Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_47.1920425024712391e-175
Sklu_2433.142502343712e-43
AFR248C3042323726e-43
YFR043C2372422902e-31
KLLA0A01089g2332192673e-28
Scas_699.392612451643e-13
CAGL0C02079g2652391625e-13
Sklu_2377.485270700.66
YPL221W793121690.85
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_47.19204
         (247 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_47.19204                                                         481   e-175
Sklu_2433.14 YFR043C, Contig c2433 23715-24467                        147   2e-43
AFR248C [3440] [Homologous to ScYFR043C - SH] (884696..885610) [...   147   6e-43
YFR043C (YFR043C) [1725] chr6 complement(239101..239814) Protein...   116   2e-31
KLLA0A01089g 102036..102737 weakly similar to sp|P43615 Saccharo...   107   3e-28
Scas_699.39                                                            68   3e-13
CAGL0C02079g 213832..214629 similar to sp|P43615 Saccharomyces c...    67   5e-13
Sklu_2377.4 YOR208W, Contig c2377 8218-10776 reverse complement        32   0.66 
YPL221W (YPL221W) [5228] chr16 (133042..135423) Protein of unkno...    31   0.85 

>Kwal_47.19204
          Length = 250

 Score =  481 bits (1239), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 234/247 (94%), Positives = 234/247 (94%)

Query: 1   MTTEFXXXXXXXXXXXXXPIRDKIIVCFSNYVHDQAEVISDLFGISFKDDQRIHHDLEWT 60
           MTTEF             PIRDKIIVCFSNYVHDQAEVISDLFGISFKDDQRIHHDLEWT
Sbjct: 1   MTTEFSMNQSLSDSSNSLPIRDKIIVCFSNYVHDQAEVISDLFGISFKDDQRIHHDLEWT 60

Query: 61  TKYYSVKIDLYIDSFDSLRDWVQQFCNSECDELRDVLAGLVLVVPCKVEDADLETFTQLA 120
           TKYYSVKIDLYIDSFDSLRDWVQQFCNSECDELRDVLAGLVLVVPCKVEDADLETFTQLA
Sbjct: 61  TKYYSVKIDLYIDSFDSLRDWVQQFCNSECDELRDVLAGLVLVVPCKVEDADLETFTQLA 120

Query: 121 DCMADAESFFVVLKARSNPSEECTDSSENKLLANGVEIVCRGDSGRNEYGEVIGTNRVRE 180
           DCMADAESFFVVLKARSNPSEECTDSSENKLLANGVEIVCRGDSGRNEYGEVIGTNRVRE
Sbjct: 121 DCMADAESFFVVLKARSNPSEECTDSSENKLLANGVEIVCRGDSGRNEYGEVIGTNRVRE 180

Query: 181 IIDTYDWQTQLLKLRQPSATKELEDTSSGLPLNEIMTRLQEARTKYLAMDSSEEREIFAR 240
           IIDTYDWQTQLLKLRQPSATKELEDTSSGLPLNEIMTRLQEARTKYLAMDSSEEREIFAR
Sbjct: 181 IIDTYDWQTQLLKLRQPSATKELEDTSSGLPLNEIMTRLQEARTKYLAMDSSEEREIFAR 240

Query: 241 DVAHELS 247
           DVAHELS
Sbjct: 241 DVAHELS 247

>Sklu_2433.14 YFR043C, Contig c2433 23715-24467
          Length = 250

 Score =  147 bits (371), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 80/234 (34%), Positives = 140/234 (59%), Gaps = 11/234 (4%)

Query: 21  RDKIIVCFSNYVHDQAEVISDLFGISFKDDQRIHHDLEWTTKYYSVKIDLYIDSFDSLRD 80
           R+KI+V  S  + ++  +IS LF  +      I  +L W  KYY   ID+YID +DSL +
Sbjct: 18  RNKILVVCSAEIENKVSIISSLFNTNVDSGCSILKNLSWQNKYYKTNIDVYIDDYDSLDE 77

Query: 81  WVQQFCNSECDELRDVLAGLVLVVPCKVEDADLETFTQLADCM----ADAESFFVVLKAR 136
           W ++F  SE ++LR+VLAG++L+   + E    +TF+   D +     + E F++     
Sbjct: 78  WTREFQQSEYNDLREVLAGVILLFNYRSE----QTFSHFLDIINSTSQNDEKFYIACNVS 133

Query: 137 SNPSEECTDSSENKLLANGVEIVCRGDSGRNEYGEVIGTNRVREIIDTYDW-QTQLLKLR 195
           S    E  +S  +  +A+G+E++   +SG+N +G+ +G  R+REIIDT++W Q +L    
Sbjct: 134 SKIDAEEWESLSDNYIAHGLELINWEESGKNAFGDKLGLERIREIIDTHEWTQCELDVKE 193

Query: 196 QPS--ATKELEDTSSGLPLNEIMTRLQEARTKYLAMDSSEEREIFARDVAHELS 247
           QP+      L+D S+   L E++ +L EAR++Y +M++ +E E+FA++++ EL+
Sbjct: 194 QPTIGVGSLLQDESAEFTLEEVLEKLNEARSRYQSMNNKDEAEMFAQEISEELT 247

>AFR248C [3440] [Homologous to ScYFR043C - SH] (884696..885610) [915
           bp, 304 aa]
          Length = 304

 Score =  147 bits (372), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 88/232 (37%), Positives = 133/232 (57%), Gaps = 13/232 (5%)

Query: 21  RDKIIVCFSNYVHDQAEVISDLFGISFKDDQRIHHDLEWTTKYYSVKIDLYIDSFDSLRD 80
           R+KI++        QAEVI DLF I   +  RI  D++W+ KYY V +DLYIDS++SL+ 
Sbjct: 75  RNKILILAPAGKAYQAEVIRDLFNIEASESDRIVRDVKWSNKYYEVDLDLYIDSYESLQT 134

Query: 81  WVQQFCNSECDELRDVLAGLVLVVPCKVEDADLETFTQL-ADCMADAESFFVV--LKARS 137
           W  +FC+ EC +LRDV+AG+ LV     E  D ETF QL  DC    E   V   L +  
Sbjct: 135 WGAEFCSDECADLRDVVAGIFLVFE---ETEDAETFQQLIEDCHFTDERVLVACDLSSAE 191

Query: 138 NPSEECTDSSENKLLANGVEIVCRGDSGRNEYGEVIGTNRVREIIDTYDWQTQLLKLRQP 197
           +P+     S E  L  + V +V   + G NE GE  G  RVRE++D + W  ++L++   
Sbjct: 192 HPA-----SLERALEVHDVALVRWRERGTNELGEQQGRERVRELLDIHPWSERMLRMHAS 246

Query: 198 SAT--KELEDTSSGLPLNEIMTRLQEARTKYLAMDSSEEREIFARDVAHELS 247
           +A    EL+   + +PL+ ++TR+++AR +YL +      + +A  +AHEL+
Sbjct: 247 TAAALAELDPLQADIPLDSVVTRIKQARERYLEITDVHAADEYAARIAHELT 298

>YFR043C (YFR043C) [1725] chr6 complement(239101..239814) Protein of
           unknown function [714 bp, 237 aa]
          Length = 237

 Score =  116 bits (290), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 81/242 (33%), Positives = 129/242 (53%), Gaps = 29/242 (11%)

Query: 21  RDKIIVCFSNYVHD--QAEVISDLF-----GISFKDDQRIHHDLEWTTKYYSVKIDLYID 73
           ++KI+V  S++ H+  + + + DLF     GIS   DQ       W  +YY V  DLYID
Sbjct: 7   QNKILV-LSDHPHNFLKTQFLQDLFHCSSTGISIVKDQT------WENRYYKVHFDLYID 59

Query: 74  SFDSLRDWVQQFCNSECDELRDVLAGLVLVVPCKVEDADLETFTQLADCMADAESFFVVL 133
           S   +  WV++F   EC+ LR+V+AG++L+   + +    E   Q    +A   + FVVL
Sbjct: 60  SCKEIPVWVEEFITPECEPLRNVMAGIILITDIR-QTKPQELLHQFM--IAAHRNTFVVL 116

Query: 134 KARSNPSEECTDSSENKLLANG----VEIV----CRGDSGRNEYGEVIGTNRVREIIDTY 185
              +   E+      N++ +N     +E V     +     N+YGE +G +R++EIIDT+
Sbjct: 117 ANVNEEVEQDEIDELNEIWSNAFTNVIEFVNWKRSKPTVNHNDYGEKLGLDRIQEIIDTH 176

Query: 186 DWQTQLLKLRQPSATKELEDTSSGLPLNEIMTRLQEARTKYLAMDSSEEREIFARDVAHE 245
           DW    L      ATK  E+  + +PL +I+  LQ AR KY ++++S E + FA ++A E
Sbjct: 177 DW----LNCEVQPATKIREEIPNEMPLEQIIRNLQSARLKYKSIENSSEADAFANEMADE 232

Query: 246 LS 247
           LS
Sbjct: 233 LS 234

>KLLA0A01089g 102036..102737 weakly similar to sp|P43615
           Saccharomyces cerevisiae YFR043c hypothetical protein
           singleton, hypothetical start
          Length = 233

 Score =  107 bits (267), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 68/219 (31%), Positives = 109/219 (49%), Gaps = 8/219 (3%)

Query: 32  VHDQAEVISDLFGISFKDDQRIHHDLEWTTKYYSVKIDLYIDSFDSLRDWVQQFCNSECD 91
           + +    IS +F   + + + I  D++W TKYY   +DLYID++D L++WV  F + EC 
Sbjct: 16  IQEHIAFISTIFQKQYDETESIARDVQWKTKYYETTLDLYIDTYDVLQEWVNDFVSDECK 75

Query: 92  ELRDVLAGLVLVVPCKVEDADLETFTQLADCMAD--AESFFVVLKARSNPSEECTDSSEN 149
           ELRDV++G++ V   +     +E    L D   +     FF+      N  EE      N
Sbjct: 76  ELRDVISGIIFVFKDEDHKPPVECLKNLIDERIEDFTAKFFIGCYFNENVIEEDELYELN 135

Query: 150 K-LLANGVEIVCRGDSGRNEYGEVIGTNRVREIIDTYDWQTQLLKLRQPSATKELEDTSS 208
             LL    EIV   D       +V G+ R++EIID + W +    L++      +    S
Sbjct: 136 SDLLVQNFEIVNWFDKPDPSMDKV-GSERIKEIIDVHPWLSHPETLKKNQGQINI----S 190

Query: 209 GLPLNEIMTRLQEARTKYLAMDSSEEREIFARDVAHELS 247
            + L+  MT+L++A+ +Y   D S+E E+F   +  ELS
Sbjct: 191 PIDLDSFMTKLEQAKERYQTFDDSKEAELFIEKIIDELS 229

>Scas_699.39
          Length = 261

 Score = 67.8 bits (164), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 59/245 (24%), Positives = 113/245 (46%), Gaps = 23/245 (9%)

Query: 21  RDKIIVCFS-NYVHD--QAEVISDLFGISFKDDQR--IHHDLEWTTKYYSVKIDLYIDSF 75
           ++KI+V F+ N +    Q E +   F +  ++D    I   + W  KY+ +++DLYID F
Sbjct: 8   QNKILVVFNKNRIPQTLQREFLQRTFDLPIENDSSDSIIKGIIWKNKYFELQLDLYIDEF 67

Query: 76  DSLRDWVQQFCNSECDELRDVLAGLVLVVPC-KVEDADLETFTQLADCMADAESFFVVLK 134
           +   ++V ++C  E  ELR V+AG++++      ED  L    Q       + SF V+  
Sbjct: 68  EDFEEFVYEYCLDEMSELRSVIAGIIIIDDTYHFEDNKLVNKLQTDSGSETSSSFMVIGN 127

Query: 135 ARSN-----------PSEECTDSSENKLLANGVEIVCRGDSGRNEYGEVIGTNRVREIID 183
              +           PSE  T+  +  ++A  V +       +N  G+ +G   ++E +D
Sbjct: 128 FEGDYEEEDIAQWRFPSESMTNDED--IIAEYVPLDKHFRMEKNSLGDKVGVPGIKEKLD 185

Query: 184 TYDWQT--QLLKLRQPSATKELEDTSSGLPLNEIMTRLQEARTKYLAMDSSEEREIFARD 241
            ++W     + KL Q   T     ++  + ++ I+ +L++AR  +      EE +  A  
Sbjct: 186 LHEWNPNCNIQKLDQIQPTH--PPSNMDVDISAIINQLRDARINFQTHKDQEEAKSIATA 243

Query: 242 VAHEL 246
           +A  +
Sbjct: 244 LAESI 248

>CAGL0C02079g 213832..214629 similar to sp|P43615 Saccharomyces
           cerevisiae YFR043c, hypothetical start
          Length = 265

 Score = 67.0 bits (162), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 62/239 (25%), Positives = 115/239 (48%), Gaps = 20/239 (8%)

Query: 20  IRDKIIVCF---SNYVHDQAEVISDLFGISFKDDQRIHHDLEWTTKYYSVKIDLYIDSFD 76
           + +K++V F   S    DQ  ++  +FG+  +D   I   L W TKYY+V+ DLY+D   
Sbjct: 33  LPNKVLVVFEGESTLFRDQ--LLDTVFGV--QDQGNIVKQLSWDTKYYAVEYDLYVDECV 88

Query: 77  SLRDWVQQFCNSECDELRDVLAGLVLVVPCKVEDADLETFTQLADCMADAESFFVVLKAR 136
            +  W+ +  + + +ELRD+L  +++V          E  + L D +    +   V+   
Sbjct: 89  DIHGWLNEVNSDDYEELRDLLTMIIIVRSFDSTQDTKEYNSVLYDFIQG--NSVSVISVN 146

Query: 137 SNPSEECTDSSEN--KLLANGVEIV-CRGDSGRNEYGEVIGTNRVREIIDTYDWQTQLLK 193
           +N + +  D+ +   +L A+ +E +    D    E  E  G  R++EIIDT+ W    + 
Sbjct: 147 TNSARQVKDTYDEFLELDASSIEFINYHDDRVEKETNECKGMARLKEIIDTHPWTDCKVV 206

Query: 194 LRQPSATKELEDTSSGLPLNEIMTRLQEARTKYLAMDS-----SEEREIFARDVAHELS 247
           L+   +T    D  +   L  ++  L++A+  Y  + +     SEE E FA  +A +++
Sbjct: 207 LKNKESTS---DKVNKPDLEYLIDTLKKAKIHYQKLSNGSDGFSEEAEQFALQMATDIA 262

>Sklu_2377.4 YOR208W, Contig c2377 8218-10776 reverse complement
          Length = 852

 Score = 31.6 bits (70), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 18/70 (25%), Positives = 33/70 (47%), Gaps = 1/70 (1%)

Query: 34  DQAEVISDLFGISFKDDQRIHHDLEWTTKYYSVKIDLYIDSFDSLRDWVQQFCNSECDEL 93
           ++ E    +F  S K D  +H+      KY++  I   I + D+L  W++ F  +  + L
Sbjct: 225 NKQESSGRMFIQSIKKDA-VHYSPNSLKKYFTFHIPTCISTTDTLPTWLKPFTKNNDENL 283

Query: 94  RDVLAGLVLV 103
             +L G  L+
Sbjct: 284 LKILDGFELL 293

>YPL221W (YPL221W) [5228] chr16 (133042..135423) Protein of unknown
           function, has high similarity to uncharacterized S.
           cerevisiae Ygl139p [2382 bp, 793 aa]
          Length = 793

 Score = 31.2 bits (69), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 29/121 (23%), Positives = 58/121 (47%), Gaps = 25/121 (20%)

Query: 34  DQAEVISDLFGISFK-DDQRIHHDLEWTTK---YYSVKIDLYIDSFDSLRD--------W 81
           + +++ ++ F +SF  DD+ +H+DL+ TT+   Y    +D+Y   F  + +        W
Sbjct: 36  ENSQLSANSFDVSFSPDDRSLHYDLDMTTQIDSYIYAYVDVYAYGFKIITENFDVCSMGW 95

Query: 82  VQQFC-----NSECDELRDVLAGLVLVVPC---KVEDAD----LETFTQLADCMADAESF 129
            +QFC     N + D +  +    V ++P    +V D D    L  +  +++ +A  + F
Sbjct: 96  -KQFCPVHPGNIQIDSIEYIAQKYVKMIPGIAYQVPDIDAYVRLNIYNNVSENLACIQVF 154

Query: 130 F 130
           F
Sbjct: 155 F 155

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.134    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,481,116
Number of extensions: 316327
Number of successful extensions: 929
Number of sequences better than 10.0: 15
Number of HSP's gapped: 920
Number of HSP's successfully gapped: 15
Length of query: 247
Length of database: 16,596,109
Length adjustment: 99
Effective length of query: 148
Effective length of database: 13,168,927
Effective search space: 1949001196
Effective search space used: 1949001196
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 60 (27.7 bits)