Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_47.1920323523311171e-157
Sklu_2433.152101955382e-69
YFR042W2001945164e-66
Scas_687.172222005107e-65
AFR247W2112064123e-50
CAGL0C02101g1971923982e-48
KLLA0A01111g2092133862e-46
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_47.19203
         (233 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_47.19203                                                         434   e-157
Sklu_2433.15 YFR042W, Contig c2433 24495-25127 reverse complement     211   2e-69
YFR042W (YFR042W) [1724] chr6 (238445..239047) Protein of unknow...   203   4e-66
Scas_687.17                                                           201   7e-65
AFR247W [3439] [Homologous to ScYFR042W - SH] complement(884059....   163   3e-50
CAGL0C02101g complement(214712..215305) similar to sp|P43614 Sac...   157   2e-48
KLLA0A01111g complement(102802..103431) similar to sp|P43614 Sac...   153   2e-46

>Kwal_47.19203
          Length = 235

 Score =  434 bits (1117), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 213/233 (91%), Positives = 213/233 (91%)

Query: 1   MVFTRICNKQPRRSFKFIMANKKQETRSANIPANPGTSALKSRLYQYFRXXXXXXFAALV 60
           MVFTRICNKQPRRSFKFIMANKKQETRSANIPANPGTSALKSRLYQYFR      FAALV
Sbjct: 1   MVFTRICNKQPRRSFKFIMANKKQETRSANIPANPGTSALKSRLYQYFRLSSSLLFAALV 60

Query: 61  ARWAVLFPLVGSKFLPGGIHEFLCYLMLYAGFFEIVWTYAFRGFKRTLLSRTLLKDVSFL 120
           ARWAVLFPLVGSKFLPGGIHEFLCYLMLYAGFFEIVWTYAFRGFKRTLLSRTLLKDVSFL
Sbjct: 61  ARWAVLFPLVGSKFLPGGIHEFLCYLMLYAGFFEIVWTYAFRGFKRTLLSRTLLKDVSFL 120

Query: 121 YWVGILHFYDDYEHALVLKNISYSTFIVTLGLSQTYCHWCKLFKSPSKNRNTILWKIDTF 180
           YWVGILHFYDDYEHALVLKNISYSTFIVTLGLSQTYCHWCKLFKSPSKNRNTILWKIDTF
Sbjct: 121 YWVGILHFYDDYEHALVLKNISYSTFIVTLGLSQTYCHWCKLFKSPSKNRNTILWKIDTF 180

Query: 181 LTXXXXXXXXXXXXXXNVQTPNFHSYHWLEIVNKVVLIIFIPISLHAFRKQLS 233
           LT              NVQTPNFHSYHWLEIVNKVVLIIFIPISLHAFRKQLS
Sbjct: 181 LTLPILYLSEFYLLLLNVQTPNFHSYHWLEIVNKVVLIIFIPISLHAFRKQLS 233

>Sklu_2433.15 YFR042W, Contig c2433 24495-25127 reverse complement
          Length = 210

 Score =  211 bits (538), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 105/195 (53%), Positives = 131/195 (67%)

Query: 39  ALKSRLYQYFRXXXXXXFAALVARWAVLFPLVGSKFLPGGIHEFLCYLMLYAGFFEIVWT 98
            + SRLYQY+R      FAAL+ARW VL PLVG+KFLPGGIHE+LCYL+LYA F E+   
Sbjct: 14  GIVSRLYQYYRLSASFLFAALLARWLVLLPLVGTKFLPGGIHEYLCYLILYASFGELFCL 73

Query: 99  YAFRGFKRTLLSRTLLKDVSFLYWVGILHFYDDYEHALVLKNISYSTFIVTLGLSQTYCH 158
           + F G    L S TLLK+++ LY+V ++HFYDDYEHA VLKN SYS+FI+ L  +Q YCH
Sbjct: 74  FGFHGLFGALTSSTLLKNLNMLYFVAVMHFYDDYEHAPVLKNSSYSSFIIGLSFTQMYCH 133

Query: 159 WCKLFKSPSKNRNTILWKIDTFLTXXXXXXXXXXXXXXNVQTPNFHSYHWLEIVNKVVLI 218
           W KLFK     +N+I  K+DT                 NVQ PNFHS   L+ +NK VL+
Sbjct: 134 WKKLFKHTHGRKNSIWRKVDTLAMMPLFYLSEFYLFLLNVQNPNFHSTLLLDRLNKFVLV 193

Query: 219 IFIPISLHAFRKQLS 233
            FIP+SLH F+KQ+S
Sbjct: 194 AFIPLSLHMFKKQIS 208

>YFR042W (YFR042W) [1724] chr6 (238445..239047) Protein of unknown
           function [603 bp, 200 aa]
          Length = 200

 Score =  203 bits (516), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 100/194 (51%), Positives = 135/194 (69%)

Query: 40  LKSRLYQYFRXXXXXXFAALVARWAVLFPLVGSKFLPGGIHEFLCYLMLYAGFFEIVWTY 99
           L  +LYQY++      +AAL+ RW +L PLVGS+FLPGGIHEFL YLM Y+   E++W  
Sbjct: 6   LTHKLYQYYQLATSFLYAALLIRWLILMPLVGSRFLPGGIHEFLIYLMFYSSIMEVIWLL 65

Query: 100 AFRGFKRTLLSRTLLKDVSFLYWVGILHFYDDYEHALVLKNISYSTFIVTLGLSQTYCHW 159
            F GFK  LLSRT LKD++F+Y V ++HFYDDYEHAL+LKN SYS+FI++L LSQ YCHW
Sbjct: 66  RFHGFKYGLLSRTFLKDLNFIYLVSVIHFYDDYEHALILKNASYSSFIISLSLSQAYCHW 125

Query: 160 CKLFKSPSKNRNTILWKIDTFLTXXXXXXXXXXXXXXNVQTPNFHSYHWLEIVNKVVLII 219
           CKLFK       T++WK++TF+T              N+Q  N+HS   L+I+N+VVL+ 
Sbjct: 126 CKLFKRKGVKERTLVWKVNTFVTLPILYLSEFALLLLNIQVKNYHSTPTLDIINRVVLLA 185

Query: 220 FIPISLHAFRKQLS 233
           + P+ L A++K L+
Sbjct: 186 YFPVLLTAYKKLLT 199

>Scas_687.17
          Length = 222

 Score =  201 bits (510), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 102/200 (51%), Positives = 139/200 (69%), Gaps = 1/200 (0%)

Query: 32  PANPGTSALKSRLYQYFRXXXXXXFAALVARWAVLFPLVGSKFLPGGIHEFLCYLMLYAG 91
           P  P T  +  +LYQY++      FAAL+ARW ++FPL G++FLPGG+HEFLCYLM+YA 
Sbjct: 21  PIEPKTPFIY-KLYQYYQLSTSFLFAALLARWLIIFPLAGARFLPGGVHEFLCYLMIYAS 79

Query: 92  FFEIVWTYAFRGFKRTLLSRTLLKDVSFLYWVGILHFYDDYEHALVLKNISYSTFIVTLG 151
             EI+W + F   K  + S+TLLKD++F+Y+V +LHFYDDYEHALVLKNISYS FI+ L 
Sbjct: 80  VGEIIWLFKFYPLKSVIFSKTLLKDLNFIYFVLVLHFYDDYEHALVLKNISYSVFIIGLS 139

Query: 152 LSQTYCHWCKLFKSPSKNRNTILWKIDTFLTXXXXXXXXXXXXXXNVQTPNFHSYHWLEI 211
           L+Q Y HWCKLFK   + +NT+++K++  L               NVQ PNFHS   L+I
Sbjct: 140 LNQAYHHWCKLFKRSGRKKNTLVFKVNNLLGSPLLYLSEYYLLLLNVQNPNFHSTPLLDI 199

Query: 212 VNKVVLIIFIPISLHAFRKQ 231
           +N+++LII+ PI+L  +R Q
Sbjct: 200 INRIILIIYFPIALAVYRNQ 219

>AFR247W [3439] [Homologous to ScYFR042W - SH]
           complement(884059..884694) [636 bp, 211 aa]
          Length = 211

 Score =  163 bits (412), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 88/206 (42%), Positives = 129/206 (62%), Gaps = 3/206 (1%)

Query: 30  NIPANPG--TSALKSRLYQYFRXXXXXXFAALVARWAVLFPLVGSKFLPGGIHEFLCYLM 87
            IP  P    +++ SR YQ++R      +AALVARW  LFPLVG++++PGGIH FL YL+
Sbjct: 6   GIPGKPAHTPNSMVSRAYQFYRLSCMFLYAALVARWLALFPLVGTRWVPGGIHGFLIYLL 65

Query: 88  LYAGFFEIVWTYAFRGFKRTLLSRTLLKDVSFLYWVGILHFYDDYEHALVLKNISYSTFI 147
             +   E++W   F  F + L +RTLLK  + LY+V ++HFYDDYEHA VLKNI YS FI
Sbjct: 66  GGSAVLEVLWMIWFYRFTKGLWTRTLLKCANMLYFVAVMHFYDDYEHAPVLKNIGYSIFI 125

Query: 148 VTLGLSQTYCHWCKLFKSPSKNRNTILWKIDTFLTXXXXXXXXXXXXXXNVQTPNFHSYH 207
           +++G++Q   H  +LF+   + R+      DTF+               NVQ P+FHS  
Sbjct: 126 LSIGMNQALHHGGRLFRGRRRRRSWWWRS-DTFVLQPALYISQFYLLLLNVQNPSFHSTP 184

Query: 208 WLEIVNKVVLIIFIPISLHAFRKQLS 233
            L+I+N+ VL+ ++P++L  FR+QL+
Sbjct: 185 KLDIINRTVLVAYVPLALQCFRRQLT 210

>CAGL0C02101g complement(214712..215305) similar to sp|P43614
           Saccharomyces cerevisiae YFR042w, hypothetical start
          Length = 197

 Score =  157 bits (398), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 82/192 (42%), Positives = 121/192 (63%), Gaps = 2/192 (1%)

Query: 43  RLYQYFRXXXXXXFAALVARWAVLFPLVGSKFLPGGIHEFLCYLMLYAGFFEIVWTYAFR 102
           +L+Q ++      + AL  RW VL PLVGS++LPGGIHE+LCYL++    FE++W+  F 
Sbjct: 5   KLFQLYQLQTTLLYLALFGRWLVLMPLVGSRYLPGGIHEYLCYLLVIVSVFEVLWSLYFH 64

Query: 103 GFKRTLLSRTLLKDVSFLYWVGILHFYDDYEHALVLKNISYSTFIVTLGLSQTYCHWCKL 162
           G  R  +S+ +LK +++LY V  LHFYDDYEHA +LK  +YSTFI+ + L ++Y HWC+L
Sbjct: 65  GL-RGFISQRVLKSLNYLYLVLNLHFYDDYEHAPLLKTSAYSTFIIGVSLVESYQHWCRL 123

Query: 163 FK-SPSKNRNTILWKIDTFLTXXXXXXXXXXXXXXNVQTPNFHSYHWLEIVNKVVLIIFI 221
           FK  P+  R T  WK  +++               N Q PN H+   LE+VN VVLI++ 
Sbjct: 124 FKRGPNYKRETRYWKFISYVMLPCLYLSEFVLLLLNRQLPNHHTTEQLELVNTVVLILYF 183

Query: 222 PISLHAFRKQLS 233
           P++L  +++ L 
Sbjct: 184 PMALTVYKRHLQ 195

>KLLA0A01111g complement(102802..103431) similar to sp|P43614
           Saccharomyces cerevisiae YFR042w hypothetical protein
           singleton, start by similarity
          Length = 209

 Score =  153 bits (386), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 79/213 (37%), Positives = 121/213 (56%), Gaps = 14/213 (6%)

Query: 20  ANKKQETRSANIPANPGTSALKSRLYQYFRXXXXXXFAALVARWAVLFPLVGSKFLPGGI 79
           A ++Q+ R            L  +LYQ+F       + AL+ RW VL PLV  K+LPGGI
Sbjct: 3   ATRRQQPRR-----------LVVKLYQFFHISSAFLYCALLVRWLVLLPLVSRKYLPGGI 51

Query: 80  HEFLCYLMLYAGFFEIVWTYAFRGFKRTLLSRTLLKDVSFLYWVGILHFYDDYEHALVLK 139
           H FLC LM+Y+    I+W    RG   ++ +R  LK+++ +Y V ILHFYDD+EH+ +LK
Sbjct: 52  HRFLCCLMVYSAVGNILWWIKMRGLAWSIFNRHNLKNINLIYLVAILHFYDDFEHSPLLK 111

Query: 140 NISYSTFIVTLGLSQTYCHWCKLFKSPS---KNRNTILWKIDTFLTXXXXXXXXXXXXXX 196
           N SYS+FIV L  +Q Y HW ++FK PS   ++  ++  +++ F+               
Sbjct: 112 NTSYSSFIVGLSFTQMYYHWNRIFKGPSPEPRSSKSLASRLNAFIMIPLLYLSEFYLLLL 171

Query: 197 NVQTPNFHSYHWLEIVNKVVLIIFIPISLHAFR 229
           N +  N+H+     + NK VL++FIP+ LH ++
Sbjct: 172 NTEIDNYHNGPKTVLFNKFVLVVFIPLCLHLYK 204

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.330    0.141    0.459 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 6,920,533
Number of extensions: 259516
Number of successful extensions: 652
Number of sequences better than 10.0: 9
Number of HSP's gapped: 646
Number of HSP's successfully gapped: 9
Length of query: 233
Length of database: 16,596,109
Length adjustment: 98
Effective length of query: 135
Effective length of database: 13,203,545
Effective search space: 1782478575
Effective search space used: 1782478575
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 60 (27.7 bits)