      LVV      +AI +L N     +  +S
Sbjct: 147 TIKFWDTRQPQPITTIAMPE-RVYTMD-NKQQLLVVGTAERHIAIINLANPTTIFKSSQS 204

Query: 174 GLKFQTRDIKLMPAANGYVQSSLDGRVAVEYFDQESSR---FAFRCHRMNLPD------- 223
            LK+QTR +      +GY   S++GR A++Y D E+ +   F+F+CHR   P+       
Sbjct: 205 PLKWQTRVVACYNEGDGYAIGSVEGRCAIKYVDDEAQKKSGFSFKCHRQTQPNRAAGSSS 264

Query: 224 TQFVFPVNSLCFNSNDGTLYTGGSDGRVYGWNLSTRKKSHEFPKFEDSI 272
              V+PVNS+ F+   GT  T G DG  + W+ + R +   FP  + SI
Sbjct: 265 QSLVYPVNSIAFHPIYGTFVTAGGDGSFHFWDKNQRHRLKGFPSMQGSI 313

>YER107C (GLE2) [1539] chr5 complement(373444..374541) Nuclear pore
           protein required for poly(A)+ RNA export, has WD (WD-40)
           repeats, functions in the nuclear export of the small
           ribosomal subunit [1098 bp, 365 aa]
          Length = 365

 Score = 90.5 bits (223), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 73/286 (25%), Positives = 131/286 (45%), Gaps = 21/286 (7%)

Query: 6   FDSPPNDYISGLVIKGITPHV-NVTAWDGTLSLYNYEDNDLVLRMRYNDA--LTSCAYSE 62
            +SP  D IS +        + + ++WDG + +++ ++     R ++  +  +    +S 
Sbjct: 31  INSPAEDSISDIAFSPQQDFMFSASSWDGKVRIWDVQNGVPQGRAQHESSSPVLCTRWSN 90

Query: 63  VGSKIFVGSVSGEVLEVDF---ESERFNLISEPAELGISALCCSQNN--IIAGSWDGSLQ 117
            G+K+  G     +   D    ++++  + S P ++     C   N   I+ GSWD +++
Sbjct: 91  DGTKVASGGCDNALKLYDIASGQTQQIGMHSAPIKVLRFVQCGPSNTECIVTGSWDKTIK 150

Query: 118 IVDSRSGDRWFRERLDNCKILGMDCADNNKLVVSLTGGKVAIYDLRNMIKP-QIRESGLK 176
             D R         +   ++  MD    + LVV+     +AI +L N     +   S LK
Sbjct: 151 YWDMRQPQPVSTVMMPE-RVYSMD-NKQSLLVVATAERHIAIINLANPTTIFKATTSPLK 208

Query: 177 FQTRDIKLMPAANGYVQSSLDGRVAVEYFD---QESSRFAFRCHRMNLPD-------TQF 226
           +QTR +     A+GY   S++GR ++ Y D   Q+ S F+F+CHR   P+          
Sbjct: 209 WQTRCVACYNEADGYAIGSVEGRCSIRYIDDGMQKKSGFSFKCHRQTNPNRAPGSNGQSL 268

Query: 227 VFPVNSLCFNSNDGTLYTGGSDGRVYGWNLSTRKKSHEFPKFEDSI 272
           V+PVNS+ F+   GT  T G DG    W+ + R +   +P  + SI
Sbjct: 269 VYPVNSIAFHPLYGTFVTAGGDGTFNFWDKNQRHRLKGYPTLQASI 314

>Kwal_27.10785
          Length = 367

 Score = 90.1 bits (222), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 76/292 (26%), Positives = 126/292 (43%), Gaps = 30/292 (10%)

Query: 6   FDSPPNDYISGLVIKGITPH----VNVTAWDGTLSLYNYEDNDLVLRMRYNDALTSCA-- 59
            ++P  D IS +     +P      +V++WD  + +++        R  Y       A  
Sbjct: 30  INNPAEDSISDIAF---SPQQDFLFSVSSWDKKVRVWDVNGGQAQCRAEYQHQAPVLATR 86

Query: 60  YSEVGSKIFVGSVSGEVLEVDFESERFNLIS--EPAELGISALCCSQNN---IIAGSWDG 114
           +S  G+KI  G     V+  D  S +   +   + A   +  + C  +N   ++ GSWD 
Sbjct: 87  WSTDGTKIASGGCDNAVMVFDVSSGQSQQVGAHDAAVKSLRFVQCGPSNTECLVTGSWDK 146

Query: 115 SLQIVDSRSGDRWFRERLDNCKILGMDCADNNKLVVSLTGGKVAIYDLRNMIKP-QIRES 173
           +++  D R         +   ++  MD +    LVV      + + DL N     +   S
Sbjct: 147 TIKYWDLRQPQPVSTLAMPE-RVYTMD-SKQKLLVVGTAERHIVVIDLNNPAAIFKTTTS 204

Query: 174 GLKFQTRDIKLMPAANGYVQSSLDGRVAVEYFD---QESSRFAFRCHRMNLPDT------ 224
            LK+QTR +      NGY   S++GR A++Y D   Q  S F+F+CHR+    T      
Sbjct: 205 PLKWQTRSVSCYIEGNGYAVGSIEGRCAIQYVDDQEQRKSGFSFKCHRVQQQSTGAAGGR 264

Query: 225 ----QFVFPVNSLCFNSNDGTLYTGGSDGRVYGWNLSTRKKSHEFPKFEDSI 272
                 V+PVNS+ F+   GT  T G DG  + W+ + R +   FP  + +I
Sbjct: 265 SSTESQVYPVNSIVFHPIYGTFATAGGDGSFHFWDKNLRHRLKGFPSLKATI 316

>CAGL0G09845g 940598..942100 similar to sp|P20053 Saccharomyces
           cerevisiae YPR178w PRP4 U4/U6 snRNP, hypothetical start
          Length = 500

 Score = 36.2 bits (82), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 38/193 (19%), Positives = 79/193 (40%), Gaps = 15/193 (7%)

Query: 99  ALCCSQNNIIAGSWDGSLQIVDSRSGDRWFRERLDNCKILGMDCADNNKLVVSLTGGKVA 158
             C + N + +GSW+G + I+DS + +     +  + K+ G+    N+ +++  TGG+  
Sbjct: 219 TFCNNGNYVASGSWNGEVSIIDSNTLEVTQTLQNHDGKVGGIAWTSNDSVLI--TGGEDH 276

Query: 159 IYDLRNMIKPQIRES----GLKFQTRDIKLMPAANGYVQSSLDGRVAVEYFDQESSRFAF 214
           +  + N    +   S    G + +  D+++ P+      SS D    +   +++      
Sbjct: 277 LITVSNRSDGEFITSNSIGGHEGRITDLQVHPSGKFIGTSSFDSTWRLWDIEKQKQLLLQ 336

Query: 215 RCHRMNLPDTQFVFPVNSLCFNSNDGTLYTGGSDGRVYGWNLSTRKKSHEFPKFEDSIVK 274
             H   L           L F ++   + T G+D     W+L + K   +      +I  
Sbjct: 337 EGHSKELY---------CLAFQADGALVSTAGTDKTAIIWDLRSGKAVSQLQGHAKTIYC 387

Query: 275 LAYKNDVLCVATG 287
           + +  D   +ATG
Sbjct: 388 MDWSIDGHTLATG 400

>YNL006W (LST8) [4579] chr14 (620066..620977) Protein required for
           transport of permeases from the Golgi to the plasma
           membrane [912 bp, 303 aa]
          Length = 303

 Score = 34.7 bits (78), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 33/143 (23%), Positives = 60/143 (41%), Gaps = 12/143 (8%)

Query: 140 MDCADNNKLVVSLTGGKVAIYDLRNM-IKPQIRESGLKFQTRDIKLMPAANGYVQSSLDG 198
           ++  ++ KL+ +     V +YD+R     P     G +     +         V SS DG
Sbjct: 38  LEITNDKKLLATAGHQNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDG 97

Query: 199 RVAVEYFDQESSRFAFRCHRMNLPDTQFVFPVNSLCFNSNDGTLYTGGSDGRVYGWNLST 258
            + V  +D  S     R ++ N P       VN +  + N G L +   DG +  W+L  
Sbjct: 98  TIKV--WDVRSPSIP-RNYKHNAP-------VNEVVIHPNQGELISCDRDGNIRIWDLGE 147

Query: 259 RKKSHEF-PKFEDSIVKLAYKND 280
            + +H+  P+ + S+  L+  +D
Sbjct: 148 NQCTHQLTPEDDTSLQSLSMASD 170

>KLLA0F13750g complement(1274110..1275972) similar to sp|P46680
           Saccharomyces cerevisiae YMR092c AIP1 actin cytoskeleton
           component singleton, start by similarity
          Length = 620

 Score = 34.7 bits (78), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 51/105 (48%), Gaps = 6/105 (5%)

Query: 14  ISGLVIKGITPHVNVTAWDGTLSLYNYEDNDLVLRMRYNDALTSCAYSEVGSKIFVGSVS 73
           I G+V+      V +T  DGTLS+ +  D+ +     +N  +TS A + + S    GS  
Sbjct: 300 IVGVVVTKDNSIVTLTL-DGTLSILSLNDHTIKFIHGHNKGITSLAVNPLVS----GSYD 354

Query: 74  GEVLEVDFESERFNLISEPAELG-ISALCCSQNNIIAGSWDGSLQ 117
           G V+  + E +  N IS       + A+  S N + + SWD +L+
Sbjct: 355 GRVVTWNSEGDEVNAISHDIHGNLVLAIDNSDNEVSSVSWDETLK 399

>YMR093W (UTP15) [4051] chr13 (454014..455555) Protein component of
           U3 snoRNP (renamed small subunit processome) which is
           required for 18S biogenesis, has WD (WD-40) repeats
           [1542 bp, 513 aa]
          Length = 513

 Score = 34.3 bits (77), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 34/135 (25%), Positives = 66/135 (48%), Gaps = 12/135 (8%)

Query: 145 NNKLVVSLTGGKVA-IYDLRNMIKPQIRESGLKFQTRDIKLMPAANGYVQS-SLDGRVAV 202
           +NK++ + +  +V  ++D+ N  +PQ+  +G     R +  +PAA   V + S DG   +
Sbjct: 136 DNKILATASDDRVTRLWDISNAYEPQLELTGATDYVRTLSFIPAAPHLVATGSYDG--LI 193

Query: 203 EYFDQESSRFAFRCHRMNLPDTQFVFPVNSLCFNSNDGTLYTGGSDGRVYGWNLSTRKKS 262
             +D  SS  +   + +N        PV ++   S    +  GG++ +V  W+L++ KK 
Sbjct: 194 RLYDTRSSG-STPIYSLNHDQ-----PVENVIAVSPTQIVSCGGNNFKV--WDLTSNKKL 245

Query: 263 HEFPKFEDSIVKLAY 277
           +E   F  ++  L Y
Sbjct: 246 YERGNFNKAVTCLDY 260

>Kwal_26.8628
          Length = 422

 Score = 34.3 bits (77), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 23/46 (50%)

Query: 244 TGGSDGRVYGWNLSTRKKSHEFPKFEDSIVKLAYKNDVLCVATGDD 289
           +GGSDG VY W+   R  +  F   E  I  L + N+   + TG D
Sbjct: 238 SGGSDGYVYIWDTRARAAAQSFFVSESDISTLKFFNNGYAIVTGAD 283

>KLLA0A04653g complement(417313..419415) similar to sp|P48234
           Saccharomyces cerevisiae YGR145w singleton, start by
           similarity
          Length = 700

 Score = 34.3 bits (77), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 47/201 (23%), Positives = 90/201 (44%), Gaps = 25/201 (12%)

Query: 57  SCAYSEVGSKIFVGSVSGEVLEVDFESERFNLISEPAEL---GISALCCSQ-NNIIAGSW 112
           S AY++V   ++VG+ S E+  ++ E  RF     P +L   G++ +  ++ N ++A S 
Sbjct: 143 SLAYNKVNCDLYVGASSNELYRLNLEQGRF---LNPFKLDTEGVNHVSINEVNGLLAASM 199

Query: 113 DGS-LQIVDSRSGDRWFRERLDNCKILGMDCAD---------NNKL--VVSLTGGKVAIY 160
           + + ++  D RS  R  +  L+N     +D AD         N+ L      + G   IY
Sbjct: 200 ETNVVEFWDPRSRSRVAKLHLEN----NLDSADFQVTCSSFKNDGLNFACGTSNGYSYIY 255

Query: 161 DLRNMIKPQIRESGLKFQTRDIKLMPAANGYVQS-SLDGRVAVEYFDQESSRFAFRCHRM 219
           DLR      +++ G  F    I  + +     +  + D R+A  +   +   +A     +
Sbjct: 256 DLRTSEPSIVKDQGYGFAVNKIIWLDSVEDSNKILTCDKRIAKIWNKNDGKAYASMEPSV 315

Query: 220 NLPDTQFVFPVNSLCFNSNDG 240
           ++ D + V P   + F +N+G
Sbjct: 316 DINDIEHV-PGTGMFFTANEG 335

>Sklu_2442.2 YNL006W, Contig c2442 3831-4742
          Length = 303

 Score = 33.1 bits (74), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 27/117 (23%), Positives = 44/117 (37%), Gaps = 11/117 (9%)

Query: 156 KVAIYDLRNM-IKPQIRESGLKFQTRDIKLMPAANGYVQSSLDGRVAVEYFDQESSRFAF 214
            V +YD+R     P     G +     I         V SS DG + V      S +  +
Sbjct: 54  HVRLYDIRTTNPNPVTSFEGHRGNVTSISFQQDNKWMVSSSEDGTIKVWDVRAPSVQRNY 113

Query: 215 RCHRMNLPDTQFVFPVNSLCFNSNDGTLYTGGSDGRVYGWNLSTRKKSHEFPKFEDS 271
           + H           PVN +  + N G L +   DG +  W+L   + +H+    +D+
Sbjct: 114 KHHA----------PVNEVVIHPNQGELISCDQDGNIRIWDLGENQCTHQLTPEDDT 160

>CAGL0A00561g complement(63710..64948) similar to sp|P53196
           Saccharomyces cerevisiae YGL004c, hypothetical start
          Length = 412

 Score = 33.1 bits (74), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 35/155 (22%), Positives = 69/155 (44%), Gaps = 20/155 (12%)

Query: 127 WFR--ERLDNCKILGMD-------C-ADNNKLVVSLTGGKVAIYDLRNMIKPQIRESGLK 176
           WF+  +RL + + LG+        C A  +K+V+  +GG + +YD   M K  +  + + 
Sbjct: 83  WFKTPKRLVSTEELGISESLDLISCDASTDKIVIGDSGGDINVYDHEWMSKLSLVGAHVS 142

Query: 177 FQTRDIKLMPAANGYVQSSLDGRVAVEYFDQESSRFAFRCHRMNLPDTQFVFPVNSLCFN 236
             T  +K+ P+    +  S D ++ V   +  S+    + H   + DT  +    ++  +
Sbjct: 143 DVTT-VKIFPSNAVLLSGSTDMQLKVWSLEDGSNPRTLKGHSAGITDTIIIERGRNVLSS 201

Query: 237 SNDGTLYTGGSDGRVYGWNLSTRKKSHEFPKFEDS 271
           S DG+         V  W L + K   +F + E++
Sbjct: 202 SLDGS---------VRLWELGSGKTISKFCRKENT 227

>Kwal_23.6429
          Length = 750

 Score = 33.1 bits (74), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 30/65 (46%), Gaps = 2/65 (3%)

Query: 230 VNSLCFNSNDGTLYTGGSDGRVYGWNLSTRKKSHEFPKFEDSIVKLAY--KNDVLCVATG 287
           + S+CF+ +   L TG  D  +  W+L+TR+        E  I  L Y    D L   +G
Sbjct: 473 IRSVCFSPDGKFLATGAEDKLIRIWDLATRRIVMTLQGHEQDIYSLDYFPSGDKLVSGSG 532

Query: 288 DDSFK 292
           D + +
Sbjct: 533 DRTVR 537

 Score = 29.6 bits (65), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 57/260 (21%), Positives = 103/260 (39%), Gaps = 47/260 (18%)

Query: 30  AWDGTLSLYNYEDNDLVLRMR-YNDALTSCAYSEVGSKIFVGSVSGEVLEVDFESERFNL 88
           A D  + +++     +V+ ++ +   + S  Y   G K+  GS    V   D  + + +L
Sbjct: 489 AEDKLIRIWDLATRRIVMTLQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSL 548

Query: 89  ISEPAELGISALCCSQNN---IIAGSWDGSLQIVDSRSGDRWFRERLDNCKILGMDCADN 145
                E G++ +  S  +   I AGS D +++I DS +G  +  ERLD+   LG      
Sbjct: 549 TLS-IEDGVTTVAVSPGDGKLIAAGSLDRTVRIWDSETG--FLVERLDSENELG------ 599

Query: 146 NKLVVSLTGGKVAIYDLRNMIKPQIRESGLKFQTRDIKLMPAANGYVQSSLDGRVAVEYF 205
                  TG K ++Y +                TRD       +G V  SLD   +V+ +
Sbjct: 600 -------TGHKDSVYSV--------------VFTRD------GHGVVSGSLD--RSVKLW 630

Query: 206 DQESSRFAFRCHRMNLPDTQFVFP-----VNSLCFNSNDGTLYTGGSDGRVYGWNLSTRK 260
           +  S+       + N   ++  +      V S+    ND  + +G  D  V  W+  +  
Sbjct: 631 NLRSANGGTAEGKANTAASEVTYTGHKDFVLSVATTQNDEFILSGSKDRGVLFWDTPSGN 690

Query: 261 KSHEFPKFEDSIVKLAYKND 280
                    +S++ +A  ND
Sbjct: 691 PLLMLQGHRNSVISVAVAND 710

>AGL234W [4078] [Homologous to ScYCR084C (TUP1) - SH]
           complement(257969..259858) [1890 bp, 629 aa]
          Length = 629

 Score = 32.7 bits (73), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 30/65 (46%), Gaps = 2/65 (3%)

Query: 230 VNSLCFNSNDGTLYTGGSDGRVYGWNLSTRKKSHEFPKFEDSIVKLAY--KNDVLCVATG 287
           + S+CF+ +   L TG  D  +  W+L+T+K        E  I  L Y    D L   +G
Sbjct: 355 IRSVCFSPDGKYLATGAEDKLIRIWDLTTKKILMTLQGHEQDIYSLDYFPAGDKLVSGSG 414

Query: 288 DDSFK 292
           D + +
Sbjct: 415 DRTVR 419

>KLLA0C08547g 749737..751284 highly similar to sp|P25382
           Saccharomyces cerevisiae YCR072c, start by similarity
          Length = 515

 Score = 32.3 bits (72), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 52/277 (18%), Positives = 115/277 (41%), Gaps = 20/277 (7%)

Query: 17  LVIKGITPHVNVTAWDGTLSLYNYEDNDLVLRMRYNDALTSCAYSEVGSKIFVGSVSGEV 76
           LV  G  P +   + DGT+ +++      +L +  + +  SC      + ++ GS    +
Sbjct: 242 LVKPGDKPRLATASKDGTIKIWDTTRRVCLLTLCGHTSSVSCVKWGGKNVLYSGSHDKTI 301

Query: 77  --LEVDFESERFNLISEPAELGISALCCSQNNIIA-GSWDGSLQIVDSRSGDRWFRERLD 133
              +++   +  N++   A   ++ L  S +  +  G++D   +   S    +  ++ L 
Sbjct: 302 RCWDMNLNGKCINILKSHAHW-VNHLSLSTDYALRLGAFDHKGETPASPEEAQ--QKALK 358

Query: 134 NCKILGMDCADNNKLVVSLTGG-KVAIYDLRNMIKPQIRESGLKFQTRDIKLMPAANGYV 192
           N + +     D  +L+V+ +    + +++     KP  R +G +     +   P     V
Sbjct: 359 NYEKVAKRKGDFEELMVTASDDFTMYLWNPLKSTKPITRMTGHQKLVNHVAFSPDGRYIV 418

Query: 193 QSSLDGRVAVEYFDQESSRF--AFRCHRMNLPDTQFVFPVNSLCFNSNDGTLYTGGSDGR 250
            +S D   +++ +D    +F   FR H         V  V  + ++S+   L +   D  
Sbjct: 419 SASFDN--SIKLWDGRDGKFLSTFRGH---------VASVYQVAWSSDCRLLVSCSKDTT 467

Query: 251 VYGWNLSTRKKSHEFPKFEDSIVKLAYKNDVLCVATG 287
           +  W++ TRK S + P  +D +  + +  D   V +G
Sbjct: 468 LKVWDVKTRKLSVDLPGHQDEVYTVDWSVDGKRVCSG 504

>Kwal_26.7736
          Length = 507

 Score = 32.3 bits (72), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 29/59 (49%)

Query: 230 VNSLCFNSNDGTLYTGGSDGRVYGWNLSTRKKSHEFPKFEDSIVKLAYKNDVLCVATGD 288
           V S+ FN N    +   S  RV  ++  TR+    F +F+D +   +++ D   +A GD
Sbjct: 42  VTSIAFNPNHPNDFAITSSTRVQLFSSRTRQVIKTFSRFKDVVYSASFRQDGKLLAMGD 100

 Score = 28.5 bits (62), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 31/136 (22%), Positives = 57/136 (41%), Gaps = 13/136 (9%)

Query: 143 ADNNKLVVSLTGGKVAIYDLRNMIKPQIRESGLKFQTRDIKLMPAA-NGYVQSSLDGRVA 201
           AD+  LV +     V ++D+    +PQ+  +G     R + ++P A +  V  S DG+  
Sbjct: 135 ADSRTLVTASDDRVVRVWDITQAQEPQVELTGASDYVRSVCMVPQAPHLVVTGSYDGQ-- 192

Query: 202 VEYFDQESSRFAFRCHRMNLPDTQFVFPVNSLCFNSNDGTLYTGGSDGRVYGWNLSTRKK 261
           V  FD  ++  A    +          PV  +   S    +  GG   +V  W+L+ ++ 
Sbjct: 193 VRLFDTRTNERATTLAQG--------MPVEDVIAVSATQLVSCGGPKFKV--WDLTAQRP 242

Query: 262 SHEFPKFEDSIVKLAY 277
             E   F  ++  L +
Sbjct: 243 LLERANFAKTVTCLNH 258

>KLLA0E04741g 428278..429657 similar to sp|P20053 Saccharomyces
           cerevisiae YPR178w PRP4 U4/U6 snRNP 52 KD protein, start
           by similarity
          Length = 459

 Score = 32.0 bits (71), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 28/53 (52%), Gaps = 1/53 (1%)

Query: 110 GSWDGSLQIVDSRSGDRWFRERLDNCKILGMDCA-DNNKLVVSLTGGKVAIYD 161
           GSW G+L +VD+     +    L   KI G+D + D+  + V    G++ IYD
Sbjct: 197 GSWSGNLSLVDNSLSKIYCNRSLSGTKISGLDWSVDSKNIFVCTHDGRIVIYD 249

>YMR116C (ASC1) [4073] chr13
           complement(499455..499877,500151..500687) Ribosomal
           protein of the 40S ribosomal subunit that influences
           translational efficiency and cell size, contains two WD
           (WD-40) repeats [960 bp, 319 aa]
          Length = 319

 Score = 31.6 bits (70), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 41/209 (19%), Positives = 83/209 (39%), Gaps = 25/209 (11%)

Query: 108 IAGSWDGSLQIVDSRSGDRWFRERLDNCKILGMDCADNNKLVVSLTGGK-VAIYDLRNMI 166
           ++ SWD +L++ D  +G+ + R       ++ +D      +++S +  K + ++ ++   
Sbjct: 81  LSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTIKGQC 140

Query: 167 KPQIRESGLKFQTRDIKLMPAANG------YVQSSLDGRVAVEYFDQESSRFAFRCHRMN 220
              +   G       ++++P           + +  D  V     +Q      F  H  N
Sbjct: 141 LATLL--GHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLNQFQIEADFIGHNSN 198

Query: 221 LPDTQFVFPVNSLCFNSNDGTLY-TGGSDGRVYGWNLSTRKKSHEFPKFEDSIVKLAYKN 279
                    +N+L   S DGTL  + G DG +  WNL+ +K  +     +D +  LA+  
Sbjct: 199 ---------INTLT-ASPDGTLIASAGKDGEIMLWNLAAKKAMYTLSA-QDEVFSLAFSP 247

Query: 280 D----VLCVATGDDSFKTLPTVEGAEIQP 304
           +        ATG   F   P     +++P
Sbjct: 248 NRYWLAAATATGIKVFSLDPQYLVDDLRP 276

>Scas_660.8
          Length = 510

 Score = 32.0 bits (71), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 36/148 (24%), Positives = 68/148 (45%), Gaps = 17/148 (11%)

Query: 144 DNNKLVVSLTGGKVAIYDLRNMIKPQIRESGLKFQTRDIKLMPAA-NGYVQSSLDGRVAV 202
           DN  L+ +     + ++D+ N  +PQ+  +G     R +  +P+A +  V  S DG   +
Sbjct: 136 DNKTLITASDDRVIRLWDISNAYQPQLELTGSTDYVRSVTCVPSAPHMIVSGSYDG--II 193

Query: 203 EYFDQESSRFAFRCHRMNLPDTQFVFPVNSLCFNSNDGTLYTGGSDGRVYGWNLSTRKKS 262
             +D   +R +      +L   Q   P+  +   S    +  GGS+ +V  W+L++ KK 
Sbjct: 194 RLYD---TRASGSSPIYSLLHDQ---PIEDIISISATQIVSCGGSNFKV--WDLTSNKKL 245

Query: 263 HEFPKFEDSIVKLAYKNDVLCVATGDDS 290
           +E   F  ++  L +      V++ DDS
Sbjct: 246 YERGNFNKTVTCLDH------VSSLDDS 267

>AAL157C [30] [Homologous to ScYLL011W (SOF1) - SH] (70077..71516)
           [1440 bp, 479 aa]
          Length = 479

 Score = 31.6 bits (70), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 37/104 (35%), Gaps = 8/104 (7%)

Query: 160 YDLRNMIKPQIRESGLKFQTRDIKLMPAANGYVQSSLDGRVAVEYFDQESSRFAFRCHRM 219
           YD+RNM +             D+   P     V  S D  + +       SR  +   RM
Sbjct: 286 YDMRNMSRALHVFKDHVSAVMDVDFSPTGEEIVTGSYDKTIRIFNLKHGHSREVYHTKRM 345

Query: 220 NLPDTQFVFPVNSLCFNSNDGTLYTGGSDGRVYGWNLSTRKKSH 263
                Q VF V    F  +   + +G  DG V  W     ++SH
Sbjct: 346 -----QHVFQVK---FTMDSKYIVSGSDDGNVRLWRAKAWERSH 381

>CAGL0J01265g complement(118375..119928) highly similar to sp|Q04305
           Saccharomyces cerevisiae YMR093w, start by similarity
          Length = 517

 Score = 31.6 bits (70), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 35/137 (25%), Positives = 62/137 (45%), Gaps = 17/137 (12%)

Query: 147 KLVVSLTGGKVA-IYDLRNMIKPQIRESGLKFQTRDIKLMPAA-NGYVQSSLDGRVAVEY 204
           K +VS +  +V  ++D+ +  +PQ+  +G     R +  +PAA +  V  S DG  A+  
Sbjct: 138 KTLVSASDDRVTRVWDISHAYEPQLELTGAADYVRTLCFVPAAPHLVVTGSYDG--ALRL 195

Query: 205 FDQESSRFAFRCHRMNLPDTQFVF--PVNSLCFNSNDGTLYTGGSDGRVYGWNLSTRKKS 262
           +D  +          + P    V   PV ++   S    +  GG + +V  W+L++ KK 
Sbjct: 196 YDTRAG---------SKPQHTLVHDQPVENVVAISPTQLVSCGGPNFKV--WDLTSNKKI 244

Query: 263 HEFPKFEDSIVKLAYKN 279
            E   F  ++  L Y N
Sbjct: 245 FERANFNKTVTCLDYVN 261

>Kwal_14.2258
          Length = 699

 Score = 31.6 bits (70), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 44/198 (22%), Positives = 85/198 (42%), Gaps = 16/198 (8%)

Query: 57  SCAYSEVGSKIFVGSVSGEVLEVDFESERF-NLISEPAELGISALCCSQNN--IIAGSWD 113
           S AY++V   ++VG+   E+  ++ E  RF N +   +E G++ +  +  N  I     +
Sbjct: 143 SLAYNKVNCDLYVGASGNELYRLNLEQGRFLNPMKLESE-GVNHVSVNDTNGLIAVAMEE 201

Query: 114 GSLQIVDSRSGDRWFRERLDNC------KILGMDCADNN-KLVVSLTGGKVAIYDLRNMI 166
             ++  DSRS  R  +  L+N       ++      ++        + G   +YDLR   
Sbjct: 202 NVVEFWDSRSRSRAAKLVLENSYDTSPFQVTATSFRNDGLNFACGTSTGYSYLYDLRTSQ 261

Query: 167 KPQIRESGLKFQTRDIKLM--PAANGYVQSSL--DGRVAVEYFDQESSRFAFRCHRMNLP 222
              +++ G  F+ + I  +    A G   + L  D R+A  +       FA     +++ 
Sbjct: 262 PTIVKDQGYGFEIKKIVWLDNTGAEGGNNNILTCDKRIAKVWDKNSGKPFASMEPNVDIN 321

Query: 223 DTQFVFPVNSLCFNSNDG 240
           D + V P   + F +N+G
Sbjct: 322 DIEHV-PGTGMFFTANEG 338

>Scas_397.2
          Length = 410

 Score = 31.6 bits (70), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 31/65 (47%), Gaps = 3/65 (4%)

Query: 107 IIAGSWDGSLQIVD---SRSGDRWFRERLDNCKILGMDCADNNKLVVSLTGGKVAIYDLR 163
           ++AG   G + I D     S  ++  E +  C  +  +  DNN L      G VA++D+R
Sbjct: 261 VVAGHVSGVITIHDILTKESTIQFPSEYMAPCNSISRNPCDNNYLYAGYETGHVALWDIR 320

Query: 164 NMIKP 168
           + + P
Sbjct: 321 SAVSP 325

 Score = 29.6 bits (65), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 28/132 (21%), Positives = 63/132 (47%), Gaps = 8/132 (6%)

Query: 78  EVDFESERFNLISEPAELG----ISALCCSQN--NIIAGSWDGSLQIVDSRSGDRWFRER 131
           +V F +  +   S  +++G    I A   + +  + I G+ +GS+ + DS+    W +E 
Sbjct: 77  KVQFRTPTWKHTSSASDIGNVTSIDAFARANDVASYIVGNEEGSISLYDSQFSHEWTQED 136

Query: 132 LDNCKILGMDCADNNKLVVSLTGG-KVAIYDLRNMIKPQIRESGLKFQTRDIKLMPAANG 190
               +I  +    + ++V+S +   ++ ++ +++   P+I   G   +  D  L+     
Sbjct: 137 AHCSEITTLKFFPSGEVVLSGSSDMQLKLWSIKDASCPRIFR-GHTSKITDSVLIERGRD 195

Query: 191 YVQSSLDGRVAV 202
           +V SSLDG + +
Sbjct: 196 FVSSSLDGTMKL 207

>Scas_713.50
          Length = 983

 Score = 31.2 bits (69), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 29/125 (23%), Positives = 53/125 (42%), Gaps = 11/125 (8%)

Query: 137 ILGMDCADNNKLVVSLTGGKVAIYDLRNMIKPQIRESGLKFQTRDIKLMPAANGYVQSSL 196
           I  +D +D+NKL+ + + G + I++L+  +  +  E G        K +P     +  + 
Sbjct: 432 IRSIDISDDNKLLATASNGSLKIWNLKTKLCIRTFECGYALTC---KFLPGGMLVIIGTR 488

Query: 197 DGRVAVEYFDQESSRFAFRCHRMNLPDTQFVFPVNSLCFNSNDGTLYTGGSDGRVYGWNL 256
            G +  + FD  SS         N+ +      + SL   S+   L TG +D  V  WN 
Sbjct: 489 AGEL--QLFDLASS-----TQIANIEEAHDA-AIWSLDLTSDGKRLITGSADKSVKFWNF 540

Query: 257 STRKK 261
              ++
Sbjct: 541 QLEQE 545

>CAGL0M13409g complement(1316268..1320851) similar to sp|P38873
            Saccharomyces cerevisiae YHR186c, start by similarity
          Length = 1527

 Score = 31.6 bits (70), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 39/157 (24%), Positives = 65/157 (41%), Gaps = 37/157 (23%)

Query: 28   VTAWDGTLSLYNYEDNDLVLRMRYNDALTSCAYSEVGSKIFVGSVS--------GEVLEV 79
            VTAW G         +D++L  R N  L+    S  GS +  G V          E LEV
Sbjct: 1260 VTAWRGL--------SDMLLTPRSNGLLSEWQQSR-GSLLVTGDVKIIRVWDALSESLEV 1310

Query: 80   DFESERFNLISEPAELGISALCCSQNNIIAGSWDGSLQIVDSRSGDRWFRER-------- 131
            D  ++  +L +      +++   + N  +AG  DG++++ D R+  R    R        
Sbjct: 1311 DIPAKTSSLFT-----SLTSDQVAGNIFVAGFSDGTIRVYDRRTDPRLAMVRRWRGGGGK 1365

Query: 132  ----LDNCKILGMDCADNNKLVVSLTGGKVAIYDLRN 164
                ++N     M      +LV   T G V ++D+R+
Sbjct: 1366 PGAWINNVH---MQRGGYRELVSGSTNGVVELWDIRH 1399

>CAGL0H03729g 342948..343859 highly similar to sp|P41318
           Saccharomyces cerevisiae YNL006w LST8, start by
           similarity
          Length = 303

 Score = 30.8 bits (68), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 28/132 (21%), Positives = 53/132 (40%), Gaps = 11/132 (8%)

Query: 140 MDCADNNKLVVSLTGGKVAIYDLRNM-IKPQIRESGLKFQTRDIKLMPAANGYVQSSLDG 198
           ++  ++ KL+ +     + +YD++     P     G +     +         V SS DG
Sbjct: 38  LEITNDKKLLAAAGHQNIRLYDIKTSNSNPVASFEGHRGNVTSVSFQQDNKWMVTSSEDG 97

Query: 199 RVAVEYFDQESSRFAFRCHRMNLPDTQFVFPVNSLCFNSNDGTLYTGGSDGRVYGWNLST 258
            + V  +D  S     R ++ N P       VN +  + N G L +   DG +  W+L  
Sbjct: 98  TIKV--WDIRSPSVP-RNYKHNAP-------VNEVVIHPNQGELISCDRDGNIRIWDLGE 147

Query: 259 RKKSHEFPKFED 270
            + +H+    +D
Sbjct: 148 NQCTHQLTPEDD 159

>Scas_512.3
          Length = 534

 Score = 31.2 bits (69), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 22/40 (55%), Gaps = 3/40 (7%)

Query: 229 PVNSLCF---NSNDGTLYTGGSDGRVYGWNLSTRKKSHEF 265
           PV SLCF   + N   L T G D ++  WNL+  K +++ 
Sbjct: 15  PVYSLCFQPNSPNKKKLLTAGGDNKIRSWNLNLVKDTNKI 54

>CAGL0H08932g join(871668..871685,872089..874779) highly similar to
           sp|P41811 Saccharomyces cerevisiae YGL137w SEC27
          Length = 902

 Score = 30.8 bits (68), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 52/257 (20%), Positives = 101/257 (39%), Gaps = 21/257 (8%)

Query: 14  ISGLVIKGITPHVNVTAWDGTLSLYNYEDNDLVLRMRYNDA-LTSCAYSEVGSKIFVGSV 72
           + G+ +    P V  T + G + ++NYE    V  ++  D  + +  +    + I VGS 
Sbjct: 16  VKGIDLHPSEPWVLTTLYSGRVEIWNYETQQEVRSIQVTDTPVRAGKFITRKNWIVVGSD 75

Query: 73  SGEVLEVDFES--ERFNLISEPAELGISALCCSQNNIIAGSWDGSLQIVDSR---SGDRW 127
             +V   ++ +  +  + ++ P  +   A+  S+  I+ GS D ++++ +     S ++ 
Sbjct: 76  DNKVRVFNYNTGEKVADFVAHPDYIRSIAVHPSKPYILTGSDDLTVKLWNWENDWSLEQT 135

Query: 128 FRERLDNCKILGMDCADNNKLVVSLTGGKVAIYDL----RNMIKPQIRESGLKFQTRDIK 183
           F+        +  +  D N         KV ++ L     N      +E G+ +   D  
Sbjct: 136 FKGHEHFVMCVAFNPKDPNVFASGCLDHKVKVWSLGQSTPNFTLHTGQEKGVNY--VDYY 193

Query: 184 LMPAANGYVQSSLDGRVAVEYFDQESSRFAFRCHRMNLPDTQFVFPVNSLCFNSNDGTLY 243
            +P     + SS D  V +  +  +S       H  N         V+   F+     + 
Sbjct: 194 PLPDKPYMITSSDDTTVKIFDYQTKSCVATLEGHMSN---------VSFAVFHPTLPIII 244

Query: 244 TGGSDGRVYGWNLSTRK 260
           +G  DG V  WN ST K
Sbjct: 245 SGSEDGTVKLWNSSTYK 261

>KLLA0D08514g complement(726710..727945) weakly similar to sp|P53873
           Saccharomyces cerevisiae YNL187w hypothetical protein
           singleton, start by similarity
          Length = 411

 Score = 30.8 bits (68), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 46/202 (22%), Positives = 78/202 (38%), Gaps = 51/202 (25%)

Query: 16  GLVIKGITPHVNVTAWDGTLSLYNYEDNDLVLRMRY---------NDALTSC--AYSEVG 64
            + I   T H    +    +++Y+Y  +  + + ++           A+ SC   Y+EV 
Sbjct: 168 SMTILQDTMHFMTGSVRNRITMYDYNRHKPIWQHQWTKQSCGKSSQKAIVSCFDEYNEVH 227

Query: 65  SKI-FVGSVSGEVLEVDFESERFNLISEPAELGISALCCSQNNIIAGSW-DGSLQIVDSR 122
             + F G+   EVL +D  S +  LISE   L               SW +G  Q++ S 
Sbjct: 228 DNVRFAGTYKTEVLRIDTRSTKSELISERDSL--------------DSWSNGIYQVIKSD 273

Query: 123 SGDRWFRERLDNCKILGMDCADNNKLVVSLTGGKVAIYDLRNMIKPQIRESGLKFQTRDI 182
           +G   +             C   N         ++ + D R M+K +I    L F+    
Sbjct: 274 NGHYLY-------------CIKRN-------AREIDVIDTR-MLKSRINILELPFKIGKQ 312

Query: 183 KL---MPAANGYVQSSLDGRVA 201
           K    + +A G +  S DG+VA
Sbjct: 313 KFKASLNSAKGLLIGSYDGQVA 334

>YGR111W (YGR111W) [2070] chr7 (715830..717032) Protein with
          similarity to southern house mosquito carboxylesterase
          PIR:S53372 [1203 bp, 400 aa]
          Length = 400

 Score = 30.8 bits (68), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 33/76 (43%), Gaps = 17/76 (22%)

Query: 3  FECFDSPPNDYISGLVIKGITPHVNVTAWDGTLSLYNYEDNDLVL-------RMRYNDAL 55
          FEC+  P         +K  T   N  AW G L++  Y D + +L       + + N+ +
Sbjct: 12 FECYSDPE--------LKRWTHLANAKAWKGILTVQQYADREQLLGSSEISQKNKSNEMM 63

Query: 56 TSC--AYSEVGSKIFV 69
          T    +Y  +G K FV
Sbjct: 64 TKYPKSYQWLGQKYFV 79

>Scas_695.15
          Length = 327

 Score = 30.4 bits (67), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 30/133 (22%), Positives = 54/133 (40%), Gaps = 11/133 (8%)

Query: 140 MDCADNNKLVVSLTGGKVAIYDLRNMIKPQIRE-SGLKFQTRDIKLMPAANGYVQSSLDG 198
           ++  ++ KL+ +     V +YD+R      +    G K     +         V SS DG
Sbjct: 58  LEITNDKKLLAAAGYQNVRLYDIRTTNPNAVATFEGHKGNVTSVSFQQDNKWMVTSSEDG 117

Query: 199 RVAVEYFDQESSRFAFRCHRMNLPDTQFVFPVNSLCFNSNDGTLYTGGSDGRVYGWNLST 258
            + V  +D  S     R ++ N P       VN +  + N G L +   DG +  W+L  
Sbjct: 118 TIKV--WDVRSPSVP-RNYKHNAP-------VNEVVIHPNQGELISCDRDGTIKIWDLGE 167

Query: 259 RKKSHEFPKFEDS 271
            + +H+    +D+
Sbjct: 168 NQCTHQLIPDDDN 180

>Scas_630.6
          Length = 621

 Score = 30.8 bits (68), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 28/65 (43%), Gaps = 2/65 (3%)

Query: 230 VNSLCFNSNDGTLYTGGSDGRVYGWNLSTRKKSHEFPKFEDSIVKLAYKND--VLCVATG 287
           + S+CF+ +   L TG  D  +  WN+  RK        E  I  L Y  D   L   +G
Sbjct: 344 IRSICFSPDGEFLATGAEDKLIRIWNIKERKIVMVLKGHEQDIYSLDYFPDGQKLVSGSG 403

Query: 288 DDSFK 292
           D S +
Sbjct: 404 DRSIR 408

>YCR072C (YCR072C) [597] chr3 complement(240800..242347) Protein of
           unknown function, member of WD (WD-40) repeat family
           [1548 bp, 515 aa]
          Length = 515

 Score = 30.4 bits (67), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 28/123 (22%), Positives = 51/123 (41%), Gaps = 13/123 (10%)

Query: 167 KPQIRESGLKFQTRDIKLMPAANGYVQSSLDGRVAVEYFDQESSRF--AFRCHRMNLPDT 224
           KP  R +G +     +   P     V +S D   +++ +D    +F   FR H       
Sbjct: 393 KPIARMTGHQKLVNHVAFSPDGRYIVSASFDN--SIKLWDGRDGKFISTFRGH------- 443

Query: 225 QFVFPVNSLCFNSNDGTLYTGGSDGRVYGWNLSTRKKSHEFPKFEDSIVKLAYKNDVLCV 284
             V  V  + ++S+   L +   D  +  W++ TRK S + P  +D +  + +  D   V
Sbjct: 444 --VASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTRKLSVDLPGHKDEVYTVDWSVDGKRV 501

Query: 285 ATG 287
            +G
Sbjct: 502 CSG 504

>AER263C [2765] [Homologous to ScYCR072C - SH] (1118228..1119769)
           [1542 bp, 513 aa]
          Length = 513

 Score = 30.4 bits (67), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 27/123 (21%), Positives = 51/123 (41%), Gaps = 13/123 (10%)

Query: 167 KPQIRESGLKFQTRDIKLMPAANGYVQSSLDGRVAVEYFDQESSRF--AFRCHRMNLPDT 224
           KP +R +G +     +   P     V +S D   +++ +D    +F   FR H       
Sbjct: 391 KPILRMTGHQKLVNHVAFSPDGRYIVSASFDN--SIKLWDGRDGKFIATFRGH------- 441

Query: 225 QFVFPVNSLCFNSNDGTLYTGGSDGRVYGWNLSTRKKSHEFPKFEDSIVKLAYKNDVLCV 284
             V  V  + ++S+   L +   D  +  W++ TRK + + P   D +  + +  D   V
Sbjct: 442 --VASVYQVAWSSDCRLLVSCSKDTTLKVWDVKTRKLTVDLPGHNDEVYTVDWSVDGKRV 499

Query: 285 ATG 287
            +G
Sbjct: 500 CSG 502

>Scas_575.6
          Length = 701

 Score = 30.4 bits (67), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 35/146 (23%), Positives = 60/146 (41%), Gaps = 31/146 (21%)

Query: 57  SCAYSEVGSKIFVGSVSGEVLEVDFESER----FNLISEPAELGISALCCSQNN--IIAG 110
           S AY+ V   ++VG+   E+  ++ E  R    F L SE    G++ +  +  N  +  G
Sbjct: 143 SLAYNAVNCDLYVGASGNELYRLNLEQGRFLNPFKLDSE----GVNHVSVNSTNGLVATG 198

Query: 111 SWDGSLQIVDSRSGDRWFRERLDNCKILGMDCADNNKLVVSLTG--------------GK 156
             +  ++  D RS     R R+   K+   +  DNN   V+ T               G 
Sbjct: 199 MEENVVEFWDPRS-----RSRV--AKLFLENQFDNNAFQVTTTSFRNDGLNFACGTSNGY 251

Query: 157 VAIYDLRNMIKPQIRESGLKFQTRDI 182
             +YDLR+     +++ G  F  + I
Sbjct: 252 TYLYDLRSSEPITVKDQGYGFDIKKI 277

>KLLA0F08811g complement(819834..821744) some similarities with
           sp|P38915 Saccharomyces cerevisiae YLR055c SPT8
           transcriptional adaptor or co-activator singleton,
           hypothetical start
          Length = 636

 Score = 30.0 bits (66), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 50/130 (38%), Gaps = 13/130 (10%)

Query: 78  EVDFESERFNLISEPAELGISALCCSQNNIIAGSWDGSLQIVDSRSGDRWFRERLDNCK- 136
           E+   +    + SE       AL   +N  +    DG++QI D R       +   N   
Sbjct: 448 EIQEHTSEKKVESETISKNTLALKTDENLFLTSCIDGNIQIWDRRQPSSEIIKLGRNVST 507

Query: 137 ----ILGMDCADNNKLVVSLTGGKVAIYDLRNMIKPQIRESGLKFQT-----RDIKLMPA 187
               +      D  K++       V IYDLR   KP++ ES LK  +       +K MP 
Sbjct: 508 PPWCMSACWSVDGGKVIAGRRNAVVEIYDLR---KPEVVESKLKLPSISGPVSKVKAMPN 564

Query: 188 ANGYVQSSLD 197
            +  V +S D
Sbjct: 565 NSHVVAASND 574

>YBR246W (YBR246W) [425] chr2 (711548..712711) Protein of unknown
           function, has moderate similarity to uncharacterized C.
           albicans Orf6.3427p [1164 bp, 387 aa]
          Length = 387

 Score = 30.0 bits (66), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 30/134 (22%), Positives = 56/134 (41%), Gaps = 33/134 (24%)

Query: 134 NCKILGMDCADNNKLVVSLTGGKVAIYDLRNMIKPQIRESGLKFQTRDIKLMPAANGYVQ 193
           +C    +DC    KL+V+ T G+ A  D+R               T  ++   +A     
Sbjct: 126 SCHFSPLDC---KKLLVTNTAGEAATIDIR---------------TLSVQFTASAIAQAY 167

Query: 194 SSLDGRVAVEYFDQESSRFAFRCHRMNLPDTQFVFPVNSLCFNSNDGTL-------YTGG 246
           S LD    ++Y  Q ++        +++   QF+ P    C+ +  G+L       +TGG
Sbjct: 168 SKLD---KIDYEVQGATEKV-----IHVESGQFLKPHELECWTAEFGSLQPFQDVVFTGG 219

Query: 247 SDGRVYGWNLSTRK 260
            D R+   +L +++
Sbjct: 220 DDSRIMAHDLRSKE 233

>KLLA0D12232g complement(1041135..1044527) some similarities with
           sp|P09547 Saccharomyces cerevisiae YPL016w SWI1
           component of SWI/SNF global transcription activator
           complex singleton, hypothetical start
          Length = 1130

 Score = 30.0 bits (66), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 19/31 (61%), Gaps = 1/31 (3%)

Query: 223 DTQFVFPVNSLCFNSNDGTLY-TGGSDGRVY 252
           D QF+FP  S   NS DG L+  GGS+G  Y
Sbjct: 2   DDQFLFPDESDPMNSGDGQLFGQGGSNGDEY 32

>KLLA0F10263g 949926..951974 gi|2494900|sp|P56094|TUP1_KLULA
           Kluyveromyces lactis Transcriptional repressor TUP1,
           start by similarity
          Length = 682

 Score = 30.0 bits (66), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 29/65 (44%), Gaps = 2/65 (3%)

Query: 230 VNSLCFNSNDGTLYTGGSDGRVYGWNLSTRKKSHEFPKFEDSIVKLAY--KNDVLCVATG 287
           + S+CF+ +   L TG  D  +  W+L T+K        E  I  L Y    + L   +G
Sbjct: 409 IRSVCFSPDGKFLATGAEDKLIRIWDLETKKIVMTLKGHEQDIYSLDYFPSGNKLVSGSG 468

Query: 288 DDSFK 292
           D + +
Sbjct: 469 DRTVR 473

>Scas_629.3
          Length = 769

 Score = 30.0 bits (66), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 16/25 (64%)

Query: 220 NLPDTQFVFPVNSLCFNSNDGTLYT 244
           N+PD++ VF  NS+  N   G LYT
Sbjct: 416 NIPDSKLVFIENSILINHQKGVLYT 440

>AEL314W [2191] [Homologous to ScYJL112W (MDV1) - SH; ScYKR036C
           (CAF4) - SH] complement(52978..55125) [2148 bp, 715 aa]
          Length = 715

 Score = 30.0 bits (66), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 45/100 (45%), Gaps = 8/100 (8%)

Query: 65  SKIFVGSVSGEVLEVDFESERFNLISEPAELGISALCCSQNNIIAGSWDGSLQIVDSRSG 124
           + +  G+  G V   D  S R     E     +++L     N++ GS D S++I D R+G
Sbjct: 578 AALATGTKDGIVRLWDLRSGRVVRTLEGHSDAVTSLQFDSLNLVTGSLDNSIRIWDLRTG 637

Query: 125 ---DRWFRERLDNCKILGMDCADNNKLVVSLTGGKVAIYD 161
              D +  E    C  L  D    NK+VV+   G V +Y+
Sbjct: 638 TLADTFSYEHPVTC--LQFDL---NKIVVANQEGTVKVYN 672

>Scas_720.95
          Length = 515

 Score = 30.0 bits (66), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 27/123 (21%), Positives = 51/123 (41%), Gaps = 13/123 (10%)

Query: 167 KPQIRESGLKFQTRDIKLMPAANGYVQSSLDGRVAVEYFDQESSRF--AFRCHRMNLPDT 224
           KP  R +G +     +   P     V +S D   +++ +D    +F   FR H       
Sbjct: 393 KPIARMTGHQKLVNHVAFSPDGRYIVSASFDN--SIKLWDGRDGKFISTFRGH------- 443

Query: 225 QFVFPVNSLCFNSNDGTLYTGGSDGRVYGWNLSTRKKSHEFPKFEDSIVKLAYKNDVLCV 284
             V  V  + ++++   L +   D  +  W++ TRK S + P  +D +  + +  D   V
Sbjct: 444 --VASVYQVAWSADCRLLVSCSKDTTLKVWDVRTRKLSVDLPGHKDEVYTVDWSVDGKRV 501

Query: 285 ATG 287
            +G
Sbjct: 502 CSG 504

>Kwal_23.3869
          Length = 414

 Score = 29.6 bits (65), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 30/62 (48%), Gaps = 1/62 (1%)

Query: 242 LYTGGSDGRVYGWNLSTRKKSHEFP-KFEDSIVKLAYKNDVLCVATGDDSFKTLPTVEGA 300
           L +G S G +Y WNL TR+   EF    +  ++ + + +  L V + D + + L   E  
Sbjct: 32  LISGDSQGHIYLWNLITRRIFAEFELNSKAHVISVDFIDGYLTVLSKDHTLRFLRIEEDT 91

Query: 301 EI 302
            +
Sbjct: 92  SL 93

>CAGL0J03476g 331933..333486 highly similar to sp|P25382
           Saccharomyces cerevisiae YCR072c, start by similarity
          Length = 517

 Score = 30.0 bits (66), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 28/123 (22%), Positives = 51/123 (41%), Gaps = 13/123 (10%)

Query: 167 KPQIRESGLKFQTRDIKLMPAANGYVQSSLDGRVAVEYFDQESSRF--AFRCHRMNLPDT 224
           KP  R +G +     +   P     V +S D   +++ +D +   F   FR H       
Sbjct: 395 KPISRMTGHQKLVNHVAFSPDGKYIVSASFDN--SIKLWDGKEGTFLSTFRGH------- 445

Query: 225 QFVFPVNSLCFNSNDGTLYTGGSDGRVYGWNLSTRKKSHEFPKFEDSIVKLAYKNDVLCV 284
             V  V  + ++S+   L +   D  +  W++ TRK S + P  +D +  + +  D   V
Sbjct: 446 --VASVYQVAWSSDCRLLVSCSKDTTLKVWDVKTRKLSVDLPGHQDEVYTVDWSVDGKRV 503

Query: 285 ATG 287
            +G
Sbjct: 504 CSG 506

>KLLA0D04840g 413362..414273 highly similar to sp|P41318
           Saccharomyces cerevisiae YNL006w LST8 required for
           transport of permeases from the golgi to the plasma
           membrane, start by similarity
          Length = 303

 Score = 29.6 bits (65), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 34/152 (22%), Positives = 61/152 (40%), Gaps = 12/152 (7%)

Query: 140 MDCADNNKLVVSLTGGKVAIYDLR-NMIKPQIRESGLKFQTRDIKLMPAANGYVQSSLDG 198
           ++   + K + +     V +YD+R N   P     G K     I         V SS DG
Sbjct: 38  LEITSDKKYLAAAGHLHVRLYDIRSNNPNPVSSFEGHKGNVTSIAFQQENRWMVSSSEDG 97

Query: 199 RVAVEYFDQESSRFAFRCHRMNLPDTQFVFPVNSLCFNSNDGTLYTGGSDGRVYGWNLST 258
            + V  +D  S     R ++ N P       VN +  + N G L +   DG +  W+L  
Sbjct: 98  TIKV--WDVRSPSVQ-RNYKHNAP-------VNEVAIHPNQGELISCDQDGNIRIWDLGE 147

Query: 259 RKKSHEF-PKFEDSIVKLAYKNDVLCVATGDD 289
            + +++  P+    +  L+  +D   +  G++
Sbjct: 148 NQCTNQLTPEDNTPLQSLSVASDGSMLVAGNN 179

>Sklu_2233.2 YMR049C, Contig c2233 5630-8059 reverse complement
          Length = 809

 Score = 29.6 bits (65), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 40/86 (46%), Gaps = 10/86 (11%)

Query: 230 VNSLCFNSNDGTLYTGGSDGRVYGWNLSTRKKSHEFPKF------EDSIVKLAYKND--- 280
           + +L  + +   L TG  DG V  W + T ++ ++          ED I  + +  D   
Sbjct: 447 IRTLSIDPSGLWLATGSDDGTVRIWEILTGREVYKVTIIDIDDNQEDHIETVEWNPDKTT 506

Query: 281 -VLCVATGDDSFKTLPTVEGAEIQPG 305
            +L VA G++ +  +P + G EI+ G
Sbjct: 507 GILAVAAGENIYLIVPPIFGFEIENG 532

>KLLA0E07942g 717476..718648 similar to sp|P20484 Saccharomyces
           cerevisiae YKL021c MAK11 involved in cell growth and
           replication of M1 dsRNA virus singleton, start by
           similarity
          Length = 390

 Score = 29.6 bits (65), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 35/89 (39%), Gaps = 17/89 (19%)

Query: 210 SRFAFRCHRMNLPDTQFVFPVNSLCFNSNDGTLYTGGSDGRVYGWNLSTRKKSHEFPKFE 269
           + F+   H   + D QF         N     L T GSDGR+  W++ TR          
Sbjct: 269 AEFSLLGHSNRVKDFQFYH-------NKFGHYLVTIGSDGRIVVWDMKTR---------- 311

Query: 270 DSIVKLAYKNDVLCVATGDDSFKTLPTVE 298
           D +        + CVA  D+S +   TV+
Sbjct: 312 DQVAVYDCGERLNCVAVCDESIEKYDTVK 340

>YJL112W (MDV1) [2803] chr10 (205222..207366) Protein involved in
           mitochondrial division and mitochondrial fission,
           contains WD (WD-40) repeats [2145 bp, 714 aa]
          Length = 714

 Score = 29.6 bits (65), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 23/54 (42%), Gaps = 2/54 (3%)

Query: 234 CFNSNDGTLYTGGSDGRVYGWNLSTRKKSHEFPKFEDSIVKLAYKNDVLCVATG 287
              S D  L TG  DG V  W+L + K         D+I  L +  D  C+ TG
Sbjct: 571 ALQSFDAALATGTKDGVVRLWDLRSGKVIRTLKGHTDAITSLKF--DSACLVTG 622

>Scas_721.7
          Length = 325

 Score = 29.3 bits (64), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 23/97 (23%), Positives = 45/97 (46%), Gaps = 4/97 (4%)

Query: 32  DGTLSLYNYEDNDLVLRMRYNDALTSCAYSEVGSKIFVGSVSGEVLEVD-FESERFNLIS 90
           D T+ + +     L   M +   + S  Y++ G+ +F  S+   +   D F       IS
Sbjct: 78  DFTIEITHLTHGCLHRLMGHTAPVISLTYNDSGNLLFTSSMDESIKIWDTFHGAILKTIS 137

Query: 91  EPAELGISALCCSQNN---IIAGSWDGSLQIVDSRSG 124
             +E  +S   C   +   + +GS+DG +++ D+R+G
Sbjct: 138 AHSESVVSLSICPDRDSSVLASGSFDGLIRLFDTRTG 174

>YKR036C (CAF4) [3289] chr11 complement(508344..510323) Protein that
           associates with Ccr4p, contains WD (WD-40) repeats [1980
           bp, 659 aa]
          Length = 659

 Score = 29.6 bits (65), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 26/59 (44%), Gaps = 3/59 (5%)

Query: 234 CFNSNDGTLYTGGSDGRVYGWNLSTRKKSHEFPKFEDSIVKLAYKNDVLCVATGDDSFK 292
           C+NS    L TG  DG V  W+L   K         D I  L + ++ L   + D+S +
Sbjct: 513 CYNS---ALATGTKDGIVRLWDLRVGKPVRLLEGHTDGITSLKFDSEKLVTGSMDNSVR 568

>KLLA0D09086g 763408..764607 weakly similar to sgd|S0006289
           Saccharomyces cerevisiae YPR085c hypothetical protein,
           hypothetical start
          Length = 399

 Score = 29.3 bits (64), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 30/65 (46%), Gaps = 7/65 (10%)

Query: 241 TLYTGGSDGRVYGWNLSTRKKSHEFPKFEDSIVKLAYKNDVLCVATGDDSFK------TL 294
           TL +G   G +  WNL +RK  +++      IV     ND++   + D + +      TL
Sbjct: 26  TLISGDEKGSILVWNLLSRKPYYKY-TCRGQIVSFQQLNDLIIATSKDHTLRILKFPSTL 84

Query: 295 PTVEG 299
            T EG
Sbjct: 85  TTKEG 89

>Kwal_27.10385
          Length = 536

 Score = 29.3 bits (64), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 28/54 (51%), Gaps = 6/54 (11%)

Query: 224 TQFVFPVNSLCFNSNDGTLYTGGSDGRVYGW--NLSTRKK----SHEFPKFEDS 271
           TQ    VN + FNS +  L T G DG++  W  N S  K+      EF +F++S
Sbjct: 68  TQHEQAVNVIRFNSRNDVLATAGDDGQLLLWKRNDSISKEFGVDEEEFAEFKES 121

>YKL012W (PRP40) [3244] chr11 (417953..419704) U1 snRNA-associated
           protein required for pre-mRNA splicing [1752 bp, 583 aa]
          Length = 583

 Score = 29.3 bits (64), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 33/62 (53%), Gaps = 3/62 (4%)

Query: 247 SDGRVYGWNLSTRKKSHEFPKFEDSIVKLA-YKNDVLCVATGDDSFKTLPTVEGAEIQPG 305
           +DG+VY +N +TR+ S   P FE  +  +A  K+D +  A  + +   +    G + +PG
Sbjct: 51  ADGKVYYYNPTTRETSWTIPAFEKKVEPIAEQKHDTVSHAQVNGN--RIALTAGEKQEPG 108

Query: 306 KV 307
           + 
Sbjct: 109 RT 110

>CAGL0F07337g complement(714870..716735) similar to sp|P26309
           Saccharomyces cerevisiae YGL116w CDC20 cell division
           control protein, hypothetical start
          Length = 621

 Score = 28.9 bits (63), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 46/192 (23%), Positives = 79/192 (41%), Gaps = 36/192 (18%)

Query: 88  LISEPAELGISALCCSQN--NIIAGSWDGSLQIVDSRSGD--RWFRERLDNCKILGMDCA 143
           L+ E  E  I+++  S +  +I  G  DG+ +I D  +    R  R +L N +I G    
Sbjct: 287 LLKEYEECQITSVHWSDDDCHISIGKSDGNTEIWDVETSTLVRTMRSKL-NVRI-GSQSW 344

Query: 144 DNNKLVVSLTGGKVAIYDLRNMIKPQIRES---------GLKFQTRDIKLMPAANGYVQS 194
               L      G++ I D+R  IK  I  +         GL ++   ++L    N     
Sbjct: 345 LETLLATGFRSGEIQINDVR--IKDHIVNTWDEHTGEVCGLSYKADGLQLASGGNDNTMM 402

Query: 195 SLDGRVAVEYFDQESSRFAFRCHRMNLPDTQFVFPVNSLCFN-SNDGTLYTGG--SDGRV 251
             D R ++  F ++    A                V +L ++ +N G L +GG  +D ++
Sbjct: 403 IWDTRTSMPQFVKKDHSAA----------------VKALAWSPTNAGLLASGGGQTDQQI 446

Query: 252 YGWNLSTRKKSH 263
           + WN +T  K H
Sbjct: 447 HFWNSTTGAKLH 458

>CAGL0D04862g 472577..475336 similar to sp|Q01454 Saccharomyces
           cerevisiae YPR135w POB1 DNA-directed DNA polymerase
           alpha-binding protein, start by similarity
          Length = 919

 Score = 28.9 bits (63), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 38/154 (24%), Positives = 61/154 (39%), Gaps = 8/154 (5%)

Query: 25  HVNVTAWDGTLSLYNYE---DNDLVLRMRYNDALTSCAYSEVGSKIFVGSVSGEVLEVDF 81
           H+ V +  G + + N E   D   VL +   D  + C  S+  SK+ V SV+G+    D 
Sbjct: 25  HLCVGSKIGIVKILNTERVQDEPRVLEV-VKDLTSVCFGSKDDSKLLVTSVTGDAYLYDA 83

Query: 82  ESERFN---LISEPAELGISALCCSQNNIIAGSWDGSLQIVDSRSGDRWFRERLDNCKIL 138
             E      L      L    +  S    + G  D  L ++D   GDR   +  +    L
Sbjct: 84  RDEGSTGKLLTRSVLPLRDCQIIHSDKYAVFGGDDLQLTLIDLDGGDRNTLKTEEQVSSL 143

Query: 139 GMDCADNNKLVVSLTGGKVAIYDLRNMIKPQIRE 172
                 +N L VS   GKV  + + + +  ++ E
Sbjct: 144 SY-SKQSNILAVSFINGKVQFFSVSSAVPNKVHE 176

>Kwal_14.2415
          Length = 597

 Score = 28.9 bits (63), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 51/123 (41%), Gaps = 29/123 (23%)

Query: 103 SQNNIIAGSWDGSLQIVDSRSGDRWFRERLDN------------CKILGMDCAD-----N 145
           +++ +I  S+     +VD R G+RWFR+ L +            C   G+D        N
Sbjct: 472 NRSRMIVASFLSKNLLVDWRWGERWFRKHLMDADLTSNSGGWGFCSSTGIDAQPYFRIFN 531

Query: 146 NKLVVSLTGGKVA-----IYDLRNMIKPQIRESGLKFQTRDIKLMPAANGYVQSSLDGRV 200
            KL       K A     I +LRN+   +I   GL  Q       P+ NGY +  +D + 
Sbjct: 532 MKLQSEKYDPKGAFVKEWIPELRNINDVKILREGLANQ-------PSVNGYPKPIVDLKE 584

Query: 201 AVE 203
           + E
Sbjct: 585 SRE 587

>YHR186C (KOG1) [2471] chr8 complement(475997..480670) Component of
            the TOR complex 1 (Tor1p or Tor2p-Kog1p-Lst8p), which is
            required for wild-type growth, maintenance of cell and
            vacuole size and morphology, protein synthesis,
            maintenance of glycogen homeostasis [4674 bp, 1557 aa]
          Length = 1557

 Score = 28.9 bits (63), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 41/154 (26%), Positives = 63/154 (40%), Gaps = 31/154 (20%)

Query: 28   VTAWDGTLSLYNYEDNDLVLRMRYNDALTSCAYSEVGSKIFVGSVS--------GEVLEV 79
            V+AW G          D++L  R    LT       GS +  G V          E +EV
Sbjct: 1295 VSAWRGL--------TDMLLTPRSTGLLTEWLQIR-GSLLTTGDVKVIRVWDAHTETVEV 1345

Query: 80   DFESERFNLISEPAELGISALCCSQNNIIAGSWDGSLQIVDSRSGDR---WFRERLDNCK 136
            D  ++  +LI+      ++A   + N  +AG  DGSL++ D R   R     R R  N K
Sbjct: 1346 DIPAKTSSLIT-----SLTADQLAGNIFVAGFADGSLRVYDRRLDPRDSMIRRWRAGNDK 1400

Query: 137  I------LGMDCADNNKLVVSLTGGKVAIYDLRN 164
                   + +      +LV   T G V ++D+R+
Sbjct: 1401 QGVWINNVHLQRGGYRELVSGATNGVVELWDIRS 1434

>KLLA0D16390g 1378884..1381694 similar to sp|Q12220 Saccharomyces
           cerevisiae YLR129w DIP2 DOM34P-interacting protein,
           start by similarity
          Length = 936

 Score = 28.5 bits (62), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 37/181 (20%), Positives = 66/181 (36%), Gaps = 7/181 (3%)

Query: 107 IIAGSWDGSLQIVDSRSGDRWFRERLDNCKILGMDCADNNKLVVSLTGGKVAIY---DLR 163
           ++ G+  G LQ+ D  S             I  +D   N K +V+ +  K   +   ++ 
Sbjct: 437 VVVGTRQGELQLFDLASSTLLSTTEAHTAAIWSLDLTSNGKRLVTGSADKSCKFWDFEVV 496

Query: 164 NMIKPQIRES---GLKF-QTRDIKLMPAANGYVQSSLDGRVAVEYFDQESSRFAFRCHRM 219
             + P  ++     LK      ++L         SS D  +AV   D     F F   + 
Sbjct: 497 EQLVPGTKDKYIPQLKLVHDTTLELTDDILAVKISSEDRYLAVSLLDNTVKVFFFDSLKF 556

Query: 220 NLPDTQFVFPVNSLCFNSNDGTLYTGGSDGRVYGWNLSTRKKSHEFPKFEDSIVKLAYKN 279
            L       PV S+ F+ +   L T  +D  +  W +            +DSI+ + ++ 
Sbjct: 557 YLSLYGHKLPVLSIDFSVDSKMLITSSADKNIKIWGVDFGDCHKSIFAHQDSIMSVRFEA 616

Query: 280 D 280
           D
Sbjct: 617 D 617

>YGL213C (SKI8) [1783] chr7 complement(90057..91250) Protein
           involved in meiotic recombination and in protection from
           double-stranded RNA (dsRNA) viruses, member of the WD
           (WD-40) repeat family [1194 bp, 397 aa]
          Length = 397

 Score = 28.5 bits (62), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 30/62 (48%), Gaps = 3/62 (4%)

Query: 230 VNSLCFNSNDGTLYTGGSDGRVYGWNLSTRKKSHEFPKFEDSIVKLAYKNDVLCVATGDD 289
           V SL FN +  TL + G DG++  W++ T+++        D I     + D+L V    D
Sbjct: 294 VMSLSFNDSGETLCSAGWDGKLRFWDVKTKERITTLNMHCDDI---EIEEDILAVDEHGD 350

Query: 290 SF 291
           S 
Sbjct: 351 SL 352

>CAGL0M06193g 643917..644867 similar to sp|P38123 Saccharomyces
           cerevisiae YBR175w, start by similarity
          Length = 316

 Score = 28.5 bits (62), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 24/105 (22%), Positives = 40/105 (38%), Gaps = 10/105 (9%)

Query: 177 FQTRDIKLMPAANGYVQS--SLDGRVAVEYFDQESSRFAFR----CHRMNLPDTQFVFPV 230
           +Q R+  ++  A G  Q   S DG+      D  +     R     HR+         PV
Sbjct: 44  YQLRETLVLEHAAGVSQICWSPDGKCIASCSDDFTVVVTHRQLGLLHRL----VGHTAPV 99

Query: 231 NSLCFNSNDGTLYTGGSDGRVYGWNLSTRKKSHEFPKFEDSIVKL 275
            SLC+N+    L+T   D  +  W++ T           + +V +
Sbjct: 100 ISLCYNNKGNLLFTSSMDESIKVWDVLTGTVMKTMSAHSEPVVSI 144

>YCR084C (TUP1) [608] chr3 complement(260307..262448) General
           repressor of RNA polymerase II transcription that is
           brought to target promoters by regulated,
           sequence-specific DNA-binding proteins, exists in a
           complex with Ssn6p that is converted to a
           transcriptional activator in a Hog1p-dependent manner
           [2142 bp, 713 aa]
          Length = 713

 Score = 28.5 bits (62), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 28/65 (43%), Gaps = 2/65 (3%)

Query: 230 VNSLCFNSNDGTLYTGGSDGRVYGWNLSTRKKSHEFPKFEDSIVKLAY--KNDVLCVATG 287
           + S+CF+ +   L TG  D  +  W++  RK        E  I  L Y    D L   +G
Sbjct: 446 IRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSGSG 505

Query: 288 DDSFK 292
           D + +
Sbjct: 506 DRTVR 510

>AGR207C [4518] [Homologous to ScYBR175W (SWD3) - SH]
           (1146710..1147672) [963 bp, 320 aa]
          Length = 320

 Score = 28.1 bits (61), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 19/85 (22%), Positives = 37/85 (43%), Gaps = 7/85 (8%)

Query: 223 DTQFVFPVNSLCFNSNDGTLYTGGSDGRVYGWNLS----TRKKSHEFPKFEDSIVKLAYK 278
           +T    P+N +C++ +   + +G  D  V   +L      + + H  P      V    K
Sbjct: 51  ETTHTEPINDICWSPDSACVASGSEDFTVEITHLEYGRLHKLRGHSAPVLS---VVFNCK 107

Query: 279 NDVLCVATGDDSFKTLPTVEGAEIQ 303
            ++LC A+ D+S K    + G  ++
Sbjct: 108 GNLLCTASVDESIKQWDVLSGTLLK 132

>ABL044C [548] [Homologous to ScYMR093W - SH] (312378..313934) [1557
           bp, 518 aa]
          Length = 518

 Score = 28.5 bits (62), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 33/138 (23%), Positives = 55/138 (39%), Gaps = 13/138 (9%)

Query: 144 DNNKLVVSLTGGKVAIYDLRNMIKPQIRESGLKFQTRDIKLMPAANGYVQSS-LDGRVAV 202
           D   LV +     V ++D+ +  +P +   G     R +  +P A   V S   DG V +
Sbjct: 136 DKQTLVTATDDRVVRVWDISHAYEPTLELLGASDYVRSVCFVPGAPHMVVSGCYDGVVRL 195

Query: 203 EYFDQESSRFAFRC-HRMNLPDTQFVFPVNSLCFNSNDGTLYTGGSDGRVYGWNLSTRKK 261
                 S++   +  H M++ D   + P            +  GGS  +V  W+L+  K 
Sbjct: 196 HDTRTRSAQPVTQLNHGMSVEDIVAISPTQ---------LVSCGGSKFKV--WDLTGNKL 244

Query: 262 SHEFPKFEDSIVKLAYKN 279
            HE   F  ++  L Y N
Sbjct: 245 LHERGNFAKTVTCLDYVN 262

>Scas_592.4*
          Length = 318

 Score = 28.1 bits (61), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 38/179 (21%), Positives = 74/179 (41%), Gaps = 24/179 (13%)

Query: 108 IAGSWDGSLQIVDSRSGDRWFRERLDNCKILGMDCADNNKLVVSLTGGK---VAIYDLRN 164
           ++ SWD +L++ D  +G+ +  +R    K   M  A + K  + ++G +   + ++ ++ 
Sbjct: 81  LSASWDKTLRLWDVATGETY--QRFVGHKSDVMSVAIDRKASMIISGSRDKTIKVWTIKG 138

Query: 165 MIKPQIRESGLKFQTRDIKLMPA-----ANGYVQSSLDGRVAVEYFDQESSRFAFRCHRM 219
                +   G       +++ P      A   + +  D  V     +Q      F  H  
Sbjct: 139 QCLATLL--GHNDWVSQVRIAPTDQNDDAVTVISAGNDKMVKAWNLNQFQIEADFVGHNG 196

Query: 220 NLPDTQFVFPVNSLCFNSNDGTLY-TGGSDGRVYGWNLSTRKKSHEFPKFEDSIVKLAY 277
           N         VN++   S DGTL  + G DG +  WNL+ +K  +     +D +  LA+
Sbjct: 197 N---------VNAVT-ASPDGTLIASAGKDGEIMLWNLAEKKAMYTLSA-QDEVFSLAF 244

>Scas_706.24
          Length = 460

 Score = 28.1 bits (61), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 37/78 (47%), Gaps = 6/78 (7%)

Query: 52  NDALTSCAYSEVGSKIFVGSVSGE--VLEV--DFESERFNLISEPAELGISALCCSQ--N 105
           ND + S ++   G  IF+G  SG+  +LEV  D     F LI +     IS +       
Sbjct: 203 NDTIYSISWDNSGKFIFIGFRSGKLALLEVSDDTGEMTFKLIVQAHRSAISVIKMDPVGR 262

Query: 106 NIIAGSWDGSLQIVDSRS 123
            +I GS DGS  + D+ +
Sbjct: 263 FVITGSTDGSCALWDTST 280

>ADL322C [1419] [Homologous to ScYBR103W (SIF2) - SH]
           (128830..130335) [1506 bp, 501 aa]
          Length = 501

 Score = 28.1 bits (61), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 25/119 (21%), Positives = 49/119 (41%), Gaps = 4/119 (3%)

Query: 98  SALCCSQNNIIAGSWDGSLQIVDSRSGDRWFRERLDNC-KILGMDCADNNKLVVSLTGGK 156
           SA     + II+ S DGS+++    S        +D      G    D  K       G+
Sbjct: 370 SAHWVDDDTIISTSMDGSIRVWSLASNSTVASATVDGVPNFTGALSPDQGKFATGTLDGE 429

Query: 157 VAIYDLRNMIKPQIRESGLKFQTR--DIKLMPAANGYVQSSLDGRVAVEYFDQESSRFA 213
           V +YD++ +++ Q+  +G     R  ++  +P    +  +     V    + QES++ +
Sbjct: 430 VMVYDIQKLLQ-QLNHNGYHGTARSAEVARIPVVGDHRSAREGNYVTQISWSQESTQLS 487

>KLLA0A09471g complement(827264..831784) similar to sp|P38873
            Saccharomyces cerevisiae YHR186c singleton, start by
            similarity
          Length = 1506

 Score = 28.5 bits (62), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 57/249 (22%), Positives = 92/249 (36%), Gaps = 72/249 (28%)

Query: 28   VTAWDGTLSLYNYEDNDLVLRMRYNDALTSCAYSEVGSKIFVGSVSGEVLEVDFESERFN 87
            +++W G          DL+L  R    LT    S  GS +  G V  +++ +      ++
Sbjct: 1250 ISSWRGL--------TDLLLTPRSTGLLTEWQQSR-GSLLVTGDV--KIIRI------WD 1292

Query: 88   LISEPAELGISALCC-----------SQNNIIAGSWDGSLQIVDSRSGDR------WFRE 130
             ++E  E+ I A              S N  +AG  DGS+++ D R   R      W   
Sbjct: 1293 ALTESVEVDIPAKSSSLITSLTSDQFSGNIFVAGYSDGSIRVYDRRMDPRDSMIRLWKTP 1352

Query: 131  RLDNCKI------LGMDCADNNKLVVSLTGGKVAIYDLR--------------------N 164
            + DN  +      + +      +LV     G VA++D+R                     
Sbjct: 1353 KSDNSPVGSWVNNIHLQRGGYRELVSGTNNGVVALWDIRADKPVCTFTDEGEPGKKLGST 1412

Query: 165  MIKPQIRE--SGLKFQTRDIKLMPAANGYVQ------SSLDGRVAVEYFDQESSRF---- 212
            M   Q+ E  S +   T++IKL   +   ++      SS  G ++       SS F    
Sbjct: 1413 MTSMQVHEHASIIATGTKEIKLWTTSGDLLRTFKNHGSSHSGPISGMTTGARSSPFISTM 1472

Query: 213  AFRCHRMNL 221
            AF  HRM L
Sbjct: 1473 AFHPHRMML 1481

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.137    0.415 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,654,186
Number of extensions: 465505
Number of successful extensions: 1677
Number of sequences better than 10.0: 103
Number of HSP's gapped: 1614
Number of HSP's successfully gapped: 108
Length of query: 308
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 207
Effective length of database: 13,099,691
Effective search space: 2711636037
Effective search space used: 2711636037
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 61 (28.1 bits)