Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_47.1921226626313880.0
YGL232W2892628021e-108
Scas_712.192922677941e-106
AFR250C2772597384e-98
KLLA0A01045g3092827067e-93
CAGL0H07931g2652516696e-88
Sklu_2433.121441355474e-71
CAGL0J02068g70855720.43
Kwal_14.235294540681.2
Kwal_56.2231736256681.2
Kwal_33.1360478764671.7
Sklu_2343.732265661.9
YJL200C78971653.1
Sklu_2090.178874653.2
Sklu_1117.1231118633.4
CAGL0J00803g131486635.3
KLLA0C08778g553111635.5
Sklu_2435.7352169626.4
CAGL0I01210g55182617.7
Scas_506.368937618.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_47.19212
         (263 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_47.19212                                                         539   0.0  
YGL232W (TAN1) [1766] chr7 (62074..62130,62189..63001) Protein c...   313   e-108
Scas_712.19                                                           310   e-106
AFR250C [3442] [Homologous to ScYGL232W - SH] (887185..888018) [...   288   4e-98
KLLA0A01045g 99292..100221 similar to sp|P53072 Saccharomyces ce...   276   7e-93
CAGL0H07931g 775729..776526 similar to sp|P53072 Saccharomyces c...   262   6e-88
Sklu_2433.12 YGL232W, Contig c2433 21601-22035                        215   4e-71
CAGL0J02068g 204811..206937 similar to sp|P40557 Saccharomyces c...    32   0.43 
Kwal_14.2352                                                           31   1.2  
Kwal_56.22317                                                          31   1.2  
Kwal_33.13604                                                          30   1.7  
Sklu_2343.7 YPL266W, Contig c2343 11318-12286                          30   1.9  
YJL200C (YJL200C) [2727] chr10 complement(56444..58813) Protein ...    30   3.1  
Sklu_2090.1 YJL200C, Contig c2090 590-2956 reverse complement          30   3.2  
Sklu_1117.1 YOL080C, Contig c1117 228-923                              29   3.4  
CAGL0J00803g complement(83483..87427) similar to sp|P43638 Sacch...    29   5.3  
KLLA0C08778g complement(767642..769303) weakly similar to sp|P25...    29   5.5  
Sklu_2435.7 YPR133C, Contig c2435 9461-10519 reverse complement        28   6.4  
CAGL0I01210g 99925..101580 weakly similar to sp|P38818 Saccharom...    28   7.7  
Scas_506.3                                                             28   8.4  

>Kwal_47.19212
          Length = 266

 Score =  539 bits (1388), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/263 (100%), Positives = 263/263 (100%)

Query: 1   MQHKFSSGTLEPCVSGIYATCARKHEKQAAQELSMLFQEKLEEYYAQELKELNDGSDSDT 60
           MQHKFSSGTLEPCVSGIYATCARKHEKQAAQELSMLFQEKLEEYYAQELKELNDGSDSDT
Sbjct: 1   MQHKFSSGTLEPCVSGIYATCARKHEKQAAQELSMLFQEKLEEYYAQELKELNDGSDSDT 60

Query: 61  DEDASVEDRIKKELDSLKVKKTGPKEKDILKFVDLNCECVVFCKTRRPIVPEKFVHRLME 120
           DEDASVEDRIKKELDSLKVKKTGPKEKDILKFVDLNCECVVFCKTRRPIVPEKFVHRLME
Sbjct: 61  DEDASVEDRIKKELDSLKVKKTGPKEKDILKFVDLNCECVVFCKTRRPIVPEKFVHRLME 120

Query: 121 EFADPKVTQKRTRYIQKLTPVTFSCNASLPELSKLAQRVLKSHFHEDGVKPLKFAVEVTR 180
           EFADPKVTQKRTRYIQKLTPVTFSCNASLPELSKLAQRVLKSHFHEDGVKPLKFAVEVTR
Sbjct: 121 EFADPKVTQKRTRYIQKLTPVTFSCNASLPELSKLAQRVLKSHFHEDGVKPLKFAVEVTR 180

Query: 181 RNFNTIDKMDIIKEVAKEVGKGGELEHKVDLKNYDKLVLVECFKNNIGMSVVDSDYLKLF 240
           RNFNTIDKMDIIKEVAKEVGKGGELEHKVDLKNYDKLVLVECFKNNIGMSVVDSDYLKLF
Sbjct: 181 RNFNTIDKMDIIKEVAKEVGKGGELEHKVDLKNYDKLVLVECFKNNIGMSVVDSDYLKLF 240

Query: 241 RKYNVQQIYEAKIKKATTESPEE 263
           RKYNVQQIYEAKIKKATTESPEE
Sbjct: 241 RKYNVQQIYEAKIKKATTESPEE 263

>YGL232W (TAN1) [1766] chr7 (62074..62130,62189..63001) Protein
           containing a thiouridine synthase, methylase, or
           pseudouridine synthase (THUMP) domain, which may bind
           RNA, has moderate similarity to uncharacterized C.
           albicans Orf6.8082p [870 bp, 289 aa]
          Length = 289

 Score =  313 bits (802), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 159/262 (60%), Positives = 199/262 (75%), Gaps = 11/262 (4%)

Query: 4   KFSSGTLEPCVSGIYATCARKHEKQAAQELSMLFQEKLEEYYAQELKELNDGSDSDTDED 63
           K SSG L+P  SGIYATC+R+HE+QAAQEL +LF+EK +E Y  ++KE  D S++D  +D
Sbjct: 21  KVSSGFLDPGTSGIYATCSRRHERQAAQELQLLFEEKFQELYG-DIKEGEDESENDEKKD 79

Query: 64  ASVEDRIKKELDSLKVKKTG-------PKEKDILKFVDLNCECVVFCKTRRPIVPEKFVH 116
            S+ED+IKKEL  LK ++TG        K+KD L F+DLNCECV FCKTR+PIVPE+FV 
Sbjct: 80  LSIEDQIKKELQELKGEETGKDLSSGETKKKDPLAFIDLNCECVTFCKTRKPIVPEEFVL 139

Query: 117 RLMEEFADPKVTQKRTRYIQKLTPVTFSCNASLPELSKLAQRVLKSHFHE--DGVKPLKF 174
            +M++ ADPK   KRTRY+QKLTP+T+SCNA + +L KLA  V+  HFH+  +  K  KF
Sbjct: 140 SIMKDLADPKNMVKRTRYVQKLTPITYSCNAKMEQLIKLANLVIGPHFHDPSNVKKNYKF 199

Query: 175 AVEVTRRNFNTIDKMDIIKEVAKEVGK-GGELEHKVDLKNYDKLVLVECFKNNIGMSVVD 233
           AVEVTRRNFNTI++MDII +V K V K G E  H VDLKNYDKL+LVECFK+NIGM VVD
Sbjct: 200 AVEVTRRNFNTIERMDIINQVVKLVNKEGSEFNHTVDLKNYDKLILVECFKSNIGMCVVD 259

Query: 234 SDYLKLFRKYNVQQIYEAKIKK 255
            DY   +RKYNVQQ+YE+K +K
Sbjct: 260 GDYKTKYRKYNVQQLYESKFRK 281

>Scas_712.19
          Length = 292

 Score =  310 bits (794), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 159/267 (59%), Positives = 198/267 (74%), Gaps = 15/267 (5%)

Query: 4   KFSSGTLEPCVSGIYATCARKHEKQAAQELSMLFQEKLEEYYAQELKELNDGSDSDTDED 63
           K +SG L+P  SGIYATC+R+ E+ AAQEL  LF+EK +E Y +EL + +D SD +  ++
Sbjct: 21  KINSGFLDPGTSGIYATCSRRKERLAAQELGQLFEEKFQEMYKEELTK-DDDSDEENIDE 79

Query: 64  ASVEDRIKKELDSLKVKK-------TGPKEKDILKFVDLNCECVVFCKTRRPIVPEKFVH 116
            S+ED+IK+EL  L  K           K+K+ L+F+DL+CECV+FCKTR PIVPE+FV 
Sbjct: 80  LSIEDQIKQELSELHEKNKPTSKSHDNNKKKEPLQFIDLDCECVIFCKTRSPIVPEEFVA 139

Query: 117 RLMEEFADPKVTQKRTRYIQKLTPVTFSCNASLPELSKLAQRVLKSHFH----EDGVKPL 172
           +++E+ A P   +KRTRYI KLTP+T+SCNA++ +L  LAQR+L  HFH    EDG   L
Sbjct: 140 KIIEDLASPDNMEKRTRYIAKLTPITYSCNATMEQLILLAQRILAPHFHGEHSEDG---L 196

Query: 173 KFAVEVTRRNFNTIDKMDIIKEVAKEVGKGGELEHKVDLKNYDKLVLVECFKNNIGMSVV 232
           KFAVEVTRRNFNTI KMDII +V KEV + G+L HKVDLKNYDKLVLVECFKNNIGMSVV
Sbjct: 197 KFAVEVTRRNFNTIPKMDIINQVVKEVTEKGKLNHKVDLKNYDKLVLVECFKNNIGMSVV 256

Query: 233 DSDYLKLFRKYNVQQIYEAKIKKATTE 259
             DYL  +RKYNVQQIYEAK    + E
Sbjct: 257 SGDYLTKYRKYNVQQIYEAKFNDNSEE 283

>AFR250C [3442] [Homologous to ScYGL232W - SH] (887185..888018) [834
           bp, 277 aa]
          Length = 277

 Score =  288 bits (738), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 152/259 (58%), Positives = 195/259 (75%), Gaps = 7/259 (2%)

Query: 2   QHKFSSGTLEPCVSGIYATCARKHEKQAAQELSMLFQEKLEEYYAQELKELNDG---SDS 58
           ++K    T++P  SGIYATCAR+HEKQA++EL  + QEK EEYY  ELK + +    SD 
Sbjct: 16  KYKVVHATIDPNTSGIYATCARRHEKQASRELMSILQEKAEEYYVDELKAIAETELLSDK 75

Query: 59  DTDEDASVEDRIKKELDSLKVKKTGP---KEKDILKFVDLNCECVVFCKTRRPIVPEKFV 115
           + +E+ SVE++++KEL+ LK K +GP   K+K +L+ + L CEC+VF KTRRPI PE FV
Sbjct: 76  EDEEELSVEEQVQKELEQLK-KGSGPVDTKKKPVLQEIQLGCECMVFIKTRRPIKPECFV 134

Query: 116 HRLMEEFADPKVTQKRTRYIQKLTPVTFSCNASLPELSKLAQRVLKSHFHEDGVKPLKFA 175
            RL++E A  + T K +RY+Q+LTP+T SCNASL EL KL +RVL  HFH D     KFA
Sbjct: 135 KRLVQELASSENTTKVSRYVQRLTPITDSCNASLTELEKLCRRVLAPHFHTDKEIKYKFA 194

Query: 176 VEVTRRNFNTIDKMDIIKEVAKEVGKGGELEHKVDLKNYDKLVLVECFKNNIGMSVVDSD 235
           VEV +RNFNTIDKMDIIK VAKEVGK GEL H VDLK+YDKLV+V+C+KNNIGMSVVD D
Sbjct: 195 VEVVKRNFNTIDKMDIIKLVAKEVGKSGELGHSVDLKDYDKLVIVQCYKNNIGMSVVDKD 254

Query: 236 YLKLFRKYNVQQIYEAKIK 254
           Y    +KYN+Q+IY+ K++
Sbjct: 255 YSVALKKYNLQEIYDTKLQ 273

>KLLA0A01045g 99292..100221 similar to sp|P53072 Saccharomyces
           cerevisiae YGL232w singleton, start by similarity
          Length = 309

 Score =  276 bits (706), Expect = 7e-93,   Method: Compositional matrix adjust.
 Identities = 149/282 (52%), Positives = 195/282 (69%), Gaps = 20/282 (7%)

Query: 2   QHKFSSGTLEPCVSGIYATCARKHEKQAAQELSMLFQEKLEEYYAQELKELN----DGSD 57
           ++K    TL+P  SGIY TCAR  EK AA E+  +F+EK+EEYY+ EL  +N    DGS 
Sbjct: 16  RYKVVKSTLDPNTSGIYITCARNKEKAAASEILSIFEEKVEEYYSDELNAMNSASPDGSG 75

Query: 58  S-DTDEDASVEDRIKKELD----------SLKVKKTG----PKEKDILKFVDLNCECVVF 102
           S + +    V    KKE+            LK  KT      K K IL+ +DL  EC+VF
Sbjct: 76  SIEIESKEPVTTESKKEISIEEELQQELEGLKNHKTTIVDTKKNKPILEQLDLQTECLVF 135

Query: 103 CKTRRPIVPEKFVHRLMEEFADPKVTQKRTRYIQKLTPVTFSCNASLPELSKLAQRVLKS 162
            KTR+PIVPEKFVHR++ + ADP   +KRTR++QKLTP+T SC+AS+ EL+KL +RVL  
Sbjct: 136 VKTRKPIVPEKFVHRIIRDLADPHDLRKRTRFVQKLTPITDSCHASMEELAKLCERVLPQ 195

Query: 163 HFHEDGVKPLKFAVEVTRRNFNTIDKMDIIKEVAKEVGKGGELEHKVDLKNYDKLVLVEC 222
           HFH++ + P+KFAVE+ +RNF+T+DKM++IK +A  VGK G LEHKVDLKNYDKLVL++C
Sbjct: 196 HFHKEEMVPVKFAVEINKRNFSTMDKMEMIKYIAGFVGKQGSLEHKVDLKNYDKLVLLQC 255

Query: 223 FKNNIGMSVVDSDYLKLFRKYNVQQIYEAKIK-KATTESPEE 263
           FKNNIGM VVD DY   ++KYNVQ+++E K K K TT +  E
Sbjct: 256 FKNNIGMCVVDKDYRTDYKKYNVQELFEMKHKNKETTPTTAE 297

>CAGL0H07931g 775729..776526 similar to sp|P53072 Saccharomyces
           cerevisiae YGL232w, start by similarity
          Length = 265

 Score =  262 bits (669), Expect = 6e-88,   Method: Compositional matrix adjust.
 Identities = 134/251 (53%), Positives = 178/251 (70%), Gaps = 9/251 (3%)

Query: 4   KFSSGTLEPCVSGIYATCARKHEKQAAQELSMLFQEKLEEYYAQELKELNDGSDSDTDED 63
           K ++G L+P  SGIYATC R+ EK A  E+ +L +EK+EE Y +     ++ +DSD DE 
Sbjct: 20  KIATGFLDPGTSGIYATCTRRKEKAAISEMGILLEEKIEELYGE-----SEVADSDVDEA 74

Query: 64  ASVEDRIKKELDSLKVKKTGPKEKDILKFVDLNCECVVFCKTRRPIVPEKFVHRLMEEFA 123
            S+ED + KEL  LK  K    +K +LK +DL CECVVF KTR+P+ P   V  ++++F+
Sbjct: 75  GSIEDEVAKELAQLKKNKDDQDKKQLLKAIDLQCECVVFFKTRKPVNPTTLVKAIIDDFS 134

Query: 124 DPKVTQKRTRYIQKLTPVTFSCNASLPELSKLAQRVLKSHFHEDGVKPLKFAVEVTRRNF 183
           +P+   KRTRYIQKLTP+T+SCNA+  +  KL  +V++  F  D  +  KFAVEVTRRNF
Sbjct: 135 NPESKVKRTRYIQKLTPITYSCNATKEQFQKLIDQVVEPAFKSD--QSYKFAVEVTRRNF 192

Query: 184 NTIDKMDIIKEVAKEVGKGGELEHKVDLKNYDKLVLVECFKNNIGMSVVDSDYLKLFRKY 243
           NT+++MDII  V   V K G   HKVDLKNYDK+++VECFKNNIGMSV+D+DY K  +KY
Sbjct: 193 NTMERMDIINTVVSTVMKHG--HHKVDLKNYDKVIMVECFKNNIGMSVLDNDYSKKHKKY 250

Query: 244 NVQQIYEAKIK 254
           N+QQIYEAK K
Sbjct: 251 NLQQIYEAKFK 261

>Sklu_2433.12 YGL232W, Contig c2433 21601-22035
          Length = 144

 Score =  215 bits (547), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 96/135 (71%), Positives = 118/135 (87%)

Query: 119 MEEFADPKVTQKRTRYIQKLTPVTFSCNASLPELSKLAQRVLKSHFHEDGVKPLKFAVEV 178
           MEEFA+PK   KRTRY+QKLTP+T+SCNA++PEL KLAQRVL  HFH+D  K  KFA+++
Sbjct: 1   MEEFANPKDLTKRTRYVQKLTPITYSCNATMPELIKLAQRVLAPHFHQDETKAYKFAIDI 60

Query: 179 TRRNFNTIDKMDIIKEVAKEVGKGGELEHKVDLKNYDKLVLVECFKNNIGMSVVDSDYLK 238
           TRRNFNT+DKM++IK++A EVGK G+L+H VDLKN+DKLVLVECFKNNIGMSVV++DY  
Sbjct: 61  TRRNFNTLDKMEMIKQIASEVGKNGQLKHTVDLKNFDKLVLVECFKNNIGMSVVNADYRT 120

Query: 239 LFRKYNVQQIYEAKI 253
            F+KYNVQQ+YEAK 
Sbjct: 121 KFKKYNVQQLYEAKF 135

>CAGL0J02068g 204811..206937 similar to sp|P40557 Saccharomyces
           cerevisiae YIL005w, hypothetical start
          Length = 708

 Score = 32.3 bits (72), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 30/55 (54%), Gaps = 10/55 (18%)

Query: 100 VVFCKTRRPIVPEKFVHRLMEEFADPKVTQKRTRYIQKLTPVTFSCNASLPELSK 154
           ++FC   + +VPE F   ++E   +P  ++  T Y++K        N ++PEL+K
Sbjct: 336 IIFCYNHKTVVPEDFT--ILEHLVEPLASRPNT-YLRKF-------NGTIPELTK 380

>Kwal_14.2352
          Length = 945

 Score = 30.8 bits (68), Expect = 1.2,   Method: Composition-based stats.
 Identities = 16/40 (40%), Positives = 23/40 (57%), Gaps = 2/40 (5%)

Query: 142 TFSCNASLPELSKLAQRVLKSHFHEDGVKPLKFAVEVTRR 181
           +FS N + PE + L   VLK+  H   +KPL  A+  +RR
Sbjct: 701 SFSFNGTTPESADLPNSVLKA--HSPKMKPLALALNTSRR 738

>Kwal_56.22317
          Length = 362

 Score = 30.8 bits (68), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 28/56 (50%)

Query: 22  ARKHEKQAAQELSMLFQEKLEEYYAQELKELNDGSDSDTDEDASVEDRIKKELDSL 77
            RK+   AA   S    E LE+ Y   L   NDGS    D D S+ D +K +++++
Sbjct: 273 VRKNRTIAAGFKSTTILEILEKNYKAYLASTNDGSQMIDDSDQSLIDVVKAKIETV 328

>Kwal_33.13604
          Length = 787

 Score = 30.4 bits (67), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 34/64 (53%), Gaps = 9/64 (14%)

Query: 152 LSKLAQRVLKSHFHEDGVKPLKFAVEVTRRNFNTIDKMDIIKEV------AKEVGKGGEL 205
           L K   R+ +++  + GV PL FA E    +++ I   D+++ V      AKE   GGEL
Sbjct: 688 LVKSFARIHETNLKKQGVLPLTFAEE---SDYDRISSGDVLETVGLVDLIAKEGANGGEL 744

Query: 206 EHKV 209
           + K+
Sbjct: 745 DVKI 748

>Sklu_2343.7 YPL266W, Contig c2343 11318-12286
          Length = 322

 Score = 30.0 bits (66), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 37/65 (56%), Gaps = 1/65 (1%)

Query: 23  RKHEKQAAQELSMLFQEKLEEYYAQELKELNDGSDSDTDEDASVEDRIKKELDSLKVKKT 82
           RK+   AA   S    E LE+ Y   L  +NDGS+   D   S+ + +K++++++ +K+T
Sbjct: 234 RKNRTIAAGFKSSTVLEILEKNYKACLAAVNDGSEMIDDTKGSMLETVKQKIETV-LKET 292

Query: 83  GPKEK 87
           G  +K
Sbjct: 293 GLSDK 297

>YJL200C (YJL200C) [2727] chr10 complement(56444..58813) Protein
           with similarity to aconitase, has potential
           mitochondrial transit peptide [2370 bp, 789 aa]
          Length = 789

 Score = 29.6 bits (65), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 36/71 (50%), Gaps = 3/71 (4%)

Query: 152 LSKLAQRVLKSHFHEDGVKPLKFAVEVTRRNFNTID---KMDIIKEVAKEVGKGGELEHK 208
           L K   R+ +++  + GV PL FA E      ++ D    ++++  +AK+   GGE++ K
Sbjct: 689 LVKSFARIHETNLKKQGVLPLTFANESDYDKISSGDVLETLNLVDMIAKDGNNGGEIDVK 748

Query: 209 VDLKNYDKLVL 219
           +   N +   +
Sbjct: 749 ITKPNGESFTI 759

>Sklu_2090.1 YJL200C, Contig c2090 590-2956 reverse complement
          Length = 788

 Score = 29.6 bits (65), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 37/74 (50%), Gaps = 9/74 (12%)

Query: 152 LSKLAQRVLKSHFHEDGVKPLKFAVEVTRRNFNTIDKMDIIKEVA------KEVGKGGEL 205
           L K   R+ +++  + GV PL FA E    +++ I   D+++ V       KE   GGEL
Sbjct: 686 LVKSFARIHETNLKKQGVLPLTFADEA---DYDRIGSGDVLETVGLVDLIDKEGNNGGEL 742

Query: 206 EHKVDLKNYDKLVL 219
           + KV   + +  V+
Sbjct: 743 DVKVTKPSGETFVI 756

>Sklu_1117.1 YOL080C, Contig c1117 228-923
          Length = 231

 Score = 28.9 bits (63), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 33/118 (27%), Positives = 48/118 (40%), Gaps = 14/118 (11%)

Query: 59  DTDEDASVEDRIKKELDSLKVKKTGPKEKDILKFVDLNCECVVF------CKTRRPIVPE 112
           D   +A VE   K E D  K  +   + K I K+V ++CE V            R  +  
Sbjct: 24  DKPSEACVELSDKLEQDIAKRGQDKGRNKKIGKYVSMDCEFVGVGLDGKDSALARVSIVN 83

Query: 113 KFVHRLMEEFADP--KVTQKRTRYIQKLTPVTFSCNASLPELSK-----LAQRVLKSH 163
            F H +++ F  P  KVT  RT ++  + P       +L E  K     L  R+L  H
Sbjct: 84  FFGHVVLDVFVKPQEKVTDWRT-WVSGIKPHHMVGALALSEAQKQVASILEGRILVGH 140

>CAGL0J00803g complement(83483..87427) similar to sp|P43638
           Saccharomyces cerevisiae YJL042w MHP1, hypothetical
           start
          Length = 1314

 Score = 28.9 bits (63), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 39/86 (45%), Gaps = 3/86 (3%)

Query: 141 VTFSCNASLPELSKLAQRVLKSHFHEDGVKPLKFAVEVTRRNFNTIDKMDIIKEVAKEVG 200
           +  S   S P L KL  R   +  +EDG K L + +   ++NF  +D + ++  +   V 
Sbjct: 584 IILSSLVSNPHLEKLTMR--NTPLNEDGWKILSYFITKQKKNFVALD-LTMVPTIKTNVQ 640

Query: 201 KGGELEHKVDLKNYDKLVLVECFKNN 226
           K  +     +  N + L  +EC  +N
Sbjct: 641 KPSKSSLAKNANNPNLLKRMECNTHN 666

>KLLA0C08778g complement(767642..769303) weakly similar to sp|P25364
           Saccharomyces cerevisiae YCR065w HCM1 transcription
           factor, hypothetical start
          Length = 553

 Score = 28.9 bits (63), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 45/111 (40%), Gaps = 17/111 (15%)

Query: 86  EKDILKFVDLNCECVVFCKTRRPIVPEKFVHR------------LMEEFADPKVTQKRTR 133
           +KD L + D N   V    +   + P KF HR            ++   + PK  +    
Sbjct: 320 DKDFLYYEDENM--VKRQDSSHLVGPLKFNHRSVSAHNHEYDDLMVAAVSSPKFKKYSCS 377

Query: 134 YIQKLTPVTFSCNASLPELSKLAQRVLKSHFHEDGVKPLKFAVEVTRRNFN 184
           +     PV+      LP ++   Q+  K+   E  V PLKF +  T ++FN
Sbjct: 378 FNTSFEPVSPMNKLQLPSVN---QQNSKTPIRESSVTPLKFNIFSTPKDFN 425

>Sklu_2435.7 YPR133C, Contig c2435 9461-10519 reverse complement
          Length = 352

 Score = 28.5 bits (62), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 42/169 (24%), Positives = 74/169 (43%), Gaps = 33/169 (19%)

Query: 53  NDGSDSDTDEDAS------VEDRIKKELDSLKVKKTGPKEKDILKFVDLNCECVVFCKTR 106
           N G D+D + D S      +ED+++K L   KV+++   E D+ +++D   E ++  K  
Sbjct: 53  NVGDDADLELDQSTRRRQLLEDKMEKLLKKPKVRRSRQDEDDLEQYLD---EKILRLKDE 109

Query: 107 RPIVPEKFVHRLME--EFADPK-VTQKRTRYIQKLTPVTFSCNASLPELSKLAQRVLKSH 163
             I  +K +  L +  E  D K V  ++ + + K+  V    N        LA  +L ++
Sbjct: 110 MNIAAQKDIETLNQRLENGDTKAVAMEKVKLLPKVITVLSKAN--------LADTILDNN 161

Query: 164 FHE----------DGVKPLKFAVEVTRRNFNTIDKMDIIKEVAKEVGKG 202
             +          DG  P   + E+ +  F  +D + I  E  KE G G
Sbjct: 162 LLQSVRIWLEPLPDGSLP---SFEIQKSLFAALDNLPIKTEHLKESGLG 207

>CAGL0I01210g 99925..101580 weakly similar to sp|P38818
           Saccharomyces cerevisiae YHR109w CTM1 cytochrome c
           methyltransferase, start by similarity
          Length = 551

 Score = 28.1 bits (61), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 37/82 (45%), Gaps = 7/82 (8%)

Query: 37  FQEKLEEYYAQELKELNDGSDSDTDEDASVEDRIKKELDS-LKVKKTGPKEKDILKFVDL 95
           FQ  LE Y    +  L + S  DT+ + +V   I +EL   LK++      K I     L
Sbjct: 462 FQAYLENYLDYRIDVLQEYSPEDTENENAVSQLIARELSVLLKIRDRINNNKSIF----L 517

Query: 96  NCECVVFCKTRRPIVPEKFVHR 117
           N E   + K   P++P K V R
Sbjct: 518 NSEDKKYAKL--PLLPTKNVER 537

>Scas_506.3
          Length = 689

 Score = 28.1 bits (61), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 24/37 (64%), Gaps = 1/37 (2%)

Query: 43  EYYAQELKELNDGSDSDTDEDASVEDRIKKELDSLKV 79
           E+     K+L D +D+D+D D S+ D++  +LDSL +
Sbjct: 566 EWGGITCKDLQDYNDTDSDSDFSL-DKVSIQLDSLNL 601

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.133    0.372 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,862,484
Number of extensions: 402969
Number of successful extensions: 2821
Number of sequences better than 10.0: 113
Number of HSP's gapped: 2791
Number of HSP's successfully gapped: 114
Length of query: 263
Length of database: 16,596,109
Length adjustment: 100
Effective length of query: 163
Effective length of database: 13,134,309
Effective search space: 2140892367
Effective search space used: 2140892367
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 60 (27.7 bits)