Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_47.192101811808401e-116
AFR249W1811804903e-63
YGL231C1901834783e-61
Scas_712.201861714341e-54
CAGL0H07953g1831684262e-53
KLLA0A01067g2021813993e-49
Sklu_2433.1379691512e-13
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_47.19210
         (180 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_47.19210                                                         328   e-116
AFR249W [3441] [Homologous to ScYGL231C - SH] complement(886552....   193   3e-63
YGL231C (YGL231C) [1767] chr7 complement(63047..63619) Protein o...   188   3e-61
Scas_712.20                                                           171   1e-54
CAGL0H07953g complement(776742..777293) similar to sp|P53073 Sac...   168   2e-53
KLLA0A01067g complement(100259..100867) weakly similar to sp|P53...   158   3e-49
Sklu_2433.13 YGL231C, Contig c2433 22436-22670 reverse complement      63   2e-13

>Kwal_47.19210
          Length = 181

 Score =  328 bits (840), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 163/180 (90%), Positives = 163/180 (90%)

Query: 1   MSEIIPEWAQNLCDPDYVQKINVVTSNSLPSPPGFXXXXXXXXXXXXXXXXXAEAENLAS 60
           MSEIIPEWAQNLCDPDYVQKINVVTSNSLPSPPGF                 AEAENLAS
Sbjct: 1   MSEIIPEWAQNLCDPDYVQKINVVTSNSLPSPPGFKTLSVSTSKPSKKTSNSAEAENLAS 60

Query: 61  LMVQKAWQISFQPAKSIPMNMIVSYMSGTSLQIISIMTALMFVSNPIKSVINIRRTFKPV 120
           LMVQKAWQISFQPAKSIPMNMIVSYMSGTSLQIISIMTALMFVSNPIKSVINIRRTFKPV
Sbjct: 61  LMVQKAWQISFQPAKSIPMNMIVSYMSGTSLQIISIMTALMFVSNPIKSVINIRRTFKPV 120

Query: 121 MGNPEVQPQVLSAMIMFVVFQAMLMGIGIHKLNSMGLIPNTKSDWLFLEKPAIYKDRSYA 180
           MGNPEVQPQVLSAMIMFVVFQAMLMGIGIHKLNSMGLIPNTKSDWLFLEKPAIYKDRSYA
Sbjct: 121 MGNPEVQPQVLSAMIMFVVFQAMLMGIGIHKLNSMGLIPNTKSDWLFLEKPAIYKDRSYA 180

>AFR249W [3441] [Homologous to ScYGL231C - SH]
           complement(886552..887097) [546 bp, 181 aa]
          Length = 181

 Score =  193 bits (490), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 92/180 (51%), Positives = 123/180 (68%)

Query: 1   MSEIIPEWAQNLCDPDYVQKINVVTSNSLPSPPGFXXXXXXXXXXXXXXXXXAEAENLAS 60
           MS   P WA+ L +P+Y++ I+VV+SN+LP PPGF                 A  E + +
Sbjct: 1   MSSEAPTWARCLVEPEYLKSISVVSSNTLPQPPGFSKKQKSQTRSVSKEEGEANRERINA 60

Query: 61  LMVQKAWQISFQPAKSIPMNMIVSYMSGTSLQIISIMTALMFVSNPIKSVINIRRTFKPV 120
           L V+KAWQ++FQP+K+IPMN  +SYMSGTSLQII IMTALM ++ P+KSV+ +R TFK +
Sbjct: 61  LQVKKAWQLAFQPSKAIPMNFFMSYMSGTSLQIIPIMTALMLLTGPVKSVLQVRSTFKGL 120

Query: 121 MGNPEVQPQVLSAMIMFVVFQAMLMGIGIHKLNSMGLIPNTKSDWLFLEKPAIYKDRSYA 180
           + N     QVL+AM ++V FQA+LM IG+ KLN+MGL+PN  SDWL  E P  Y  +SYA
Sbjct: 121 LNNEAAYGQVLAAMCLYVFFQAVLMAIGLQKLNAMGLLPNKHSDWLAWETPMAYSMQSYA 180

>YGL231C (YGL231C) [1767] chr7 complement(63047..63619) Protein of
           unknown function, has moderate similarity to
           uncharacterized S. pombe Spcc1281.03cp [573 bp, 190 aa]
          Length = 190

 Score =  188 bits (478), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 98/183 (53%), Positives = 121/183 (66%), Gaps = 7/183 (3%)

Query: 1   MSEIIP-EWAQNLCDPDYVQKINVVTSNSLPSPPGFXXXXXXXXXXXXXXXXXAEAENLA 59
           MSE  P EWA++L D  Y++K N+  SN+LPSPPGF                 ++  +LA
Sbjct: 1   MSEQEPYEWAKHLLDTKYIEKYNIQNSNTLPSPPGFEGNSSKGNVTRKQQDATSQTTSLA 60

Query: 60  S------LMVQKAWQISFQPAKSIPMNMIVSYMSGTSLQIISIMTALMFVSNPIKSVINI 113
                  L VQKAWQI+ QPAKSIPMN+ +SYMSGTSLQII IMTALM +S PIK++ + 
Sbjct: 61  QKNQITVLQVQKAWQIALQPAKSIPMNIFMSYMSGTSLQIIPIMTALMLLSGPIKAIFST 120

Query: 114 RRTFKPVMGNPEVQPQVLSAMIMFVVFQAMLMGIGIHKLNSMGLIPNTKSDWLFLEKPAI 173
           R  FKPV+GN   Q QV +AM M++VFQ +LM IG  KLNSMGLIPN K DWL  E+ A 
Sbjct: 121 RSAFKPVLGNKATQSQVQTAMFMYIVFQGVLMYIGYRKLNSMGLIPNAKGDWLPWERIAH 180

Query: 174 YKD 176
           Y +
Sbjct: 181 YNN 183

>Scas_712.20
          Length = 186

 Score =  171 bits (434), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 90/171 (52%), Positives = 111/171 (64%), Gaps = 3/171 (1%)

Query: 7   EWAQNLCDPDYVQKINVVTSNSLPSPPGFXXXXXXXXXXXXXXXXXAEA---ENLASLMV 63
           EWA  LC+    +  +     +LPSPPG+                  EA   + L +L+ 
Sbjct: 7   EWAVKLCNLKEEEATDSSAIKTLPSPPGYGVVEVGKNQHESQGNKATEAIRMKELNNLLA 66

Query: 64  QKAWQISFQPAKSIPMNMIVSYMSGTSLQIISIMTALMFVSNPIKSVINIRRTFKPVMGN 123
           QKA  I+ QPAKSIPMNMI+SYMSGTSLQII IM ALM +S P+K++ +IR  FKPV+GN
Sbjct: 67  QKAMSIAMQPAKSIPMNMIMSYMSGTSLQIIPIMAALMLLSGPLKAIFSIRAAFKPVLGN 126

Query: 124 PEVQPQVLSAMIMFVVFQAMLMGIGIHKLNSMGLIPNTKSDWLFLEKPAIY 174
            E+Q QV SAM +++VFQ  LM IGI KLN+MGLIPNTKSDWL  E P  Y
Sbjct: 127 KEIQSQVNSAMFLYIVFQGALMYIGIRKLNAMGLIPNTKSDWLTWELPVDY 177

>CAGL0H07953g complement(776742..777293) similar to sp|P53073
           Saccharomyces cerevisiae YGL231c, hypothetical start
          Length = 183

 Score =  168 bits (426), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 86/168 (51%), Positives = 109/168 (64%), Gaps = 1/168 (0%)

Query: 7   EWAQNLCDPDYVQKINVVTSNSLPSPPGFXXXXXXXXXXXXXXXXXAEAENLASLMVQKA 66
           EW +NL +P  V++    T N+ PSP G+                     ++A+L VQKA
Sbjct: 8   EWVENLLNPQIVKEWQQSTVNT-PSPQGYQGLSGSVRDKKNTSNKQVNKPDIANLQVQKA 66

Query: 67  WQISFQPAKSIPMNMIVSYMSGTSLQIISIMTALMFVSNPIKSVINIRRTFKPVMGNPEV 126
           W+I+ QPAKSIPMN  +SYMSGTSLQII IMTALM +S P+KS+  IR TFKPV+GNP+ 
Sbjct: 67  WEIALQPAKSIPMNFFMSYMSGTSLQIIPIMTALMLLSGPVKSIFTIRETFKPVLGNPKS 126

Query: 127 QPQVLSAMIMFVVFQAMLMGIGIHKLNSMGLIPNTKSDWLFLEKPAIY 174
           Q Q+   MI++V FQ +LM IG+ KLN MGLIPN  SDW+  EK   Y
Sbjct: 127 QNQIYLMMILYVAFQGVLMFIGLKKLNDMGLIPNKTSDWMAWEKITDY 174

>KLLA0A01067g complement(100259..100867) weakly similar to sp|P53073
           Saccharomyces cerevisiae YGL231c singleton, start by
           similarity
          Length = 202

 Score =  158 bits (399), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 85/181 (46%), Positives = 118/181 (65%), Gaps = 3/181 (1%)

Query: 1   MSEIIPEWAQNLCDPDYVQKINVVTSNSLPSPPGFXXXXXXXXXXXXXXXXXAEAENLAS 60
           MSE IP+WA++L   D V + N V    LP P G                  A+   +A 
Sbjct: 23  MSEDIPQWAKDL-KVDKVMRRNSVNGGKLPDPFGIKKLEIEGQKPPKVIDHDAQ-NRIAK 80

Query: 61  LMVQKAWQISFQPAKSIPMNMIVSYMSGTSLQIISIMTALMFVSNPIKSVINIRRTFKPV 120
           L  ++AWQIS +P KS+PMN+I+SYMSG SLQII IMTA+M VSNPIKS++ ++  F+ +
Sbjct: 81  LTAERAWQISSEPLKSVPMNIIMSYMSGNSLQIIPIMTAVMLVSNPIKSILGVKSKFQHL 140

Query: 121 MG-NPEVQPQVLSAMIMFVVFQAMLMGIGIHKLNSMGLIPNTKSDWLFLEKPAIYKDRSY 179
           +  + +V P V++AMIM+V++Q +LMGIG+HKLNSMGL P T SDWL  ++P  Y  R+ 
Sbjct: 141 INKDNDVTPPVVAAMIMYVIYQLILMGIGLHKLNSMGLFPTTSSDWLAWQQPTEYLYRTL 200

Query: 180 A 180
           +
Sbjct: 201 S 201

>Sklu_2433.13 YGL231C, Contig c2433 22436-22670 reverse complement
          Length = 79

 Score = 62.8 bits (151), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 41/69 (59%)

Query: 6  PEWAQNLCDPDYVQKINVVTSNSLPSPPGFXXXXXXXXXXXXXXXXXAEAENLASLMVQK 65
          P+WA +LC+P + + + V +SN+LPSPPGF                 ++ +++  L VQK
Sbjct: 6  PQWATDLCNPKHAKSLTVASSNTLPSPPGFKLVSEGSSKNKNDNANKSKEKDINGLQVQK 65

Query: 66 AWQISFQPA 74
          AW+++ QPA
Sbjct: 66 AWELALQPA 74

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.133    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 4,887,041
Number of extensions: 150102
Number of successful extensions: 345
Number of sequences better than 10.0: 10
Number of HSP's gapped: 337
Number of HSP's successfully gapped: 10
Length of query: 180
Length of database: 16,596,109
Length adjustment: 95
Effective length of query: 85
Effective length of database: 13,307,399
Effective search space: 1131128915
Effective search space used: 1131128915
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 58 (26.9 bits)