Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_47.1921487686442410.0
Sklu_2433.1188487325610.0
AFR251C86886021990.0
KLLA0A01023g86186420900.0
YGL233W (SEC15)91089020180.0
Scas_712.1888287220060.0
CAGL0H07909g88286419640.0
Sklu_1965.4791112780.44
Scas_655.17d271118740.75
Scas_706.281234100695.1
KLLA0E12265g700191685.5
YGL061C (DUO1)24768675.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_47.19214
         (864 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_47.19214                                                        1638   0.0  
Sklu_2433.11 YGL233W, Contig c2433 17844-20498                        991   0.0  
AFR251C [3443] [Homologous to ScYGL233W (SEC15) - SH] (888186..8...   851   0.0  
KLLA0A01023g 96383..98968 similar to sp|P22224 Saccharomyces cer...   809   0.0  
YGL233W (SEC15) [1765] chr7 (59121..61853) Component of exocyst ...   781   0.0  
Scas_712.18                                                           777   0.0  
CAGL0H07909g 772741..775389 similar to sp|P22224 Saccharomyces c...   761   0.0  
Sklu_1965.4 YDR258C, Contig c1965 3102-5477                            35   0.44 
Scas_655.17d                                                           33   0.75 
Scas_706.28                                                            31   5.1  
KLLA0E12265g complement(1084026..1086128) similar to sp|P36000 S...    31   5.5  
YGL061C (DUO1) [1918] chr7 complement(388969..389712) Protein co...    30   5.8  

>Kwal_47.19214
          Length = 876

 Score = 1638 bits (4241), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 823/864 (95%), Positives = 823/864 (95%)

Query: 1   MEGDAQSLISEELQQVLLSTDLSFLKSLQTGQDXXXXXXXXXXXXLDLDEHTFNKWTPLL 60
           MEGDAQSLISEELQQVLLSTDLSFLKSLQTGQD            LDLDEHTFNKWTPLL
Sbjct: 1   MEGDAQSLISEELQQVLLSTDLSFLKSLQTGQDEIAEVAGEYEEELDLDEHTFNKWTPLL 60

Query: 61  RSAIEDESLPLVVEELYNSIEDNFENLESQILQDSQLSDNLTASVGQIASIKEVIEGSLL 120
           RSAIEDESLPLVVEELYNSIEDNFENLESQILQDSQLSDNLTASVGQIASIKEVIEGSLL
Sbjct: 61  RSAIEDESLPLVVEELYNSIEDNFENLESQILQDSQLSDNLTASVGQIASIKEVIEGSLL 120

Query: 121 QEIEDLHIQLAETTNDVITRKQNYINNXXXXXXXXXXXXXXXXVLQILELSKKCQDLIKE 180
           QEIEDLHIQLAETTNDVITRKQNYINN                VLQILELSKKCQDLIKE
Sbjct: 121 QEIEDLHIQLAETTNDVITRKQNYINNKKISTKISETIILITKVLQILELSKKCQDLIKE 180

Query: 181 RSYFKALQSLGGLEKIYVQDFKNYNFDFLKKIYASIPILKSKIKDESINLVKSSFNSNLE 240
           RSYFKALQSLGGLEKIYVQDFKNYNFDFLKKIYASIPILKSKIKDESINLVKSSFNSNLE
Sbjct: 181 RSYFKALQSLGGLEKIYVQDFKNYNFDFLKKIYASIPILKSKIKDESINLVKSSFNSNLE 240

Query: 241 KKLLTVGQTFFDFYHDVLLSDWLNSRSELKLSNFKFNSPVEISLRDTTQLESLNVATLYP 300
           KKLLTVGQTFFDFYHDVLLSDWLNSRSELKLSNFKFNSPVEISLRDTTQLESLNVATLYP
Sbjct: 241 KKLLTVGQTFFDFYHDVLLSDWLNSRSELKLSNFKFNSPVEISLRDTTQLESLNVATLYP 300

Query: 301 LDEFYDSILIFQNLKEIDYLRTEFKKEYDFRTSKVVHPLELKVSASATPAEQKLQVTNLF 360
           LDEFYDSILIFQNLKEIDYLRTEFKKEYDFRTSKVVHPLELKVSASATPAEQKLQVTNLF
Sbjct: 301 LDEFYDSILIFQNLKEIDYLRTEFKKEYDFRTSKVVHPLELKVSASATPAEQKLQVTNLF 360

Query: 361 ADDFTQDQLKHYLLRILGFVIYDRHLNKSTEYVLSFNQFNTSESFWELFINRFSPFLEHF 420
           ADDFTQDQLKHYLLRILGFVIYDRHLNKSTEYVLSFNQFNTSESFWELFINRFSPFLEHF
Sbjct: 361 ADDFTQDQLKHYLLRILGFVIYDRHLNKSTEYVLSFNQFNTSESFWELFINRFSPFLEHF 420

Query: 421 VNSRINTEEEMIDLKDFLGVYIAILENIGVNIEQIYRINVLLFKKYARFLVQMFDSEFST 480
           VNSRINTEEEMIDLKDFLGVYIAILENIGVNIEQIYRINVLLFKKYARFLVQMFDSEFST
Sbjct: 421 VNSRINTEEEMIDLKDFLGVYIAILENIGVNIEQIYRINVLLFKKYARFLVQMFDSEFST 480

Query: 481 LLDDDDFMPLTINDHGLYEKVLKICWLREDELDKFGSIEQTPGESFFATLPFSPLYPMTC 540
           LLDDDDFMPLTINDHGLYEKVLKICWLREDELDKFGSIEQTPGESFFATLPFSPLYPMTC
Sbjct: 481 LLDDDDFMPLTINDHGLYEKVLKICWLREDELDKFGSIEQTPGESFFATLPFSPLYPMTC 540

Query: 541 TLAKKCYNKLVGFLTDFFQYDLGELNHVIVQMIDDIFGKIVNDKIAAKSDTTSREEIAQI 600
           TLAKKCYNKLVGFLTDFFQYDLGELNHVIVQMIDDIFGKIVNDKIAAKSDTTSREEIAQI
Sbjct: 541 TLAKKCYNKLVGFLTDFFQYDLGELNHVIVQMIDDIFGKIVNDKIAAKSDTTSREEIAQI 600

Query: 601 LINLDYFIVAVKEFSNILSRENIMHNPGVELGLQATKQLSKSRTLTETKLIALIDSKVSD 660
           LINLDYFIVAVKEFSNILSRENIMHNPGVELGLQATKQLSKSRTLTETKLIALIDSKVSD
Sbjct: 601 LINLDYFIVAVKEFSNILSRENIMHNPGVELGLQATKQLSKSRTLTETKLIALIDSKVSD 660

Query: 661 LMEFVEFEWASQEILREPDYSIKDIAQFLEMMFNSTLVNLPDSVKTLLIFREFDALTRRF 720
           LMEFVEFEWASQEILREPDYSIKDIAQFLEMMFNSTLVNLPDSVKTLLIFREFDALTRRF
Sbjct: 661 LMEFVEFEWASQEILREPDYSIKDIAQFLEMMFNSTLVNLPDSVKTLLIFREFDALTRRF 720

Query: 721 LDVLLNQTPSVITPQSILNFERNMDFLEAIITKLFXXXXXXXXXXXXXEIPSGQFSDNAR 780
           LDVLLNQTPSVITPQSILNFERNMDFLEAIITKLF             EIPSGQFSDNAR
Sbjct: 721 LDVLLNQTPSVITPQSILNFERNMDFLEAIITKLFPSSDSTPQTPTSPEIPSGQFSDNAR 780

Query: 781 SSNVINNTVRSLHSTFSDLKQHIQFLKSPDMEEYKDSSIRMRKYPRIKPEVAQMLYNKIV 840
           SSNVINNTVRSLHSTFSDLKQHIQFLKSPDMEEYKDSSIRMRKYPRIKPEVAQMLYNKIV
Sbjct: 781 SSNVINNTVRSLHSTFSDLKQHIQFLKSPDMEEYKDSSIRMRKYPRIKPEVAQMLYNKIV 840

Query: 841 PPRSAGTESEESSSVDQSFADSIT 864
           PPRSAGTESEESSSVDQSFADSIT
Sbjct: 841 PPRSAGTESEESSSVDQSFADSIT 864

>Sklu_2433.11 YGL233W, Contig c2433 17844-20498
          Length = 884

 Score =  991 bits (2561), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 505/873 (57%), Positives = 646/873 (73%), Gaps = 10/873 (1%)

Query: 1   MEGDAQSLISEELQQVLLSTDLSFLKSLQTGQDXXXXXXXXXXXXLD----LDEHTFNKW 56
           M+ + QSL+S+ELQ+VLLS+D S L S  T Q+             D    LDE +F++W
Sbjct: 1   MDQEPQSLVSQELQKVLLSSDFSTLASPITAQNNNKQSNTSASLLQDDIIELDEQSFDRW 60

Query: 57  TPLLRSAIEDESLPLVVEELYNSIEDNFENLESQILQDSQLSDNLTASVGQIASIKEVIE 116
            PLLR++IED SL  +VEEL+NS++DNF++LE++ILQDSQ++DNLT S+ +I SI+++I 
Sbjct: 61  VPLLRTSIEDSSLTKLVEELFNSVDDNFQSLETRILQDSQINDNLTTSINEIESIQKLIN 120

Query: 117 GSLLQEIEDLHIQLAETTNDVITRKQNYINNXXXXXXXXXXXXXXXXVLQILELSKKCQD 176
           GSL QE+ DL  QL+++TNDVI +KQ  INN                +LQILELS +CQD
Sbjct: 121 GSLQQEVSDLQQQLSQSTNDVILKKQILINNRKTSMKISESMILINKILQILELSNRCQD 180

Query: 177 LIKERSYFKALQSLGGLEKIYVQDFKNYNFDFLKKIYASIPILKSKIKDESINLVKSSFN 236
           LIKE  +FKALQSL  LEKIY+QDFKNYNFDFLK+IY SIP LKS IKDESINL+K SF 
Sbjct: 181 LIKEGDFFKALQSLDNLEKIYLQDFKNYNFDFLKEIYNSIPFLKSIIKDESINLIKKSFT 240

Query: 237 SNLEKKLLTVGQTFFDFYHDVLLSDWLNSRSELKLSNFKFNSPVEISLRDTTQLESLNVA 296
           SNLEK L TVG  +F+ Y +VLL DWL  +  +KL NFKFNS VE++LRD   LE L   
Sbjct: 241 SNLEKTLFTVGSKYFEVYQEVLLKDWLELKHSMKLGNFKFNSSVELALRDQKGLELLKAE 300

Query: 297 TLYPLDEFYDSILIFQNLKEIDYLRTEFKKEYDFRTSKVVHPLELK--VSASATPAEQKL 354
             Y LDEF+DSILIFQNLKE+DYL  EF KEYDFR +K+V+PLELK   ++S+   + + 
Sbjct: 301 NFYHLDEFHDSILIFQNLKELDYLCEEFIKEYDFRKAKLVYPLELKNTTTSSSLNGQNQS 360

Query: 355 QVTNLFADDFTQDQLKHYLLRILGFVIYDRHLNKSTEYVLSFNQFNTSESFWELFINRFS 414
            + ++F ++     LK YLL+ILGF+IYD+HLNKST+YVLSFN +NT+  FW++ + + +
Sbjct: 361 HLDDVFGENLNMSFLKEYLLKILGFLIYDKHLNKSTDYVLSFNSYNTTNEFWDILMKKLA 420

Query: 415 PFLEHFVNSRINTEEEMIDLKDFLGVYIAILENIGVNIEQIYRINVLLFKKYARFLVQMF 474
           P L+ FV   + TEEE++  KDFLG++IAILEN+ +NIE +YRI++ +F+KY   LV  F
Sbjct: 421 PHLQQFVTRNLTTEEELVQFKDFLGIFIAILENLKLNIETLYRIHITVFEKYCNLLVHKF 480

Query: 475 DSEFSTLLDDDDFMPLTINDHGLYEKVLKICWLREDELDKFGSIEQTPGESFFATLPFSP 534
             EFSTLL+DDDFMPLT ND  LYEKVLKICWL+E+E +K    +      F ATLPFSP
Sbjct: 481 SEEFSTLLNDDDFMPLTTNDRNLYEKVLKICWLKEEEPEKMKEQQDPANGDFLATLPFSP 540

Query: 535 LYPMTCTLAKKCYNKLVGFLTDFFQYDLGELNHVIVQMIDDIFGKIVNDKIAAKSDTTSR 594
           LYPM CTLAKK Y K+V FL +F+Q++L  LN ++V+ +D IF K+VN+KI +K DTTSR
Sbjct: 541 LYPMACTLAKKTYGKIVTFLNNFYQHELYHLNTILVKTMDSIFQKVVNNKIRSKLDTTSR 600

Query: 595 EEIAQILINLDYFIVAVKEFSNILSRENIMHNPGVELGLQATKQLSKSRTLTETKLIALI 654
           EEIAQ+LINLDYF++A +EFS+IL+RENI+ NP VE+ L + +QL++SR   ETKLI LI
Sbjct: 601 EEIAQVLINLDYFVIAAREFSSILTRENIIQNPDVEIRLASAEQLTESRKYAETKLIELI 660

Query: 655 DSKVSDLMEFVEFEWASQEILREPDYSIKDIAQFLEMMFNSTLVNLPDSVKTLLIFREFD 714
           DSKVSDLMEFVE +W +  I +EPD SI+DIAQFLEMMF STLVNLP SVKTLLIFREFD
Sbjct: 661 DSKVSDLMEFVELDWVATTIKQEPDISIRDIAQFLEMMFTSTLVNLPYSVKTLLIFREFD 720

Query: 715 ALTRRFLDVLLNQTPSVITPQSILNFERNMDFLEAIITKLFXXXXXXXXXXXXXEIPSGQ 774
           +LTRRFL++LLN TPS ITPQS+LNFE +M FLE I++K+F                S  
Sbjct: 721 SLTRRFLEMLLNGTPSTITPQSVLNFEMDMKFLEGIVSKIFPSETKELPFESSPSPDSPL 780

Query: 775 FSDNARSSNVINNTVRSLHSTFSDLKQHIQFLKSPDMEEYKDSSIRMRKYPRIKPEVAQM 834
            SD AR+SN+I N VRSL STF+DLKQHIQ +K+ ++EEYKD SIRMRKYPRI+PEVAQ+
Sbjct: 781 QSDQARASNLIENNVRSLQSTFTDLKQHIQLMKASNLEEYKDPSIRMRKYPRIRPEVAQL 840

Query: 835 LYNKIV---PPRSAGTESEESSSVDQSFADSIT 864
           L +K+    P  SAG + + +S   QS  +S+T
Sbjct: 841 LVSKVAIPSPSPSAG-DGDNTSYRGQSPTESLT 872

>AFR251C [3443] [Homologous to ScYGL233W (SEC15) - SH]
           (888186..890792) [2607 bp, 868 aa]
          Length = 868

 Score =  851 bits (2199), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/860 (50%), Positives = 598/860 (69%), Gaps = 13/860 (1%)

Query: 1   MEGDAQSLISEELQQVLLSTDLSFLKSLQTGQDXXXXXXXXXXXXLDLDEHTFNKWTPLL 60
           +E +  + +S+ELQ+VLL+ + +        +D            + L + TF KW P L
Sbjct: 5   LEQEPHTQLSQELQKVLLTAEFA------ATRDDDYTPGETGDGLMCLSDQTFEKWVPYL 58

Query: 61  RSAIEDESLPLVVEELYNSIEDNFENLESQILQDSQLSDNLTASVGQIASIKEVIEGSLL 120
           R A+E + L  VVEE+Y+S+E+NF+N E+QILQDSQ+SDNL+ S+ +   I+ + E  L 
Sbjct: 59  RQAVESDRLDGVVEEVYSSVEENFQNFETQILQDSQVSDNLSFSIDENDRIQNLAESYLQ 118

Query: 121 QEIEDLHIQLAETTNDVITRKQNYINNXXXXXXXXXXXXXXXXVLQILELSKKCQDLIKE 180
            ++ DL   L+ +TN+V+++K+   +N                + Q+LEL+ KCQ+LI++
Sbjct: 119 GQVADLQAHLSASTNEVVSKKRALTSNRRTSIKISESIILIEKIFQMLELTNKCQELIRD 178

Query: 181 RSYFKALQSLGGLEKIYVQDFKNYNFDFLKKIYASIPILKSKIKDESINLVKSSFNSNLE 240
            +++KALQ+L  LE+IY+ DFKNY F+FL  IY SIP LK+ IKDESINL+K S +SNLE
Sbjct: 179 GNFYKALQNLDKLERIYIHDFKNYKFEFLAVIYNSIPKLKNIIKDESINLIKKSLSSNLE 238

Query: 241 KKLLTVGQTFFDFYHDVLLSDWLNSRSELKLSNFKFNSPVEISLRDTTQLESLNVATLYP 300
           K L  VGQT+F  Y+D LL  WL  +  +KLSN+KFNSPVE+SLRD + L  L +   Y 
Sbjct: 239 KTLSQVGQTYFQVYNDQLLPHWLAMKKAMKLSNYKFNSPVEVSLRDDSFLAGLKLEDYYN 298

Query: 301 LDEFYDSILIFQNLKEIDYLRTEFKKEYDFRTSKVVHPLELKVSASATPAEQKLQVTNLF 360
           LDEFYDSI+IF++LKE +YL  EF KEYDFR  K+V+PL+ K + + T +  + QV + F
Sbjct: 299 LDEFYDSIMIFESLKETNYLCDEFTKEYDFRKVKLVYPLDWKSTTTMTHSANE-QVDS-F 356

Query: 361 ADDFTQDQLKHYLLRILGFVIYDRHLNKSTEYVLSFNQFNTSESFWELFINRFSPFLEHF 420
               +   LK YLL+ILGF++YD+ L+KST+Y+ ++N + T+E FWE F+ + SP L  F
Sbjct: 357 YQQLSLPFLKEYLLKILGFLLYDKFLHKSTDYIFAYNTYTTTEEFWEQFMTKVSPHLSRF 416

Query: 421 VNSRINTEEEMIDLKDFLGVYIAILENIGVNIEQIYRINVLLFKKYARFLVQMFDSEFST 480
           +  ++ TE+++I+ K+FLG+ IAILEN+ +N E +Y+I V +F+KY   L+ +FD EF+ 
Sbjct: 417 IKEKLTTEDQLIEFKNFLGILIAILENMKLNSESMYKIQVQVFEKYCGLLIHVFDKEFTN 476

Query: 481 LLDDDDFMPLTINDHGLYEKVLKICWLREDELDKFGSIEQTPGESFFATLPFSPLYPMTC 540
           LL+DDDFMPL I+D   YEKV+K+CW++ D +     + Q     F  TLPFSPLYPMTC
Sbjct: 477 LLNDDDFMPLPISDRNFYEKVMKLCWMKPDSV---PIVTQDDANGFSVTLPFSPLYPMTC 533

Query: 541 TLAKKCYNKLVGFLTDFFQYDLGELNHVIVQMIDDIFGKIVNDKIAAKSDTTSREEIAQI 600
            L KK Y  ++ FL  FFQ+DL  LN V+V+ +DDIF K+VN+KI +K DTTSREEIAQI
Sbjct: 534 ALIKKSYANMLLFLNTFFQHDLSYLNIVLVRTVDDIFIKVVNNKIRSKLDTTSREEIAQI 593

Query: 601 LINLDYFIVAVKEFSNILSRENIMHNPGVELGLQATKQLSKSRTLTETKLIALIDSKVSD 660
           LINLDYFIVA KEFS+I+++ENI  NP +E+ L +TKQL+ ++   ETKLI LIDSKV+D
Sbjct: 594 LINLDYFIVAAKEFSDIMTKENITQNPDIEIKLSSTKQLADTKKYAETKLIELIDSKVTD 653

Query: 661 LMEFVEFEWASQEILREPDYSIKDIAQFLEMMFNSTLVNLPDSVKTLLIFREFDALTRRF 720
           LMEFVE +W ++E+  EP  SI+DIAQFLEMMF STL NLP S+K+LLIFREFD LTR+F
Sbjct: 654 LMEFVELDWTTEEVRDEPGLSIRDIAQFLEMMFTSTLANLPYSIKSLLIFREFDQLTRKF 713

Query: 721 LDVLLNQTPSVITPQSILNFERNMDFLEAIITKLFXXXXXXXXXXXXXEIPSGQFSD--N 778
           L++L++++PS IT QS+ NFE +M FLE +I+ +F               P+   +D  N
Sbjct: 714 LELLVHESPSYITTQSVANFETDMKFLENVISNIFPNESTEQNVEISPSTPTTPVADSFN 773

Query: 779 ARSSNVINNTVRSLHSTFSDLKQHIQFLKSPDMEEYKDSSIRMRKYPRIKPEVAQMLYNK 838
            +S N+I + VRSL STF+DL QHI  +KS + +EYKDSSIRMRKYPRIKPEVA +L NK
Sbjct: 774 VKSPNMIESNVRSLFSTFTDLNQHILLMKSNNFDEYKDSSIRMRKYPRIKPEVAHLLMNK 833

Query: 839 IVPPRSAGTESEESSSVDQS 858
           +  P +A T+ + ++  D S
Sbjct: 834 LSRPTTATTDGDNTTVSDYS 853

>KLLA0A01023g 96383..98968 similar to sp|P22224 Saccharomyces
           cerevisiae YGL233w SEC15 vesicular traffic control
           protein singleton, start by similarity
          Length = 861

 Score =  809 bits (2090), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/864 (48%), Positives = 590/864 (68%), Gaps = 25/864 (2%)

Query: 1   MEGDAQSLISEELQQVLLSTDLSFLKSLQTGQDXXXXXXXXXXXXLDLDEHTFNKWTPLL 60
           M+ D Q  +S++LQ+ LL+ +    KS  + QD             +LD   F++W PLL
Sbjct: 1   MDQDPQLAVSQDLQRALLTAEF-VSKSGSSNQDQGEDEL------FELDPQIFDRWVPLL 53

Query: 61  RSAIEDESLPLVVEELYNSIEDNFENLESQILQDSQLSDNLTASVGQIASIKEVIEGSLL 120
           R  I++  L  V+++LY SI+D+FENLE+QILQDSQ+++NL  S+ +I  ++++I+GSL 
Sbjct: 54  RQTIDEGQLNTVIDDLYASIDDHFENLETQILQDSQINNNLVTSINEIQKVQQIIDGSLQ 113

Query: 121 QEIEDLHIQLAETTNDVITRKQNYINNXXXXXXXXXXXXXXXXVLQILELSKKCQDLIKE 180
            +I++L  Q+  +T ++++RKQ  I+N                VLQILEL  +C++LI+E
Sbjct: 114 NDIKNLQSQVRHSTLNLVSRKQILIDNTKTSSKITESSILIQKVLQILELFNRCRELIEE 173

Query: 181 RSYFKALQSLGGLEKIYVQDFKNYNFDFLKKIYASIPILKSKIKDESINLVKSSFNSNLE 240
           + +FKALQ++   E IY+QDFK YNF+FL +IY SIP+LKS+IKDESINL+K S N NLE
Sbjct: 174 KDFFKALQTIETFETIYLQDFKQYNFEFLNQIYTSIPMLKSQIKDESINLIKKSLNYNLE 233

Query: 241 KKLLTVGQTFFDFYHDVLLSDWLNSRSELKLSNFKFNSPVEISLRDTTQLESLNVATLYP 300
           K    +G+ ++D Y   +L DWL ++  +KL N+KFNSPVEISLRDT++L+SL +     
Sbjct: 234 KTFSVIGEKYYDVYETQILQDWLKTKQSMKLHNYKFNSPVEISLRDTSKLDSLQLQNFCQ 293

Query: 301 LDEFYDSILIFQNLKEIDYLRTEFKKEYDFRTSKVVHPLELKVSASATPAEQKLQVTNLF 360
           L EF+DSILIFQ+L E+D+   EF+KEY+FR SK++HPL LK  ++ + +  K+   + F
Sbjct: 294 LHEFHDSILIFQSLNEMDFFIDEFRKEYEFRKSKLIHPLFLKDFSTVSHSNGKI---DAF 350

Query: 361 ADDFTQDQLKHYLLRILGFVIYDRHLNKSTEYVLSFNQF-NTSESFWELFINRFSPFLEH 419
           A+       K Y+L+ILGF++YD+ L+KST+YVLS N   N+++ FW   +N+  P+L  
Sbjct: 351 AEKLDLSFFKEYILKILGFLVYDKELHKSTDYVLSNNNNPNSTDIFWTSIMNKLYPYLIT 410

Query: 420 FVNSRINTEEEMIDLKDFLGVYIAILENIGVNIEQIYRINVLLFKKYARFLVQMFDSEFS 479
            V  ++ TE+ + + KDFLGV IAILEN+ +N+E +Y++ V  F +Y   LV +F  EF+
Sbjct: 411 MVKEKLTTEQLLTEFKDFLGVLIAILENLKLNVELLYKVQVETFSQYCELLVFLFQKEFT 470

Query: 480 TLLDDDDFMPLTINDHGLYEKVLKICWLREDELDKFGSIEQTPGESFFATLPFSPLYPMT 539
            LL DDDFMPL I D  LYEK+LKICWL     D+      T  ++F AT PFSPLYPMT
Sbjct: 471 NLLQDDDFMPLAITDKALYEKILKICWLA----DQGSDTSNTTNDNFSATFPFSPLYPMT 526

Query: 540 CTLAKKCYNKLVGFLTDFFQYDLGELNHVIVQMIDDIFGKIVNDKIAAKSDTTSREEIAQ 599
           CTL KK Y+ L  F++ F+++D+  LN ++++ ID+IF ++VND I +K DTTSREEIAQ
Sbjct: 527 CTLVKKTYSSLHSFISIFYKHDISHLNLIVIKAIDNIFDRVVNDNIKSKLDTTSREEIAQ 586

Query: 600 ILINLDYFIVAVKEFSNILSRENIMHNPGVELGLQATKQLSKSRTLTETKLIALIDSKVS 659
           IL+NLDYF++A KEFS IL+REN+ +NP VE+ L + K+L ++R   ETKLI LIDSKV 
Sbjct: 587 ILVNLDYFVIAAKEFSLILTRENLTNNPDVEIRLSSIKKLIETRKEAETKLITLIDSKVI 646

Query: 660 DLMEFVEFEWASQEILREPDYSIKDIAQFLEMMFNSTLVNLPDSVKTLLIFREFDALTRR 719
           DLMEF+EF+W S E+  EPD +I DIAQFLEMMF STL  +P ++K LLIFREFD +TRR
Sbjct: 647 DLMEFIEFDWNSTEVRTEPDMTIVDIAQFLEMMFTSTLAIIPYNIKMLLIFREFDVITRR 706

Query: 720 FLDVLLNQTPSVITPQSILNFERNMDFLEAIITKLF-----XXXXXXXXXXXXXEIPSGQ 774
           FL+ LLN+TP  I+PQS+ NFE +M +LE  ITK+F                  ++PS  
Sbjct: 707 FLEKLLNETPDRISPQSVQNFETDMLYLEKTITKIFPNDVSSVPTSPSIPATPTDVPS-- 764

Query: 775 FSDNARSSNVINNTVRSLHSTFSDLKQHIQFLKSPDMEEYKDSSIRMRKYPRIKPEVAQM 834
            +   RSS  + N ++SL STF+DLKQHI  +K    +EYKD+ IR++KY R+KPEVAQ 
Sbjct: 765 -TAGNRSSTQVENNIKSLLSTFTDLKQHIGLMKINHWDEYKDNDIRLKKYSRVKPEVAQS 823

Query: 835 LYNKIVPPRSAGTE--SEESSSVD 856
           L +K+ PP S  +   S+E SS +
Sbjct: 824 LLSKLQPPSSEQSNLVSDEGSSAE 847

>YGL233W (SEC15) [1765] chr7 (59121..61853) Component of exocyst
           complex required for exocytosis [2733 bp, 910 aa]
          Length = 910

 Score =  781 bits (2018), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/890 (46%), Positives = 592/890 (66%), Gaps = 37/890 (4%)

Query: 1   MEGDAQSLISEELQQVLLSTDLSFLKSL--------QTGQDXXXXXXXXXXXXLDLDEHT 52
           M+ + Q L+S++ QQVLL+T      S         ++                DLD  +
Sbjct: 1   MDQEGQPLLSKDFQQVLLATASGNNSSWTERAVLNNESTDAVKHEPALGQNDVFDLDPLS 60

Query: 53  FNKWTPLLRSAIEDESLPLVVEELYNSIEDNFENLESQILQDSQLSDNLTASVGQIASIK 112
           F+KW P LR A++   L  V++EL NSIEDNF+ LE Q+LQDSQ++D L  S+ +IA+I+
Sbjct: 61  FDKWVPFLRRALDKNQLDPVIDELENSIEDNFQGLELQLLQDSQMNDKLETSIDEIANIQ 120

Query: 113 EVIEGSLLQEIEDLHIQLAETTNDVITRKQNYINNXXXXXXXXXXXXXXXXVLQILELSK 172
            +++ +L  EI    I+L+E+ N++I +KQ Y+NN                V++ILELS 
Sbjct: 121 GMVQDTLSSEISKFQIRLSESANELIVKKQMYVNNKKISLKISEATILITKVVRILELSS 180

Query: 173 KCQDLIKERSYFKALQSLGGLEKIYVQDFKNYNFDFLKKIYASIPILKSKIKDESINLVK 232
           KCQ+LI ER +FK LQ+L  LEK+Y+Q+FKNYNF FL +IY SIP L+   KDE INL++
Sbjct: 181 KCQELITERKFFKVLQNLDSLEKLYLQEFKNYNFQFLIEIYNSIPFLQKVTKDECINLIR 240

Query: 233 SSFNSNLEKKLLTVGQTFFDFYHDVLLSDWLNSRSELKLSNFKFNSPVEISLRDTTQLES 292
           +S N NL K L+ VGQ F   Y + LL  WL +RS++KL+NFKFNSP+EIS+RD + L  
Sbjct: 241 NSLNLNLGKNLIKVGQEFVAIYENELLPQWLETRSKMKLTNFKFNSPIEISMRDESFLAK 300

Query: 293 LNVATLYPLDEFYDSILIFQNLKEIDYLRTEFKKEYDFRTSKVVHPLELKVSASA----- 347
           LN+   + LD+F+DSI+IFQNL E+  L  EF KEY+ R +K+++PL  K + +A     
Sbjct: 301 LNLGEFFQLDDFHDSIMIFQNLNELSVLSGEFNKEYELRKTKLMYPLIWKKNKTAAYQMD 360

Query: 348 --------TPAEQKLQVTNLFADDFTQDQ----LKHYLLRILGFVIYDRHLNKSTEYVLS 395
                   TP      V+    D FTQ      L+ Y L+ILGF++YD +LNK+TE++L 
Sbjct: 361 SLLRGTGTTPGSTAHDVST--DDPFTQSLSLHFLQDYFLKILGFLLYDINLNKATEFILV 418

Query: 396 FNQFNTSESFWELFINRFSPFLEHFVNSRINTEEEMIDLKDFLGVYIAILENIGVNIEQI 455
            N +N++  FW+  ++R SP+L +F++ ++ TEE+MI LKDFL +Y+AILEN  +NIE +
Sbjct: 419 DNNYNSTNEFWDGLMDRLSPYLSYFIDEKLKTEEDMIKLKDFLCIYVAILENFKLNIEPL 478

Query: 456 YRINVLLFKKYARFLVQMFDSEFSTLLDDDDFMPLTINDHGLYEKVLKICWLREDELDKF 515
           Y+I V +F+K+    ++ FD EF  LL+DDDFMPL+IND  LYEKVLKICW++E E    
Sbjct: 479 YKILVSIFEKFCSVSLRAFDDEFQILLNDDDFMPLSINDKTLYEKVLKICWMKEGE--HL 536

Query: 516 GSIEQTPGESFFATLPFSPLYPMTCTLAKKCYNKLVGFLTDFFQYDLGELNHVIVQMIDD 575
              + T GE F  TLPFSPLYPMTCTLAKK Y+K+  FL+ F++++L  LN+++V+ +DD
Sbjct: 537 SLPDPTNGEPFAVTLPFSPLYPMTCTLAKKTYSKITAFLSIFYRHELHTLNNILVKTMDD 596

Query: 576 IFGKIVNDKIAAKSDTTSREEIAQILINLDYFIVAVKEFSNILSRENIMHNPGVELGLQA 635
           IF  IVN KI +K ++TSREEIAQIL+NLDYFI+A KEFSN ++RENI+ NP +E+ L +
Sbjct: 597 IFNDIVNKKIRSKLESTSREEIAQILVNLDYFIIAAKEFSNFMTRENILQNPDMEIRLSS 656

Query: 636 TKQLSKSRTLTETKLIALIDSKVSDLMEFVEFEWASQEILREPDYSIKDIAQFLEMMFNS 695
            K L++SR L ETKLI LIDSK+SD++E +E +W   E+ ++PD SI D+AQFLEMMF S
Sbjct: 657 IKYLAESRKLAETKLIELIDSKISDILETIEIDWQITEVRQDPDISIIDLAQFLEMMFAS 716

Query: 696 TLVNLPDSVKTLLIFREFDALTRRFLDVLLNQTPSVITPQSILNFERNMDFLEAIITKLF 755
           TL NLP SV+TLLIFREFD+LTR+F+ +LL+ TPS IT +SI+NFE ++++LE+II ++F
Sbjct: 717 TLQNLPYSVQTLLIFREFDSLTRQFMGLLLHDTPSTITHESIMNFEVDVNYLESIIPRIF 776

Query: 756 XXX-----XXXXXXXXXXEIPSGQFSDNARSSNVINNTVRSLHSTFSDLKQHIQFLKSPD 810
                               P+   ++   +  +  N ++SL +TF +LKQ I+ LK+  
Sbjct: 777 PSTPGTIDSNGYQSPMTPSTPTFPNANGVDAPTLFENNIKSLEATFMELKQCIELLKTQG 836

Query: 811 MEEYKDSSIRMRKYPRIKPEVAQMLYNKIVPPRSA--GTESEESSSVDQS 858
            ++Y +  IR+RKY RI+ E A +L +KI    S+  G   +++S +D S
Sbjct: 837 -KDYNEPEIRLRKYSRIRQEDAALLLSKIQHFVSSVEGANGDDTSVMDSS 885

>Scas_712.18
          Length = 882

 Score =  777 bits (2006), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/872 (47%), Positives = 579/872 (66%), Gaps = 30/872 (3%)

Query: 4   DAQSLISEELQQVLLSTDLSFLKSLQTGQDXXXXXXXXXXXXLD-----LDEHTFNKWTP 58
           D + L+S++ Q++LLS +    ++  T  D            ++     LD  +F+KW P
Sbjct: 2   DQEVLLSQDFQKILLSYEPKKAET-TTSHDKEENASEYKDLGMEEDAFELDPQSFDKWVP 60

Query: 59  LLRSAIEDESLPLVVEELYNSIEDNFENLESQILQDSQLSDNLTASVGQIASIKEVIEGS 118
            LRSA+E   L  +++EL  SI+DNF+ LE Q+LQDSQ++D L  S+ +I++I+ +I+ S
Sbjct: 61  FLRSAVEKNQLGTIIQELDTSIDDNFQGLELQLLQDSQINDKLETSINEISNIQNMIDTS 120

Query: 119 LLQEIEDLHIQLAETTNDVITRKQNYINNXXXXXXXXXXXXXXXXVLQILELSKKCQDLI 178
           L   I +L  QL +TTN++I +KQ ++NN                V++ILELS KCQ+LI
Sbjct: 121 LSGGILNLQEQLTQTTNELIIKKQVFVNNKKTSLKISELTILLTKVVRILELSSKCQELI 180

Query: 179 KERSYFKALQSLGGLEKIYVQDFKNYNFDFLKKIYASIPILKSKIKDESINLVKSSFNSN 238
            E ++FKALQ+L  LEKIY+Q+F+NYNF FLK+IY SIP LKS  KDE +NL+++S NSN
Sbjct: 181 TEGNFFKALQNLDSLEKIYLQEFRNYNFKFLKEIYDSIPYLKSVTKDECLNLIRNSLNSN 240

Query: 239 LEKKLLTVGQTFFDFYHDVLLSDWLNSRSELKLSNFKFNSPVEISLRDTTQLESLNVATL 298
           L K L  VG +FFD Y + LL  WL  +  +KL  FKFNSPVEIS+RD   L+ LN+   
Sbjct: 241 LGKNLTDVGMSFFDTYQNELLPKWLEIKKSMKLEKFKFNSPVEISMRDQASLKKLNLEKF 300

Query: 299 YPLDEFYDSILIFQNLKEIDYLRTEFKKEYDFRTSKVVHPLELKVSASATPAEQKLQVTN 358
           + ++EFYDSI+IFQ L ++DYL +EF KEY+FR +K+++PL  K    A+ +   +   +
Sbjct: 301 FHIEEFYDSIMIFQTLNKLDYLFSEFSKEYEFRKTKLIYPLLWK---RASNSNANIPPGD 357

Query: 359 LFADDFTQDQ----LKHYLLRILGFVIYDRHLNKSTEYVLSFNQFNTSESFWELFINRFS 414
           + +D FT+      LK Y  +ILGF++YD +LNKST++VL  N +N +  FW+  +NR  
Sbjct: 358 ISSDAFTKQMNLKFLKEYFWKILGFLLYDINLNKSTDFVLVDNNYNATNEFWDGLMNRLQ 417

Query: 415 PFLEHFVNSRINTEEEMIDLKDFLGVYIAILENIGVNIEQIYRINVLLFKKYARFLVQMF 474
           P+L HF+ + +N ++  ++ KDF+ +Y+AILEN  ++I+ +Y I +LLF +Y    ++ F
Sbjct: 418 PYLRHFIVTGLNDDDSFVEFKDFMCIYVAILENYKLSIDPLYEILILLFDRYCDISIRYF 477

Query: 475 DSEFSTLLDDDDFMPLTINDHGLYEKVLKICWLREDELDKFGSIEQTPGESFFATLPFSP 534
           D+EF  LL+DDDFMPLTIND  L++KV +ICW++EDE       E   G  F  TLPFSP
Sbjct: 478 DTEFEVLLNDDDFMPLTINDKTLFQKVSQICWMKEDE--HLEPQEDMSG--FSITLPFSP 533

Query: 535 LYPMTCTLAKKCYNKLVGFLTDFFQYDLGELNHVIVQMIDDIFGKIVNDKIAAKSDTTSR 594
           LYPMTCTL KK Y+KL  F+T F+++DL  LN ++V  ID IF  IVN KI AK  +TSR
Sbjct: 534 LYPMTCTLLKKAYSKLTSFITMFYRHDLPALNRLLVNAIDKIFIDIVNKKIRAKLQSTSR 593

Query: 595 EEIAQILINLDYFIVAVKEFSNILSRENIMHNPGVELGLQATKQLSKSRTLTETKLIALI 654
           EEIAQILINLDYFIVA K FS I++  NIM NP +E+ L++TK L  SR   E KLI LI
Sbjct: 594 EEIAQILINLDYFIVATKAFSKIMTEGNIMQNPDIEIQLKSTKDLKDSRKYAEGKLIKLI 653

Query: 655 DSKVSDLMEFVEFEWASQEILREPDYSIKDIAQFLEMMFNSTLVNLPDSVKTLLIFREFD 714
           DSKV+D++E V+ +W S+EI+++PD SI D+AQFLEMMF +TL+NLP S++ LLIFREFD
Sbjct: 654 DSKVADILETVDLDWNSKEIIQDPDISIVDVAQFLEMMFATTLINLPYSIQILLIFREFD 713

Query: 715 ALTRRFLDVLLNQTPSVITPQSILNFERNMDFLEAIITKLFXXXXXXXXXXXXXEI---- 770
           +LTRRFLD+LLN TP  IT +S+LNFE N+ +LE II ++F              +    
Sbjct: 714 SLTRRFLDILLNDTPDHITHESVLNFEVNIKYLEGIIPRIFPSRDEEETNITSERMMTPL 773

Query: 771 -PSGQFSDNARSSNVINNTVRSLHSTFSDLKQHIQFLKSPDMEEYKDSSIRMRKYPRIKP 829
            P    ++N  S  +I N V+SL  TF +L+Q+I+ LK+ +  EY D  +RMRKY R+KP
Sbjct: 774 SPVFNGTNNGHSPELIENNVKSLEETFIELRQYIELLKTGN--EYMDPDLRMRKYSRVKP 831

Query: 830 EVAQMLYNKI------VPPRSAGTESEESSSV 855
           E A +L  K+       P  +   + ++SSS+
Sbjct: 832 EHANILMRKVRVTPIMSPSDTPQQQDDDSSSI 863

>CAGL0H07909g 772741..775389 similar to sp|P22224 Saccharomyces
           cerevisiae YGL233w SEC15, start by similarity
          Length = 882

 Score =  761 bits (1964), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/864 (45%), Positives = 568/864 (65%), Gaps = 15/864 (1%)

Query: 1   MEGDAQSLISEELQQVLLSTDLSFLKSLQTGQDXXXXXXXXXX-----XXLDLDEHTFNK 55
           M+ + + +IS++ Q VLL T    + S+   ++                 LD+D+   +K
Sbjct: 1   MDQETKKVISKDFQDVLLDTSTVVVSSVFDQENKIVGGENAKGVDIIDSTLDIDQRAIDK 60

Query: 56  WTPLLRSAIEDESLPLVVEELYNSIEDNFENLESQILQDSQLSDNLTASVGQIASIKEVI 115
           W P LR   E++ L  V+ EL NSI+DNF+ LE Q+LQDSQL+D L  S+ +IA I+ ++
Sbjct: 61  WIPYLREYTENDQLNTVITELENSIDDNFQGLELQLLQDSQLNDKLETSMDEIAEIQSMV 120

Query: 116 EGSLLQEIEDLHIQLAETTNDVITRKQNYINNXXXXXXXXXXXXXXXXVLQILELSKKCQ 175
           E SL ++I++    L  +TN++I +KQ Y+N+                VL++LELS KCQ
Sbjct: 121 ELSLSRDIDEFQKNLTSSTNELIRQKQTYLNSKKTSLKISEAIILINKVLRLLELSNKCQ 180

Query: 176 DLIKERSYFKALQSLGGLEKIYVQDFKNYNFDFLKKIYASIPILKSKIKDESINLVKSSF 235
           +LI E ++FKALQ+L  LEK+Y+Q+F++YNF  LK+IY SIP LKS  KDE INL+K+S 
Sbjct: 181 ELITEGNFFKALQNLDSLEKLYLQEFRDYNFKLLKEIYVSIPYLKSVTKDECINLIKNSL 240

Query: 236 NSNLEKKLLTVGQTFFDFYHDVLLSDWLNSRSELKLSNFKFNSPVEISLRDTTQLESLNV 295
           NSNL K L  VGQTF+  Y D LLS WLN+R  +KL   KFNSP+EIS+RD   L  L +
Sbjct: 241 NSNLGKNLNVVGQTFYLIYKDELLSKWLNTREIMKLKRVKFNSPIEISMRDEENLRKLEL 300

Query: 296 ATLYPLDEFYDSILIFQNLKEIDYLRTEFKKEYDFRTSKVVHPLELKVSASATPAEQKLQ 355
              + LD F+DS++IF+ L E DYL  EF KEY+F+ SK + PL  K S +         
Sbjct: 301 EQFFNLDAFHDSLMIFETLNETDYLVEEFNKEYEFKKSKTIQPLPWKTSGNTVSVNSTAH 360

Query: 356 VTNLFADDFTQDQLKHYLLRILGFVIYDRHLNKSTEYVLSFNQFNTSESFWELFINRFSP 415
             + F +  +   LK YLL ILGF++YD +LN+ T+Y+   N +N +  FWE+ + R  P
Sbjct: 361 --DEFKESLSVPFLKEYLLNILGFLLYDINLNRLTDYIFVNNNYNATNEFWEMLMMRLKP 418

Query: 416 FLEHFVNSRINTEEEMIDLKDFLGVYIAILENIGVNIEQIYRINVLLFKKYARFLVQMFD 475
           + ++F+++ + TE+++I+ KDFLG+Y+ I+EN  +NI+ +Y + + LF+KY +  +++FD
Sbjct: 419 YFKYFMDTVLKTEKDIIEFKDFLGIYVCIMENYKLNIDPLYSVMLALFEKYCKTTLELFD 478

Query: 476 SEFSTLLDDDDFMPLTINDHGLYEKVLKICWLREDELDKFGSIEQTPGESFFATLPFSPL 535
            +F  +L DDDFMPLTI++ G YEKV+KICW++E+       I+    E+F  TLPFSPL
Sbjct: 479 KDFQVMLSDDDFMPLTIDNKGFYEKVIKICWMKENH----QIIDDMDDENFSVTLPFSPL 534

Query: 536 YPMTCTLAKKCYNKLVGFLTDFFQYDLGELNHVIVQMIDDIFGKIVNDKIAAKSDTTSRE 595
           YPMTCT+ +K Y KL  F++ F+++ L  LN+++V  ID I   +VN +I AK +TTSRE
Sbjct: 535 YPMTCTMTQKVYAKLTSFISSFYRHSLHSLNNILVNTIDGILDGVVNKQIRAKLETTSRE 594

Query: 596 EIAQILINLDYFIVAVKEFSNILSRENIMHNPGVELGLQATKQLSKSRTLTETKLIALID 655
           EIAQ+LINLDYF++A KEFSN+++++NI+ NP VE+ L +TK  ++SR   E+KLI LID
Sbjct: 595 EIAQLLINLDYFVIASKEFSNLMTKDNILENPDVEIRLASTKNFAESRKYAESKLIDLID 654

Query: 656 SKVSDLMEFVEFEWASQEILREPDYSIKDIAQFLEMMFNSTLVNLPDSVKTLLIFREFDA 715
           +K+ D++E V F+W   +   +PD SI D+AQFLEMMF +TLVNLP SV+ LLIFREFD+
Sbjct: 655 TKIKDILETVSFDWLDTDRRIDPDISIVDLAQFLEMMFATTLVNLPYSVQILLIFREFDS 714

Query: 716 LTRRFLDVLLNQTPSVITPQSILNFERNMDFLEAIITKLFXXXXXXXXXXXXXEIPSGQF 775
           LTR FLDVLL+ TP  I+ +S+ NFE +M +LE II K+F             + P    
Sbjct: 715 LTRHFLDVLLHDTPQYISKESVGNFEVDMMYLEGIIPKIFPRTDENENGRLGSQTPKTPT 774

Query: 776 SDN---ARSSNVINNTVRSLHSTFSDLKQHIQFLKSPDMEEYKDSSIRMRKYPRIKPEVA 832
            D+   ++S++ I+N ++SL STF +LKQ IQ L+S D  EY D  +R RKY RIKP+ A
Sbjct: 775 IDDESRSQSNSQIDNNIKSLESTFMELKQCIQLLQSEDPNEYLDPQMRSRKYSRIKPDDA 834

Query: 833 QMLYNKIVPPRS-AGTESEESSSV 855
            +L  KI P  + A T   E+SSV
Sbjct: 835 NILIGKIRPITAPAPTNEAENSSV 858

>Sklu_1965.4 YDR258C, Contig c1965 3102-5477
          Length = 791

 Score = 34.7 bits (78), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 54/112 (48%), Gaps = 13/112 (11%)

Query: 268 ELKLSNFKFNSPVEISLRDTTQLESLNVATLYPLDEFYDSILIFQNLKEIDYLRTEFKKE 327
           ELKL N + +   EI  ++ +++ES+  A +  L++    + I Q  +E DY      K 
Sbjct: 365 ELKLKNDELSRLTEIWEKEKSEIESIKTAKV-DLEQARTELQICQ--REGDY-----AKA 416

Query: 328 YDFRTSKVVHPLELKVSASATPAEQKLQVTNLFADDFTQDQLKHYLLRILGF 379
            + R SK+   LE KVS S    EQK    NL  D  T D +   + ++ G 
Sbjct: 417 SELRYSKIPE-LERKVSMS----EQKDTKNNLLHDAVTSDDISQVIAKMTGI 463

>Scas_655.17d
          Length = 271

 Score = 33.1 bits (74), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 29/118 (24%), Positives = 60/118 (50%), Gaps = 4/118 (3%)

Query: 203 NYNFDFLKKIYASIPILKSKIKDESINLVKSSFNSNLEKKLLTVGQTFFDFYHDVLLSDW 262
           N + ++L+K +     L  +  D SIN+ + S  S  ++ LL V Q   +    ++   W
Sbjct: 151 NKSLEYLEKYFWEDQFLFQQSSDSSINMFQKSLASMGKRHLLKVSQNVIEKPQKLVFGIW 210

Query: 263 LNSRSELKLSNFKFNSPVEISLRDTTQLESLNVATLYPLDEFYDSILIFQNLKEIDYL 320
           L+S++ + L     N+ V  SL+++  ++S++  T+    +    +L+F NL  ++ L
Sbjct: 211 LDSQNHVLLFA---NTAVNFSLKESL-VKSVHGNTMSSRSDVVKKLLLFLNLAIVESL 264

>Scas_706.28
          Length = 1234

 Score = 31.2 bits (69), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 44/100 (44%), Gaps = 13/100 (13%)

Query: 459  NVLLFKKYAR-FLVQMFDSEFSTLLDDDDFMPLTINDHGLYEKVLKICWL------REDE 511
            N+ +F+K+ + +++Q   SE+  +     F    I  HG   K +KIC L       EDE
Sbjct: 945  NINMFEKFQKSWVLQFVSSEYLLIRKVIRFYLERIGKHGKVIKAIKICGLLGVSENAEDE 1004

Query: 512  LDKFGSIEQTPGESFFATLPFSPLYPMTCTLAKKCYNKLV 551
            L K       P E      P+   Y  +C +  K + KL+
Sbjct: 1005 LKK----RDNPEEKIIKKAPYDVRY--SCLILVKIFIKLL 1038

>KLLA0E12265g complement(1084026..1086128) similar to sp|P36000
           Saccharomyces cerevisiae YKL135c APL2 AP-1 complex
           subunit, beta1-adaptin, 82 KD, start by similarity
          Length = 700

 Score = 30.8 bits (68), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 44/191 (23%), Positives = 84/191 (43%), Gaps = 30/191 (15%)

Query: 266 RSELKLSNFKFNSPVEISLRDTTQLESLNV-ATLYPLDEFYDSILIFQNLKEIDYLRTEF 324
           R EL++   KFN P+ +      ++E L++   L P+D      ++F  LKE  Y + +F
Sbjct: 328 RKELRIFYVKFNDPLYV------KIEKLDILLRLVPVDNLKHCQMLFNELKE--YAK-DF 378

Query: 325 KKEYDFRTSKVVHPLELKVSASATPAEQKLQVTNLFADDFT-----QDQLKHYLLR-ILG 378
             E+  +  + +  L +KVS        K    N+  ++F      +++ +  L+R +  
Sbjct: 379 DHEFVTKAIQSISQLAIKVSNGGEDTNNKF--LNMVMEEFVSIVQEREEFRDILMRCVCD 436

Query: 379 FVIYDRHLNKSTEYVLSFNQFNTSESFWELFINRFSP---------FLEHFVNSRINTE- 428
            + YD   N   E   S N+     S W+     F+          F+ ++ N  + T+ 
Sbjct: 437 MLRYDSDNNLIKET--SKNELGAIISSWQDIDTIFTSDLGSCNYIWFITNYTNENLETKL 494

Query: 429 EEMIDLKDFLG 439
           E ++++ D LG
Sbjct: 495 EPLVEVFDELG 505

>YGL061C (DUO1) [1918] chr7 complement(388969..389712) Protein
           component of Dad1p-Duo1p-Dam1p complex
           (Dad1p-Duo1p-Dam1p-Ask1p-Spc19p-Spc34p-Dad2p), required
           for maintenance of metaphase and anaphase spindle
           integrity [744 bp, 247 aa]
          Length = 247

 Score = 30.4 bits (67), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 17/68 (25%), Positives = 37/68 (54%), Gaps = 2/68 (2%)

Query: 61  RSAIEDESLPLVVEELYNSIEDNFENLESQILQDSQ--LSDNLTASVGQIASIKEVIEGS 118
           +S ++D ++  ++ +++N +  N  N  ++  + +    SDN++A+   I S   +   S
Sbjct: 4   QSQLDDSTIDKLIPQIFNEMRSNLNNTTNKFPKSTGGGASDNISANSNSIRSFNSITTQS 63

Query: 119 LLQEIEDL 126
           LL+E E L
Sbjct: 64  LLKESESL 71

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.136    0.376 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 27,066,927
Number of extensions: 1208257
Number of successful extensions: 4486
Number of sequences better than 10.0: 45
Number of HSP's gapped: 4621
Number of HSP's successfully gapped: 45
Length of query: 864
Length of database: 16,596,109
Length adjustment: 110
Effective length of query: 754
Effective length of database: 12,788,129
Effective search space: 9642249266
Effective search space used: 9642249266
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)