Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_52.1944321221011191e-158
Sklu_951.12232209011e-124
KLLA0D15037g2252208191e-112
AAR037W2622167651e-103
YPR113W (PIS1)2202097352e-99
CAGL0G03157g2192107264e-98
Scas_705.202212097082e-95
KLLA0F05027g298811112e-06
CAGL0I03784g270711103e-06
Scas_645.24239651084e-06
Sklu_2382.8271681032e-05
ADR084C277721014e-05
Kwal_56.2450326268988e-05
AGR344W39090850.005
YDL142C (CRD1)28371840.006
Scas_31.125793830.009
YHR123W (EPT1)39188770.055
KLLA0E07590g20242730.14
Kwal_33.1471538989730.18
CAGL0K09570g39756720.25
Scas_666.34*37655700.40
KLLA0F24354g39192700.41
ABR180W259660700.48
YNL130C (CPT1)39356651.6
AFR408C25163607.4
Kwal_27.12401236102599.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_52.19443
         (210 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_52.19443                                                         435   e-158
Sklu_951.1 YPR113W, Contig c951 1150-1821 reverse complement          351   e-124
KLLA0D15037g 1269125..1269802 similar to sp|P06197 Saccharomyces...   320   e-112
AAR037W [223] [Homologous to ScYPR113W (PIS1) - SH] complement(4...   299   e-103
YPR113W (PIS1) [5534] chr16 (752253..752915) CDP-diacylglycerol-...   287   2e-99
CAGL0G03157g 292181..292840 highly similar to sp|P06197 Saccharo...   284   4e-98
Scas_705.20                                                           277   2e-95
KLLA0F05027g complement(492389..493285) similar to sp|Q07560 Sac...    47   2e-06
CAGL0I03784g complement(325276..326088) similar to sp|Q07560 Sac...    47   3e-06
Scas_645.24                                                            46   4e-06
Sklu_2382.8 YDL142C, Contig c2382 19681-20496                          44   2e-05
ADR084C [1825] [Homologous to ScYDL142C (CRD1) - SH] (856914..85...    44   4e-05
Kwal_56.24503                                                          42   8e-05
AGR344W [4655] [Homologous to ScYNL130C (CPT1) - SH; ScYHR123W (...    37   0.005
YDL142C (CRD1) [726] chr4 complement(201720..202571) Cardiolipin...    37   0.006
Scas_31.1                                                              37   0.009
YHR123W (EPT1) [2411] chr8 (354817..354866,354958..356083) sn-1,...    34   0.055
KLLA0E07590g complement(686610..687218) no similarity, hypotheti...    33   0.14 
Kwal_33.14715                                                          33   0.18 
CAGL0K09570g 942032..943225 similar to sp|P17898 Saccharomyces c...    32   0.25 
Scas_666.34*                                                           32   0.40 
KLLA0F24354g join(2269337..2269386,2269496..2270621) similar to ...    32   0.41 
ABR180W [773] [Homologous to ScYLR454W - SH] complement(742456.....    32   0.48 
YNL130C (CPT1) [4465] chr14 complement(379558..380689,380782..38...    30   1.6  
AFR408C [3600] [Homologous to ScYDR472W (TRS31) - SH] (1169595.....    28   7.4  
Kwal_27.12401                                                          27   9.5  

>Kwal_52.19443
          Length = 212

 Score =  435 bits (1119), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 210/210 (100%), Positives = 210/210 (100%)

Query: 1   MAQVTAKQVLWYIPNQIGYMRVATAVISFFLMAGHPVWTTWVYGTSCLLDALDGTMARKY 60
           MAQVTAKQVLWYIPNQIGYMRVATAVISFFLMAGHPVWTTWVYGTSCLLDALDGTMARKY
Sbjct: 1   MAQVTAKQVLWYIPNQIGYMRVATAVISFFLMAGHPVWTTWVYGTSCLLDALDGTMARKY 60

Query: 61  NQTSGFGAVLDMVTDRSTTSSLLCFLCVQYPRFAAVFQILLSLDLSSHYMHMYATLSSGG 120
           NQTSGFGAVLDMVTDRSTTSSLLCFLCVQYPRFAAVFQILLSLDLSSHYMHMYATLSSGG
Sbjct: 61  NQTSGFGAVLDMVTDRSTTSSLLCFLCVQYPRFAAVFQILLSLDLSSHYMHMYATLSSGG 120

Query: 121 ESHKKIEKEQWLLNLYYSRRSVLFTVCAFNELFYLALYLYGFPQLAGIGGVLAVVCLPGY 180
           ESHKKIEKEQWLLNLYYSRRSVLFTVCAFNELFYLALYLYGFPQLAGIGGVLAVVCLPGY
Sbjct: 121 ESHKKIEKEQWLLNLYYSRRSVLFTVCAFNELFYLALYLYGFPQLAGIGGVLAVVCLPGY 180

Query: 181 VFKQVANIVQLKRAAMLLASKDAEQASGKR 210
           VFKQVANIVQLKRAAMLLASKDAEQASGKR
Sbjct: 181 VFKQVANIVQLKRAAMLLASKDAEQASGKR 210

>Sklu_951.1 YPR113W, Contig c951 1150-1821 reverse complement
          Length = 223

 Score =  351 bits (901), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 162/220 (73%), Positives = 188/220 (85%), Gaps = 10/220 (4%)

Query: 1   MAQVTAKQVLWYIPNQIGYMRVATAVISFFLMAGHPVWTTWVYGTSCLLDALDGTMARKY 60
           M+  T + VLWYIPNQIGY RV TA++SFFLM  HP++T  VYG SCLLDALDGTMARKY
Sbjct: 1   MSVFTPQTVLWYIPNQIGYTRVVTAILSFFLMEKHPLYTMLVYGISCLLDALDGTMARKY 60

Query: 61  NQTSGFGAVLDMVTDRSTTSSLLCFLCVQYPRFAAVFQILLSLDLSSHYMHMYATLSSGG 120
           NQTSG GAVLDMVTDRSTTSSLLCFLCV YPRFA++FQIL+SLDLSSHYMHMYATLS+GG
Sbjct: 61  NQTSGLGAVLDMVTDRSTTSSLLCFLCVLYPRFASIFQILISLDLSSHYMHMYATLSTGG 120

Query: 121 ESHKKIEKEQWLLNLYYSRRSVLFTVCAFNELFYLALYLYGFPQL----------AGIGG 170
           +SHKKIEKEQWLLNLYYS R +LFT+CAFNE+FY+ALYLY FPQL            I G
Sbjct: 121 DSHKKIEKEQWLLNLYYSNRQMLFTICAFNEIFYMALYLYAFPQLKHVDLPVLGSTHIAG 180

Query: 171 VLAVVCLPGYVFKQVANIVQLKRAAMLLASKDAEQASGKR 210
           ++A VCLPGY+FKQ+ANI+QLKRAAM+LA+KDA +A+ ++
Sbjct: 181 IIAAVCLPGYIFKQIANIIQLKRAAMMLATKDAREANERK 220

>KLLA0D15037g 1269125..1269802 similar to sp|P06197 Saccharomyces
           cerevisiae YPR113w PIS1 CDP diacylglycerol--inositol
           3-phosphatidyltransferase singleton, start by similarity
          Length = 225

 Score =  320 bits (819), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 145/220 (65%), Positives = 179/220 (81%), Gaps = 10/220 (4%)

Query: 1   MAQVTAKQVLWYIPNQIGYMRVATAVISFFLMAGHPVWTTWVYGTSCLLDALDGTMARKY 60
           M+ VTA+ VLWYIPNQIGY+RV T  +S  LMA HP+WT  VYG SCLLDALDGTMARKY
Sbjct: 1   MSAVTARDVLWYIPNQIGYVRVVTMCLSLVLMAKHPLWTMVVYGVSCLLDALDGTMARKY 60

Query: 61  NQTSGFGAVLDMVTDRSTTSSLLCFLCVQYPRFAAVFQILLSLDLSSHYMHMYATLSSGG 120
            Q S FGAVLDMVTDRSTT++L+CFLCV YP ++ VFQ+L++LD+SSHY+HMYATLS+G 
Sbjct: 61  GQISSFGAVLDMVTDRSTTTALICFLCVAYPVWSPVFQLLVALDISSHYIHMYATLSTGS 120

Query: 121 ESHKKIEKEQWLLNLYYSRRSVLFTVCAFNELFYLALYLYGFPQLAG----------IGG 170
           +SHK IEKEQWLLNLYY+RR VLFT+CA NE+FY+ LY+  FPQ             IG 
Sbjct: 121 QSHKAIEKEQWLLNLYYTRRKVLFTICALNEMFYMGLYINAFPQFKSYYFPLLGSTHIGA 180

Query: 171 VLAVVCLPGYVFKQVANIVQLKRAAMLLASKDAEQASGKR 210
           ++A+VCLPGY+FKQ+AN+VQL RAA++LA+KDA +A+ +R
Sbjct: 181 IIALVCLPGYIFKQIANVVQLNRAALMLANKDAAEATERR 220

>AAR037W [223] [Homologous to ScYPR113W (PIS1) - SH]
           complement(407884..408672) [789 bp, 262 aa]
          Length = 262

 Score =  299 bits (765), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 145/216 (67%), Positives = 172/216 (79%), Gaps = 11/216 (5%)

Query: 4   VTAKQVLWYIPNQIGYMRVATAVISFFLMAGHPVWTTWVYGTSCLLDALDGTMARKYNQT 63
           VTAKQVL YIPN IGYMRVAT V++ FLM  HP WTT VYG SCLLDALDGTMAR+Y QT
Sbjct: 42  VTAKQVLRYIPNCIGYMRVATMVVACFLMKNHPAWTTVVYGVSCLLDALDGTMARRYGQT 101

Query: 64  SGFGAVLDMVTDRSTTSSLLCFLCVQYPRFAAVFQILLSLDLSSHYMHMYATLSSGGESH 123
           S FGAVLDMVTDRSTT++L+CFLC+ YPR+  VFQ+L++LDLSSHYMHMY +LS  G+SH
Sbjct: 102 SRFGAVLDMVTDRSTTNALICFLCLLYPRWTPVFQLLIALDLSSHYMHMYGSLSC-GDSH 160

Query: 124 KKIEKEQWLLNLYYSRRSVLFTVCAFNELFYLALYLYGFPQLAGI----------GGVLA 173
           KKIEK+QWLL++YYSRR VLF VC  NELFY  +YL GFPQL  +          G ++A
Sbjct: 161 KKIEKDQWLLHMYYSRRDVLFAVCFLNELFYFGIYLAGFPQLWHLWLPGLGRLHFGTLVA 220

Query: 174 VVCLPGYVFKQVANIVQLKRAAMLLASKDAEQASGK 209
           ++CLPGYVFKQ+ N+VQL RAA+LLA  DA  A+ +
Sbjct: 221 LLCLPGYVFKQITNVVQLNRAALLLAHMDARDATRR 256

>YPR113W (PIS1) [5534] chr16 (752253..752915)
           CDP-diacylglycerol-inositol 3-phosphatidyltransferase
           (phosphatidylinositol synthase) [663 bp, 220 aa]
          Length = 220

 Score =  287 bits (735), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 134/209 (64%), Positives = 163/209 (77%), Gaps = 1/209 (0%)

Query: 3   QVTAKQVLWYIPNQIGYMRVATAVISFFLMAGHPVWTTWVYGTSCLLDALDGTMARKYNQ 62
           +VTA+ VLWYIPN+IGY+RV TA +SFF+M  HP   TW+Y TSCLLDALDGTMARKYNQ
Sbjct: 9   KVTAEHVLWYIPNKIGYVRVITAALSFFVMKNHPTAFTWLYSTSCLLDALDGTMARKYNQ 68

Query: 63  TSGFGAVLDMVTDRSTTSSLLCFLCVQYPRFAAVFQILLSLDLSSHYMHMYATLSSGGES 122
            S  GAVLDMVTDRS+T+ L+CFLCVQYP++   FQ++L LD++SHYMHMYA+LS+G  S
Sbjct: 69  VSSLGAVLDMVTDRSSTAGLMCFLCVQYPQWCVFFQLMLGLDITSHYMHMYASLSAGKTS 128

Query: 123 HKKI-EKEQWLLNLYYSRRSVLFTVCAFNELFYLALYLYGFPQLAGIGGVLAVVCLPGYV 181
           HK + E E  LL+LYY+RR VLFT+CAFNELFY  LYL  F   A  G    ++  PGYV
Sbjct: 129 HKSVGEGESRLLHLYYTRRDVLFTICAFNELFYAGLYLQLFSNSATFGKWTTIISFPGYV 188

Query: 182 FKQVANIVQLKRAAMLLASKDAEQASGKR 210
           FKQ AN+VQLKRAA++LA  DA+ A+ K 
Sbjct: 189 FKQTANVVQLKRAALILADNDAKNANEKN 217

>CAGL0G03157g 292181..292840 highly similar to sp|P06197
           Saccharomyces cerevisiae YPR113w PIS1 CDP
           diacylglycerol--inositol 3-phosphatidyltransferase,
           hypothetical start
          Length = 219

 Score =  284 bits (726), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 136/210 (64%), Positives = 162/210 (77%), Gaps = 3/210 (1%)

Query: 3   QVTAKQVLWYIPNQIGYMRVATAVISFFLMAGHPVWTTWVYGTSCLLDALDGTMARKYNQ 62
           QVTAK V+WYIPN+IGYMRV +A+ISF  M  +P  T  VYG SCLLDALDGTMARKYNQ
Sbjct: 6   QVTAKDVVWYIPNKIGYMRVISAIISFATMRDYPFLTMLVYGVSCLLDALDGTMARKYNQ 65

Query: 63  TSGFGAVLDMVTDRSTTSSLLCFLCVQYPR--FAAVFQILLSLDLSSHYMHMYATLSSGG 120
            S  GAVLDMVTDRSTTS L+C+LC  YP   +   FQ+LL LD+SSHYMHMYA LS G 
Sbjct: 66  VSRLGAVLDMVTDRSTTSGLMCYLCFAYPSRIWCVFFQVLLGLDISSHYMHMYANLSGGQ 125

Query: 121 ESHKKIEKE-QWLLNLYYSRRSVLFTVCAFNELFYLALYLYGFPQLAGIGGVLAVVCLPG 179
            SHK + KE   LL+LYY+RR VLFT+CAFNE+FY  LY Y FPQ A +G  L ++CLPG
Sbjct: 126 GSHKNVSKESSRLLHLYYTRRDVLFTICAFNEVFYGGLYFYSFPQYATVGKWLCIICLPG 185

Query: 180 YVFKQVANIVQLKRAAMLLASKDAEQASGK 209
           Y+FKQVAN++QL RAA++LA  DA+ A+ +
Sbjct: 186 YIFKQVANVIQLNRAALMLAELDAKDANER 215

>Scas_705.20
          Length = 221

 Score =  277 bits (708), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 130/209 (62%), Positives = 160/209 (76%), Gaps = 1/209 (0%)

Query: 2   AQVTAKQVLWYIPNQIGYMRVATAVISFFLMAGHPVWTTWVYGTSCLLDALDGTMARKYN 61
              TA  V WYIPNQIGYMRV TAVISFF M  +PV+T  VYG SCLLDALDGTMARKYN
Sbjct: 9   GSTTANTVFWYIPNQIGYMRVLTAVISFFTMHNYPVFTGLVYGISCLLDALDGTMARKYN 68

Query: 62  QTSGFGAVLDMVTDRSTTSSLLCFLCVQYPRFAAVFQILLSLDLSSHYMHMYATLSSGGE 121
           Q S  GAVLDMVTDRSTTS L CFLC ++P +  +FQ+LL+LD+SSHYMHMYATLSSG  
Sbjct: 69  QVSTLGAVLDMVTDRSTTSGLTCFLCYKFPSWCVIFQLLLALDISSHYMHMYATLSSGTT 128

Query: 122 SHKKIEKE-QWLLNLYYSRRSVLFTVCAFNELFYLALYLYGFPQLAGIGGVLAVVCLPGY 180
           SHK +  E   LL+LYY+RR VLFT+C FNE FY  LYL+ +      G  +A++ LPG+
Sbjct: 129 SHKNVSNESSKLLHLYYTRRDVLFTICFFNESFYGGLYLFAYDNYHTFGKWVALISLPGF 188

Query: 181 VFKQVANIVQLKRAAMLLASKDAEQASGK 209
           +FKQ+ N++QL+RAA++LA+ DA +A+ +
Sbjct: 189 IFKQITNVIQLQRAALILATSDATKANER 217

>KLLA0F05027g complement(492389..493285) similar to sp|Q07560
           Saccharomyces cerevisiae YDL142c PGS1 cardiolipin
           synthase singleton, start by similarity
          Length = 298

 Score = 47.4 bits (111), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 47/81 (58%), Gaps = 8/81 (9%)

Query: 10  LWYIPNQIGYMRVATA-VISFFLMAGH--PVWTTWVYGTSCLLDALDGTMARKYNQTSGF 66
           +W +PN +   R+AT  +I ++++  +  P  + +VY  SC+ D LDG +AR Y   S  
Sbjct: 82  IWTLPNVLTMSRIATTPLIGYYILTQNLAPAMSLFVY--SCVTDFLDGYLARSYKMKSVA 139

Query: 67  GAVLDMVTDR---STTSSLLC 84
           G VLD + D+    TT++ LC
Sbjct: 140 GTVLDPMADKILMMTTTAALC 160

>CAGL0I03784g complement(325276..326088) similar to sp|Q07560
           Saccharomyces cerevisiae YDL142c PGS1 cardiolipin
           synthase, hypothetical start
          Length = 270

 Score = 47.0 bits (110), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 7   KQVLWYIPNQIGYMRVAT-AVISFFLMAGHPVWTTWVYGTSCLLDALDGTMARKYNQTSG 65
           K+    IPN I   R+AT  +I +FL+    V    ++  S + D LDG +AR+YN  S 
Sbjct: 47  KKDFLTIPNVITITRIATTPMIGYFLLNNQLVPALSLFAYSSITDFLDGYIARRYNMKSD 106

Query: 66  FGAVLDMVTDR 76
            G +LD + D+
Sbjct: 107 AGTILDPMADK 117

>Scas_645.24
          Length = 239

 Score = 46.2 bits (108), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 40/65 (61%), Gaps = 1/65 (1%)

Query: 13 IPNQIGYMRVAT-AVISFFLMAGHPVWTTWVYGTSCLLDALDGTMARKYNQTSGFGAVLD 71
          IPN I   R+AT  ++ +F+++ + +    ++  SC+ D LDG +ARKY   S  G++LD
Sbjct: 24 IPNVITMSRIATTPLVGYFILSNNLIPAMGLFAYSCITDFLDGYIARKYYLKSVAGSILD 83

Query: 72 MVTDR 76
           + D+
Sbjct: 84 PIADK 88

>Sklu_2382.8 YDL142C, Contig c2382 19681-20496
          Length = 271

 Score = 44.3 bits (103), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 40/68 (58%), Gaps = 1/68 (1%)

Query: 10  LWYIPNQIGYMRVATA-VISFFLMAGHPVWTTWVYGTSCLLDALDGTMARKYNQTSGFGA 68
           ++ +PN + + R+A A +I  ++++ +      ++  SCL D LDG +ARKY   S  G 
Sbjct: 54  IYTLPNILTFSRIAAAPLIGHYILSQNLTPALCLFTYSCLTDFLDGYLARKYKMKSVLGT 113

Query: 69  VLDMVTDR 76
           +LD + D+
Sbjct: 114 ILDPMADK 121

>ADR084C [1825] [Homologous to ScYDL142C (CRD1) - SH]
           (856914..857747) [834 bp, 277 aa]
          Length = 277

 Score = 43.5 bits (101), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 38/72 (52%), Gaps = 1/72 (1%)

Query: 6   AKQVLWYIPNQIGYMRVATAV-ISFFLMAGHPVWTTWVYGTSCLLDALDGTMARKYNQTS 64
            K V+W +PN +   R+A A  I   +M    +    ++  SC+ D LDG +ARKY   +
Sbjct: 54  PKSVIWTVPNILTMSRIACAPFIGHCIMTQQLMPAFCLFAYSCVTDFLDGYLARKYKSRT 113

Query: 65  GFGAVLDMVTDR 76
             G +LD + D+
Sbjct: 114 VAGTILDPMADK 125

>Kwal_56.24503
          Length = 262

 Score = 42.4 bits (98), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 39/68 (57%), Gaps = 1/68 (1%)

Query: 10  LWYIPNQIGYMRVATA-VISFFLMAGHPVWTTWVYGTSCLLDALDGTMARKYNQTSGFGA 68
           ++ +PN +   R+A A +I   ++  + +    ++  SCL D LDG MARKY+  S  G 
Sbjct: 47  IYTLPNMLTITRIAAAPMIGHCIVNNNLIPALGLFTYSCLTDFLDGYMARKYDMKSVAGT 106

Query: 69  VLDMVTDR 76
           VLD + D+
Sbjct: 107 VLDPMADK 114

>AGR344W [4655] [Homologous to ScYNL130C (CPT1) - SH; ScYHR123W
           (EPT1) - SH]
           complement(1368344..1368393,1368447..1369569) [1173 bp,
           390 aa]
          Length = 390

 Score = 37.4 bits (85), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 38/90 (42%), Gaps = 12/90 (13%)

Query: 10  LWYIPNQI-----GYMRVATAVISFF---LMAGHPVWTTWVYGTSCLL----DALDGTMA 57
           LW  PN +     G++      + ++   L   +P WT + Y     L    DA DG  A
Sbjct: 44  LWMAPNAVTLSGFGFIVANLCTVLYYDPKLEGNNPRWTYFTYAIGLFLYQTFDACDGAHA 103

Query: 58  RKYNQTSGFGAVLDMVTDRSTTSSLLCFLC 87
           R+ +Q+S  G + D   D   TS  +   C
Sbjct: 104 RRTSQSSPLGELFDHCIDALNTSLGVIVFC 133

>YDL142C (CRD1) [726] chr4 complement(201720..202571) Cardiolipin
           synthase, synthesizes cardiolipin from
           phosphatidylglycerol and CDP-diacylglycerol [852 bp, 283
           aa]
          Length = 283

 Score = 37.0 bits (84), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 35/71 (49%), Gaps = 1/71 (1%)

Query: 7   KQVLWYIPNQIGYMRVA-TAVISFFLMAGHPVWTTWVYGTSCLLDALDGTMARKYNQTSG 65
           K  L  IPN +   R+  T  I  F++  +      ++  S + D +DG +ARKY   + 
Sbjct: 64  KSKLLNIPNILTLSRIGCTPFIGLFIITNNLTPALGLFAFSSITDFMDGYIARKYGLKTI 123

Query: 66  FGAVLDMVTDR 76
            G +LD + D+
Sbjct: 124 AGTILDPLADK 134

>Scas_31.1
          Length = 257

 Score = 36.6 bits (83), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 42/93 (45%), Gaps = 13/93 (13%)

Query: 9   VLWYIPNQI-----GYMRVATAVISFF---LMAGHPVWTTWVYGTSCLL----DALDGTM 56
           +LW  PN +     G++ +    + ++   L    P WT + Y     L    DA DGT 
Sbjct: 30  LLWMAPNVVTLTGFGFIILNVLTVLYYDPTLTEETPRWTYFSYALGLFLYQTFDACDGTH 89

Query: 57  ARKYNQTSGFGAVLDMVTDR-STTSSLLCFLCV 88
           AR+  Q+   G + D   D  +TT S+L F  V
Sbjct: 90  ARRTGQSGPLGELFDHCIDSLNTTLSMLVFCSV 122

>YHR123W (EPT1) [2411] chr8 (354817..354866,354958..356083)
           sn-1,2-Diacylglycerol ethanolaminephosphotransferase,
           catalyzes the synthesis of phosphatidylethanolamine from
           CDP-ethanolamine and diacylglycerol [1176 bp, 391 aa]
          Length = 391

 Score = 34.3 bits (77), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 37/88 (42%), Gaps = 13/88 (14%)

Query: 11  WYIPNQI---GYMRVATAVISFF-----LMAGHPVWTTWVYGTSCLL----DALDGTMAR 58
           W  PN I   G+  +   V++ F     L    P WT + Y     L    D  DG  AR
Sbjct: 45  WMAPNIITLSGFAFIVINVLTVFYYDPNLNTDTPRWTYFSYALGVFLYQTFDGCDGVHAR 104

Query: 59  KYNQTSGFGAVLDMVTDR-STTSSLLCF 85
           + NQ+   G + D   D  ++T S+  F
Sbjct: 105 RINQSGPLGELFDHSIDAINSTLSIFIF 132

>KLLA0E07590g complement(686610..687218) no similarity, hypothetical
           start
          Length = 202

 Score = 32.7 bits (73), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 19/42 (45%)

Query: 100 LLSLDLSSHYMHMYATLSSGGESHKKIEKEQWLLNLYYSRRS 141
           LL  DL  H   M   L        +I KE WLL L YSR S
Sbjct: 129 LLKRDLKDHLDRMIQYLEDNDRPSDEILKEIWLLKLRYSRTS 170

>Kwal_33.14715
          Length = 389

 Score = 32.7 bits (73), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 38/89 (42%), Gaps = 13/89 (14%)

Query: 10  LWYIPNQI-----GYMRVATAVISFF---LMAGHPVWTTWVYGTSCLL----DALDGTMA 57
           LW  PN +     G++ +    + ++        P WT + Y     L    DA DG  A
Sbjct: 43  LWMAPNLVTLSGLGFIIINVLTVLYYDPTFSEESPRWTYFSYAIGLFLYQTFDACDGQHA 102

Query: 58  RKYNQTSGFGAVLDMVTDR-STTSSLLCF 85
           R+  Q+   G + D   D  +TT S++ F
Sbjct: 103 RRTGQSGPLGELFDHCIDSLNTTLSMMVF 131

>CAGL0K09570g 942032..943225 similar to sp|P17898 Saccharomyces
           cerevisiae YNL130c CPT1 Diacylglycerol
           cholinephosphotransferase or sp|P22140 Saccharomyces
           cerevisiae YHR123w EPT1, start by similarity
          Length = 397

 Score = 32.3 bits (72), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 25/56 (44%), Gaps = 4/56 (7%)

Query: 36  PVWTTWVYGTSCLL----DALDGTMARKYNQTSGFGAVLDMVTDRSTTSSLLCFLC 87
           P WT + Y     L    DA DG  AR+  Q+S  G + D   D   T+  L  +C
Sbjct: 78  PRWTYFSYALGLFLYQTFDACDGMHARRTGQSSPLGELFDHCIDSLNTTLSLFPVC 133

>Scas_666.34*
          Length = 376

 Score = 31.6 bits (70), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 25/55 (45%), Gaps = 5/55 (9%)

Query: 36  PVWTTWVYGTSCLL----DALDGTMARKYNQTSGFGAVLDMVTDR-STTSSLLCF 85
           P WT + Y     L    DA DG  AR+  Q+   G + D   D  +TT SL  F
Sbjct: 61  PRWTYYSYSLGLFLYQTFDACDGMHARRTGQSGPLGELFDHCIDSINTTLSLFPF 115

>KLLA0F24354g join(2269337..2269386,2269496..2270621) similar to
           sp|P17898 Saccharomyces cerevisiae YNL130c CPT1
           diacylglycerol cholinephosphotransferase, start by
           similarity
          Length = 391

 Score = 31.6 bits (70), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 37/92 (40%), Gaps = 13/92 (14%)

Query: 10  LWYIPNQI-----GYMRVATAVISFF---LMAGHPVWTTWVYGTSCLL----DALDGTMA 57
           LW  PN +     G++ V    + +    L    P W  + Y     L    DA DG  A
Sbjct: 44  LWMAPNVVTLSGFGFIIVNVLTVLYLNPTLDQEQPRWAYFSYALGLFLYQTFDACDGAHA 103

Query: 58  RKYNQTSGFGAVLDMVTDR-STTSSLLCFLCV 88
           R+  Q+   G + D   D  +TT S+  F  V
Sbjct: 104 RRTGQSGPLGELFDHCIDALNTTLSMFIFCSV 135

>ABR180W [773] [Homologous to ScYLR454W - SH]
            complement(742456..750246) [7791 bp, 2596 aa]
          Length = 2596

 Score = 31.6 bits (70), Expect = 0.48,   Method: Composition-based stats.
 Identities = 18/60 (30%), Positives = 34/60 (56%), Gaps = 11/60 (18%)

Query: 59   KYNQTSGFGAVLDMVTDRSTTSSLLCFLCVQYPRFAAVFQILLSLDLSSHYMHMYATLSS 118
            KY++ S F  V D+++D  +  S++C+L    PRF      +L+ D S  Y+ +Y  +++
Sbjct: 2134 KYDRVSSFANVSDLLSDAISMDSVICYL----PRF------VLASD-SKQYIALYNIIAN 2182

>YNL130C (CPT1) [4465] chr14
           complement(379558..380689,380782..380831)
           sn-1,2-Diacylglycerol cholinephosphotransferase,
           catalyzes the synthesis of phosphatidylcholine from
           CDP-choline and diacylglycerol [1182 bp, 393 aa]
          Length = 393

 Score = 29.6 bits (65), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 23/56 (41%), Gaps = 4/56 (7%)

Query: 36  PVWTTWVYGTSCLL----DALDGTMARKYNQTSGFGAVLDMVTDRSTTSSLLCFLC 87
           P WT + Y     L    DA DG  AR+  Q    G + D   D   T+  +  +C
Sbjct: 78  PRWTYFSYAIGLFLYQTFDACDGMHARRTGQQGPLGELFDHCIDSINTTLSMIPVC 133

>AFR408C [3600] [Homologous to ScYDR472W (TRS31) - SH]
           (1169595..1170350) [756 bp, 251 aa]
          Length = 251

 Score = 27.7 bits (60), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 13/63 (20%), Positives = 27/63 (42%)

Query: 28  SFFLMAGHPVWTTWVYGTSCLLDALDGTMARKYNQTSGFGAVLDMVTDRSTTSSLLCFLC 87
            + ++   P WT +++GTS   ++  G +       +GF   + + TD   T        
Sbjct: 177 EYMIVDNEPQWTQFIHGTSIQCESFTGGIIEGVLDHAGFPCHVTVHTDPEGTYDQRTVYL 236

Query: 88  VQY 90
           +Q+
Sbjct: 237 IQF 239

>Kwal_27.12401
          Length = 236

 Score = 27.3 bits (59), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 24/102 (23%), Positives = 48/102 (47%), Gaps = 11/102 (10%)

Query: 80  SSLLCFLCVQYPRFAAVFQILLSLDLSSHYMHMYATLSSGGESHKKIEKEQWLLNLYYSR 139
           SSLL  +C +   FA    + ++   +S++ H++     G +  +K+    + +  ++ R
Sbjct: 9   SSLLLQICGKRSTFAITSTVAITQKPTSNHSHVFKAYYKGTQRSRKV---CYSMTEHFER 65

Query: 140 RSVLFTVCAFNELFY----LALYLYGFPQLAGIGGVLAVVCL 177
              L    A N +FY    ++ + + FP L+ +    A VCL
Sbjct: 66  ---LRAHSAPNRVFYCFQSVSCFYFSFP-LSNVLNCFANVCL 103

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.326    0.136    0.419 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 6,008,023
Number of extensions: 218373
Number of successful extensions: 709
Number of sequences better than 10.0: 27
Number of HSP's gapped: 699
Number of HSP's successfully gapped: 27
Length of query: 210
Length of database: 16,596,109
Length adjustment: 97
Effective length of query: 113
Effective length of database: 13,238,163
Effective search space: 1495912419
Effective search space used: 1495912419
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 59 (27.3 bits)