Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_47.1918471265028450.0
Sklu_2433.186272597315e-87
AFR244C5722506201e-71
KLLA0A01177g6362816065e-69
Scas_712.226242785401e-59
YGL228W (SHE10)5772934842e-52
CAGL0I04092g5562713695e-37
Scas_687.205712443332e-32
YFR039C5102232992e-28
CAGL0C02167g4802882469e-22
YIL144W (TID3)691151770.44
Scas_721.22868107702.5
Kwal_26.706337865675.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_47.19184
         (702 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_47.19184                                                        1100   0.0  
Sklu_2433.18 YGL228W, Contig c2433 29391-31274                        286   5e-87
AFR244C [3436] [Homologous to ScYGL228W (SHE10) - SH; ScYFR039C ...   243   1e-71
KLLA0A01177g 108738..110648 some similarities with sp|P53075 Sac...   238   5e-69
Scas_712.22                                                           212   1e-59
YGL228W (SHE10) [1770] chr7 (67597..69330) Protein of unknown fu...   191   2e-52
CAGL0I04092g 358219..359889 weakly similar to sp|P53075 Saccharo...   146   5e-37
Scas_687.20                                                           132   2e-32
YFR039C (YFR039C) [1721] chr6 complement(231999..233531) Protein...   119   2e-28
CAGL0C02167g 220619..222061 weakly similar to sp|P43611 Saccharo...    99   9e-22
YIL144W (TID3) [2533] chr9 (78074..80149) Component of the Tid3p...    34   0.44 
Scas_721.22                                                            32   2.5  
Kwal_26.7063                                                           30   5.4  

>Kwal_47.19184
          Length = 712

 Score = 1100 bits (2845), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 552/650 (84%), Positives = 552/650 (84%)

Query: 1   MRVSRXXXXXXXXXXXXXQQASRYCQRQDASFCQYTSLSRMSPWWAANGAPVWEREVAGR 60
           MRVSR             QQASRYCQRQDASFCQYTSLSRMSPWWAANGAPVWEREVAGR
Sbjct: 1   MRVSRGLLITILVVVLGIQQASRYCQRQDASFCQYTSLSRMSPWWAANGAPVWEREVAGR 60

Query: 61  VERWSAAAHEYEKRVEAWAEPRVQQGWAWSRDVVETHVVPTVYKWSKLAQLKVQLWYNVY 120
           VERWSAAAHEYEKRVEAWAEPRVQQGWAWSRDVVETHVVPTVYKWSKLAQLKVQLWYNVY
Sbjct: 61  VERWSAAAHEYEKRVEAWAEPRVQQGWAWSRDVVETHVVPTVYKWSKLAQLKVQLWYNVY 120

Query: 121 VMPRVKHFQYRVQRWVASNTYAQRFLARIQWAVAETRVVVTWLTQQVARVLEQAPIVVRD 180
           VMPRVKHFQYRVQRWVASNTYAQRFLARIQWAVAETRVVVTWLTQQVARVLEQAPIVVRD
Sbjct: 121 VMPRVKHFQYRVQRWVASNTYAQRFLARIQWAVAETRVVVTWLTQQVARVLEQAPIVVRD 180

Query: 181 LLKSISSRKSRVXXXXXXXXXXXXXXFTIIVEELPXXXXXXXXXXXXXXXXTIIETVTIS 240
           LLKSISSRKSRV              FTIIVEELP                TIIETVTIS
Sbjct: 181 LLKSISSRKSRVENNLEEENNLEEENFTIIVEELPSDDEYDDDDETLYLTSTIIETVTIS 240

Query: 241 DANELEKPTASSSHEDDASLEVPLRDLVQDEFEAWSTAVQQKASNTLSQFDAEIQDLVDS 300
           DANELEKPTASSSHEDDASLEVPLRDLVQDEFEAWSTAVQQKASNTLSQFDAEIQDLVDS
Sbjct: 241 DANELEKPTASSSHEDDASLEVPLRDLVQDEFEAWSTAVQQKASNTLSQFDAEIQDLVDS 300

Query: 301 KLSEIRPNVTTLLQSISDSCQAYYRDINKAILDVDCNMELDPVTGEQLYFNRDGTQLRKY 360
           KLSEIRPNVTTLLQSISDSCQAYYRDINKAILDVDCNMELDPVTGEQLYFNRDGTQLRKY
Sbjct: 301 KLSEIRPNVTTLLQSISDSCQAYYRDINKAILDVDCNMELDPVTGEQLYFNRDGTQLRKY 360

Query: 361 MTRPLMREYFSAAHAHVEERLEFVRAQLEKFVAMVNKEVDEIRQESLELYEEWGDVMISE 420
           MTRPLMREYFSAAHAHVEERLEFVRAQLEKFVAMVNKEVDEIRQESLELYEEWGDVMISE
Sbjct: 361 MTRPLMREYFSAAHAHVEERLEFVRAQLEKFVAMVNKEVDEIRQESLELYEEWGDVMISE 420

Query: 421 WSKRMAYGDIFHAIGSDSFDQQQHDNWKQFLKLKKRVVATRDQLMQHPAKLQALDTFLRD 480
           WSKRMAYGDIFHAIGSDSFDQQQHDNWKQFLKLKKRVVATRDQLMQHPAKLQALDTFLRD
Sbjct: 421 WSKRMAYGDIFHAIGSDSFDQQQHDNWKQFLKLKKRVVATRDQLMQHPAKLQALDTFLRD 480

Query: 481 IQFTLSALQRDAGEYLFILRSQANLAFQTXXXXXXXXXXXXXXXXXXXXXXXXXVELAER 540
           IQFTLSALQRDAGEYLFILRSQANLAFQT                         VELAER
Sbjct: 481 IQFTLSALQRDAGEYLFILRSQANLAFQTREKQEREREEEERARLQREQQKRAEVELAER 540

Query: 541 KXXXXXXXXXXXXXXXXXXXXSVETTESLFAVEDAFSQDTEEDSAYDTALXXXXXXXXXX 600
           K                    SVETTESLFAVEDAFSQDTEEDSAYDTAL          
Sbjct: 541 KAREEHERQLQRAREEELERASVETTESLFAVEDAFSQDTEEDSAYDTALESEDDEASSS 600

Query: 601 GYQTASEYGDDETSSSGYQTASEDADEDTIVQEFQDANEFYNDSEFYDIH 650
           GYQTASEYGDDETSSSGYQTASEDADEDTIVQEFQDANEFYNDSEFYDIH
Sbjct: 601 GYQTASEYGDDETSSSGYQTASEDADEDTIVQEFQDANEFYNDSEFYDIH 650

>Sklu_2433.18 YGL228W, Contig c2433 29391-31274
          Length = 627

 Score =  286 bits (731), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 136/259 (52%), Positives = 191/259 (73%), Gaps = 3/259 (1%)

Query: 249 TASSSHEDDASLEVPLRDLVQDEFEAWSTAVQQKASNTLSQFDAEIQDLVDSKLSEIRPN 308
           TA+S  E+D+SL+VPL+DLVQ+E++AWS  V++KA+  L  F  E+ D    +L  + P 
Sbjct: 255 TAASREEEDSSLDVPLKDLVQNEYQAWSNTVERKANTALDAFTKEVHDYEIEQLESVSPL 314

Query: 309 VTTLLQSISDSCQAYYRDINKAILDVDCNMELDPVTGEQLYFNRDGTQLRKYMTRPLMRE 368
           +++LLQ+IS++ Q +++ INKAILD++C ME+    GEQL+F+R GTQL++Y+TRPLMR 
Sbjct: 315 MSSLLQNISNTTQLHFQKINKAILDINCTMEIGE-NGEQLFFDRHGTQLKEYITRPLMRG 373

Query: 369 YFSAAHAHVEERLEFVRAQLEKFVAMVNKEVDEIRQESLELYEEWGDVMISEWSKRMAYG 428
            F+AA+  +    + +RA+L++FV  VN  VD IR E LE+YEEWGDVMISEWSKRMAY 
Sbjct: 374 LFTAANEELTAMSDDLRARLKEFVNTVNDHVDVIRNEHLEVYEEWGDVMISEWSKRMAYV 433

Query: 429 DIFHAIGSDSFDQQQHDNWKQFLKLKKRVVATRDQLMQHPAKLQALDTFLRDIQFTLSAL 488
           D+      D  D +QH NWK FLKLK+ V+ TRD L++HP K   L+ FL+++QFTL  L
Sbjct: 434 DVVALDEQD--DSEQHSNWKNFLKLKRNVIKTRDLLVEHPVKFHDLEVFLKEVQFTLRML 491

Query: 489 QRDAGEYLFILRSQANLAF 507
            +++GEYL+ILRS+ANL F
Sbjct: 492 AKESGEYLYILRSKANLTF 510

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 23/91 (25%), Positives = 40/91 (43%)

Query: 39  SRMSPWWAANGAPVWEREVAGRVERWSAAAHEYEKRVEAWAEPRVQQGWAWSRDVVETHV 98
           +R+ PWW     P   +  A  V        + +        P+++      RD  ET +
Sbjct: 61  ARVYPWWGEKVTPHLNKANAAYVSNVVPHLGKLKSNYRTVVAPKLRSLAIKVRDYFETTI 120

Query: 99  VPTVYKWSKLAQLKVQLWYNVYVMPRVKHFQ 129
            P  YK       K+QL+Y+++++PR KH +
Sbjct: 121 FPQCYKAYHTIAFKIQLYYHIFIVPRAKHIK 151

>AFR244C [3436] [Homologous to ScYGL228W (SHE10) - SH; ScYFR039C -
           SH] (877997..879715) [1719 bp, 572 aa]
          Length = 572

 Score =  243 bits (620), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 120/250 (48%), Positives = 169/250 (67%), Gaps = 4/250 (1%)

Query: 260 LEVPLRDLVQDEFEAWSTAVQQKASNTLSQFDAEIQDLVDSKLSEIRPNVTTLLQSISDS 319
           +E   +DLV DEF AW  A+++KA + L  F  E+ +    +   + P    LL+ IS  
Sbjct: 240 VEASFKDLVADEFSAWQQAIERKADSVLQAFTEEVGEFEMQQHEAVAPKFRALLKHISAK 299

Query: 320 CQAYYRDINKAILDVDCNMELDPVTGEQLYFNRDGTQLRKYMTRPLMREYFSAAHAHVEE 379
            Q +Y  IN+AI D++  MELDP T + ++F+  GTQL +Y+TRPLMREYFS A+  +  
Sbjct: 300 SQEHYAKINQAIRDINSTMELDPATNQTIWFDAHGTQLHQYITRPLMREYFSQANDELAN 359

Query: 380 RLEFVRAQLEKFVAMVNKEVDEIRQESLELYEEWGDVMISEWSKRMAYGDIFHAIGSD-S 438
               +RA+L + V  VN +VD IRQE +E+YEEW DVM+SEWS+RMAY D+   +  D  
Sbjct: 360 ITNHIRAELREVVDSVNGQVDVIRQEHIEVYEEWADVMVSEWSRRMAYIDV---VDRDLE 416

Query: 439 FDQQQHDNWKQFLKLKKRVVATRDQLMQHPAKLQALDTFLRDIQFTLSALQRDAGEYLFI 498
            + +++ NWK+FLKLKKRV+  RDQL++HP K   L+TFL++IQ TL  L ++ GEYL+I
Sbjct: 417 AEAERNRNWKRFLKLKKRVIKVRDQLLEHPVKFNQLETFLKEIQSTLRILAQENGEYLYI 476

Query: 499 LRSQANLAFQ 508
           LRS+ANL+FQ
Sbjct: 477 LRSKANLSFQ 486

>KLLA0A01177g 108738..110648 some similarities with sp|P53075
           Saccharomyces cerevisiae YGL228w SHE10, hypothetical
           start
          Length = 636

 Score =  238 bits (606), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 118/281 (41%), Positives = 185/281 (65%), Gaps = 6/281 (2%)

Query: 232 TIIETVTISDANELE-KPTASSSHEDDASLEVPLRDLVQDEFEAWSTAVQQKASNTLSQF 290
           TI+ TVT +  + L+ K T S+S       ++ + ++++++F +W   ++ K SNT+  F
Sbjct: 279 TIVLTVTQTANSALDLKATPSASGLIVDECDMSMEEMLRNDFMSWKITIENKLSNTMKDF 338

Query: 291 DAEIQDLVDSKLSEIRPNVTTLLQSISDSCQAYYRDINKAILDVDCNMELDPVTGEQLYF 350
           + +I +    KL  I+P +  LL+  S++ Q  ++ I KAI+DV+C   +DP T + ++F
Sbjct: 339 ENDINEFAQEKLDHIQPTLADLLKRASNTSQTNFQIITKAIMDVNCTESVDPKTNKTIWF 398

Query: 351 NRDGTQLRKYMTRPLMREYFSAAHAHVEERLEFVRAQLEKFVAMVNKEVDEIRQESLELY 410
           +++ TQL KYMTR LMREYFSAAH+  +   + +RA L K    VN  V+ +RQE++EL+
Sbjct: 399 DQNNTQLPKYMTRELMREYFSAAHSQFDALSQEIRAHLRKLADEVNDHVEVLRQENVELF 458

Query: 411 EEWGDVMISEWSKRMAYGDIFHAIGSDS---FDQQQHDNWKQFLKLKKRVVATRDQLMQH 467
           EEW DVMI+EWSK +AY D+  A+  +     +++Q  NWK F+KLK++V+ TRD LM+H
Sbjct: 459 EEWADVMITEWSKNLAYVDV--AVNEEKLADLEKEQRKNWKDFMKLKRQVIKTRDTLMEH 516

Query: 468 PAKLQALDTFLRDIQFTLSALQRDAGEYLFILRSQANLAFQ 508
           P KL +L +F+  +Q +L  L  + GEYL+ILRS+ANL FQ
Sbjct: 517 PVKLDSLQSFVNTVQQSLKTLSHENGEYLYILRSKANLEFQ 557

>Scas_712.22
          Length = 624

 Score =  212 bits (540), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 106/278 (38%), Positives = 173/278 (62%), Gaps = 5/278 (1%)

Query: 236 TVTISDANELEKPTASSSHEDDASLEVPLRDLVQDEFEAWSTAVQQKASNTLSQFDAEIQ 295
           TVT +         A++S E    L+V  + L+Q +F+ WS  ++QK ++    FD ++ 
Sbjct: 250 TVTSTIVKNWPGKVATTSGEAVKDLDVDEQQLLQSDFDNWSNTIEQKIASINKLFDKDVA 309

Query: 296 DLVDSKLSEIRPNVTTLLQSISDSCQAYYRDINKAILDVDCNMELDPVTGEQLYFNRDG- 354
            L+  ++          +Q+++   +  ++D+NKAI D++C   LDP T E +YF+R+G 
Sbjct: 310 KLIKKEMKSNEQKFKDKIQNLNQESELLFQDLNKAIQDINCTESLDPQTNETIYFDRNGE 369

Query: 355 TQLRKYMTRPLMREYFSAAHAHVEERLEFVRAQLEKFVAMVNKEVDEIRQESLELYEEWG 414
           TQL +Y+ RPL+RE F    A + E +  ++      +  VNK+V+ IR E L++YEEWG
Sbjct: 370 TQLEQYIERPLIRELFEKTRATLNELIADIQNDENVLIEKVNKKVESIRDEHLDVYEEWG 429

Query: 415 DVMISEWSKRMAYGDI----FHAIGSDSFDQQQHDNWKQFLKLKKRVVATRDQLMQHPAK 470
           ++M++EWSKRMAY D+     +A   ++      +NWK+FLK+KK+V+  RD+L++H   
Sbjct: 430 EIMVNEWSKRMAYVDVVAAHLNAEEKEAKKTMSEENWKKFLKVKKQVIGARDELVEHVPN 489

Query: 471 LQALDTFLRDIQFTLSALQRDAGEYLFILRSQANLAFQ 508
           ++ ++ FL +IQ TL  L +DAGEYL+ILR++ANLAFQ
Sbjct: 490 IKTMEQFLNNIQETLKMLSKDAGEYLYILRARANLAFQ 527

>YGL228W (SHE10) [1770] chr7 (67597..69330) Protein of unknown
           function, has weak similarity to uncharacterized S.
           cerevisiae Yfr039p [1734 bp, 577 aa]
          Length = 577

 Score =  191 bits (484), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 98/293 (33%), Positives = 184/293 (62%), Gaps = 18/293 (6%)

Query: 232 TIIETVTISDANELEKPTASSSHEDDAS--------LEVPLRDLVQDEFEAWSTAVQQKA 283
           T++ET+T+    E     A+ +H+D+AS        + V  + L+Q++F+ WS  + QK 
Sbjct: 233 TVVETITLD--QEEASAVANHAHDDEASTDVEGSTDVNVNEQALLQEDFDMWSETILQKT 290

Query: 284 SNTLSQFDAEIQDLVDSKLSEIRPNVTTLLQSISDSCQAYYRDINKAILDVDCNMELDPV 343
            + +  F+ ++   ++ KL E   +     QS+ D  + ++  I+ AI D++C   +D  
Sbjct: 291 QDVIQLFEKDVSKYINGKLVEEANHFKAKFQSLDDKSKKFFSKISLAINDIECVEGIDSE 350

Query: 344 TGEQLYFNRDG-TQLRKYMTRPLMREYFSAAHAHVEERLEFVRAQLEKFVAMVNKEVDEI 402
           TG++++F++ G T++ +Y+TR L+REYF+   + ++E    +   L +    + K+V+ I
Sbjct: 351 TGKKIFFDKSGSTEISQYITRELVREYFNETRSTLDELTNAMEKDLSEITDEIEKKVNAI 410

Query: 403 RQESLELYEEWGDVMISEWSKRMAYGDIFHA-IGSD---SFDQQQHD---NWKQFLKLKK 455
           R+E++E++EEWGD++++EWSKRMAY D+ +A +G+D   + D+++     NWK+FLK KK
Sbjct: 411 REENVEVFEEWGDIIVNEWSKRMAYVDVINAHMGADDDTTLDEEKAKSSVNWKKFLKGKK 470

Query: 456 RVVATRDQLMQHPAKLQALDTFLRDIQFTLSALQRDAGEYLFILRSQANLAFQ 508
           +++ +RD+L  H A L  ++ F + +Q  + +  +++GE+L+ILRS+ANL FQ
Sbjct: 471 QIIESRDKLAHHSADLSRVNAFRQKVQKKILSFTQESGEFLYILRSKANLQFQ 523

>CAGL0I04092g 358219..359889 weakly similar to sp|P53075
           Saccharomyces cerevisiae YGL228w SHE10, start by
           similarity
          Length = 556

 Score =  146 bits (369), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 80/271 (29%), Positives = 145/271 (53%), Gaps = 10/271 (3%)

Query: 246 EKPTASSSHEDDASLEVPLRDLVQDEFEAWSTAVQQKASNTLSQFDAEIQDLVDSKLSEI 305
           EK   +   ED   +E+  +  +Q +F+ W++ + +K          +++  +  K+   
Sbjct: 251 EKNLETKEEEDITDIEIDHQAQLQRDFDKWTSNIDKKVKMVNKMLVRDVKKHLKPKIDAN 310

Query: 306 RPNVTTLLQSISDSCQAYYRDINKAILDVDCNMELDPVTGEQLYFNRDG-TQLRKYMTRP 364
                  L+ +       ++ INKAI D++C   +DP TG+Q+YF+ +G +Q+ KY+TR 
Sbjct: 311 DKLFKDKLKVLHKEANDNFQLINKAIQDINCTQGIDPETGKQIYFDSEGKSQIEKYITRE 370

Query: 365 LMREYFSAAHAHVEERLEFVRAQLEKFVAMVNKEVDEIRQESLELYEEWGDVMISEWSKR 424
           ++R   +     +   +  +   + K +    K  +  R++ L  +EEWGD+MI+EWSK+
Sbjct: 371 MIRTMLNDTQTTLNSLVADIENDVSKILEDFKKIAENSREQHLTTFEEWGDIMINEWSKK 430

Query: 425 MAYGDIF-------HAIGSDSFDQQQHDNWKQFLKLKKRVVATRDQLMQHPAKLQALDTF 477
           +AY D+        H   S +  +    NWK+F+ +KK+++  RD++ +   K+      
Sbjct: 431 LAYLDVLAPHEDAEHEGKSKT--ELSEKNWKKFMAIKKQILDARDKMAKRQIKISEFKLL 488

Query: 478 LRDIQFTLSALQRDAGEYLFILRSQANLAFQ 508
           L ++Q TL A+  + GEYL+ILR+QANLAFQ
Sbjct: 489 LDNVQNTLQAVTNENGEYLYILRAQANLAFQ 519

>Scas_687.20
          Length = 571

 Score =  132 bits (333), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 79/244 (32%), Positives = 131/244 (53%), Gaps = 4/244 (1%)

Query: 268 VQDEFEAWSTAVQQKASNTLSQFDAEIQDLVDSKLSEIRPNVTTLLQSISDSCQAYYRDI 327
           + +EF AW  AV+ K+SN L  F  EI+  ++ +       +   L ++ +  ++    I
Sbjct: 259 LNNEFNAWINAVEGKSSNALLAFQDEIERSIEREGEYFTNEMEIRLNNLKNEIESQIDKI 318

Query: 328 NKAILDVDCNMELDPVTGEQLYFNRDGT-QLRKYMTRPLMREYFSAAHAHVEE-RLEFVR 385
            K I D+DC  + DP + E +YF+ +GT ++ +Y++RPLM   F  AH  ++E R E   
Sbjct: 319 EKYIQDIDCISKYDPSSNELVYFDSNGTRKILEYVSRPLMDSIFLKAHFQIDEFRNEMED 378

Query: 386 AQLEKFVAMVNKEVDEIRQESLELYEEWGDVMISEWSKRMAYGDIFHA--IGSDSFDQQQ 443
             +  F+  +  +++ I QE++E+YEEWGD+MISEWS+RMA  D+     +  D   +Q 
Sbjct: 379 TVINPFIYSMQYKLETIHQENVEVYEEWGDIMISEWSRRMAQFDVVSGQLLDDDPLFEQS 438

Query: 444 HDNWKQFLKLKKRVVATRDQLMQHPAKLQALDTFLRDIQFTLSALQRDAGEYLFILRSQA 503
              W++FL LK  VV  RD L        AL+  + + +  L  +  +A      L  +A
Sbjct: 439 AKKWQRFLDLKHEVVEMRDTLYYSEPDSTALEGIISNARIKLEEIIDEANNQFEALGKKA 498

Query: 504 NLAF 507
           ++AF
Sbjct: 499 DVAF 502

>YFR039C (YFR039C) [1721] chr6 complement(231999..233531) Protein of
           unknown function, has weak similarity to uncharacterized
           S. cerevisiae She10p [1533 bp, 510 aa]
          Length = 510

 Score =  119 bits (299), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 68/223 (30%), Positives = 125/223 (56%), Gaps = 8/223 (3%)

Query: 250 ASSSHEDDASLEVPLRDLVQDEFEAWSTAVQQKASNTLSQFDAEIQDLVDSKLSEIRPNV 309
            S+SH   A LE    + ++ E+EAW  A+  K  + ++  D+EIQ + ++++      +
Sbjct: 233 GSNSH---AELETYEAESLKMEYEAWIKAIDSKIHSAMALLDSEIQSVFEAEVQNKSIEI 289

Query: 310 TTLLQSISDSCQAYYRDINKAILDVDCNMELDPVTGEQLYFNRDG-TQLRKYMTRPLMRE 368
           T  L  ++ +       ++  I D++C  + DPV  +  YF+  G  +L  Y+T+  +  
Sbjct: 290 TRNLDDLNTTVNEQLVFLDSKIKDINCTSKFDPVQNKIKYFDESGQVELEAYITKSSITS 349

Query: 369 YFSAAHAHVEERLEFVRAQLEKFVAMVNKEVDEIRQESLELYEEWGDVMISEWSKRMAYG 428
                  H+ +  + +   L+ F+  + K  + IR E++E+YEEWGDVMIS+WS+RMAY 
Sbjct: 350 ILKNYKIHLLDFEKSLFHSLDSFLTEMAKLAESIRLENVEVYEEWGDVMISQWSQRMAYM 409

Query: 429 DIFHAIGSDSFD----QQQHDNWKQFLKLKKRVVATRDQLMQH 467
           D+      D +D    ++ H NW +F++LKK+V++ R++L++H
Sbjct: 410 DVRGLHLEDQYDPAYIEENHSNWLRFMELKKKVISERNRLVKH 452

>CAGL0C02167g 220619..222061 weakly similar to sp|P43611
           Saccharomyces cerevisiae YFR039c, hypothetical start
          Length = 480

 Score = 99.4 bits (246), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 73/288 (25%), Positives = 133/288 (46%), Gaps = 28/288 (9%)

Query: 245 LEKPTASSSHED--DASLEVP-LRDLVQDE-------FEAWSTAVQQKASNTLSQFDAEI 294
           L  PT  + H+D  D++++ P L +L+  E       F  W  ++ +K     ++   E+
Sbjct: 177 LNDPTDVTLHKDTDDSAVQFPQLSELINTEVLLQEGGFNIWVKSISRKFKAIENELSQEV 236

Query: 295 QDLVDSKLSEIRPNVTTLLQSISDSCQAYYRDINKAILDVDCNMELDPVTGEQLYFNRDG 354
            + + S +     N    ++ +     A    +   + +++C M  D  T    Y++  G
Sbjct: 237 DNTISSTVVSGVENFQKDIEELRSDMDAQISILKDTVQNINCTMIYDENTDSVFYYDHTG 296

Query: 355 TQLR-KYMTRPLMREYFSAAHAHVEERLEFVRAQLEKFVAMVNKEVDEIRQESLELYEEW 413
            +L   Y+TRPL+  +  +    +E+ +E V+ Q+E  V   +  ++ +R E++E YEEW
Sbjct: 297 QKLLDTYVTRPLIMHHLKSTETRLEQLVEAVKLQVENMVEQSHIALEAVRNETIEAYEEW 356

Query: 414 GDVMISEWSKRMAYGDIF--------------HAIGSDSFDQQQ---HDNWKQFLKLKKR 456
           GD   +EWSK MAY DI+                 G D  D +    +++W +F   KK 
Sbjct: 357 GDTFYTEWSKYMAYRDIYDEDGEEPRPLAIDGKGKGEDQGDDEVAKIYEDWFEFTLHKKD 416

Query: 457 VVATRDQLMQHPAKLQALDTFLRDIQFTLSALQRDAGEYLFILRSQAN 504
           ++  RDQL+      + L  F   +   L +L++     +  LRSQA+
Sbjct: 417 IIQFRDQLLHKQLDTKKLKQFETSLDSQLDSLEKTYTAQIQSLRSQAD 464

>YIL144W (TID3) [2533] chr9 (78074..80149) Component of the
           Tid3p-Nuf2p-Spc24p-Spc25p centromere complex, involved
           in chromosome segregation [2076 bp, 691 aa]
          Length = 691

 Score = 34.3 bits (77), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 35/151 (23%), Positives = 74/151 (49%), Gaps = 22/151 (14%)

Query: 361 MTRPLMREYFSAAHA-------HVEERLEFVRAQLEKFVAMVNKEVDEIRQESLELYEEW 413
           M   L+ +YF+ ++        + E  ++ ++   EKFV ++N ++  ++ ++  LYE++
Sbjct: 274 MVEKLLIDYFTESYKSFLKLEDNYEPSMQELKLGFEKFVHIINTDIANLQTQNDNLYEKY 333

Query: 414 GDVM-ISEWSKRMAYGDIFHAIGSDSFDQQQHDNWKQFLKLKKRVVATRDQLMQHPAKLQ 472
            +VM IS+  K     + + A+ SDS    +++N+         V A + +  + P KL+
Sbjct: 334 QEVMKISQKIK--TTREKWKALKSDS---NKYENY---------VNAMKQKSQEWPGKLE 379

Query: 473 ALDTFLRDIQFTLSALQRDAGEYLFILRSQA 503
            + +     +  + ALQ +  E   ILR + 
Sbjct: 380 KMKSECELKEEEIKALQSNISELHKILRKKG 410

>Scas_721.22
          Length = 868

 Score = 31.6 bits (70), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 26/107 (24%), Positives = 55/107 (51%), Gaps = 15/107 (14%)

Query: 243 NELEKPTASSSHEDDASLEVPLRDLVQDEFEAWSTAVQQ-------KASNTLSQFDAEIQ 295
           N+L+K   +  + +DA    P  ++++D+ ++W+ AVQQ       +  N +S    EI 
Sbjct: 414 NDLKKKYTTGGNNNDAD---PQLEMMRDQIKSWAYAVQQNEFNDIERIINVISSKRKEIL 470

Query: 296 DLVDSKLSEIRPNVTTLLQSISDSCQA---YYRDINKAILDVD--CN 337
           D++ +  +E + N+  L  S+ ++ Q+    +R I   + ++   CN
Sbjct: 471 DILATLPAEEKENILKLKASLVEASQSDEKLFRLIKPYVAEIKLLCN 517

>Kwal_26.7063
          Length = 378

 Score = 30.4 bits (67), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 38/65 (58%), Gaps = 7/65 (10%)

Query: 280 QQKASNTLSQFDAEIQDLV------DSKLSEIRPNVTTLLQSISDSCQAYYRDINKAILD 333
           QQ  +N LS+FD  I+DL+      +S++++ R  +  L Q I ++ ++  +DI++ I D
Sbjct: 208 QQYFANELSKFDHYIRDLMASISSDESRITKTRTELDDLQQHIREA-KSVIKDIDRCIQD 266

Query: 334 VDCNM 338
            D  M
Sbjct: 267 QDIKM 271

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.128    0.377 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 16,894,733
Number of extensions: 652069
Number of successful extensions: 2707
Number of sequences better than 10.0: 33
Number of HSP's gapped: 2779
Number of HSP's successfully gapped: 35
Length of query: 702
Length of database: 16,596,109
Length adjustment: 109
Effective length of query: 593
Effective length of database: 12,822,747
Effective search space: 7603888971
Effective search space used: 7603888971
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)