Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_47.1918044944322660.0
Sklu_2433.1944944321400.0
YER043C (SAH1)44944321000.0
KLLA0A01199g44944320900.0
AFR243C44944320650.0
Scas_687.2144944320600.0
CAGL0C02189g44944320430.0
YCR045C491167850.021
CAGL0M12837g46691820.050
Scas_701.20469122790.13
YIL074C (SER33)469110750.30
YER081W (SER3)469110750.37
Sklu_2438.247093673.2
YKL060C (FBA1)35974654.9
KLLA0E19723g2141201665.3
KLLA0C09306g47091655.4
Kwal_23.595347091646.9
YAL060W (BDH1)38294638.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_47.19180
         (443 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_47.19180                                                         877   0.0  
Sklu_2433.19 YER043C, Contig c2433 31749-33098                        828   0.0  
YER043C (SAH1) [1469] chr5 complement(235769..237118) Adenosylho...   813   0.0  
KLLA0A01199g 111159..112508 highly similar to sp|P39954 Saccharo...   809   0.0  
AFR243C [3435] [Homologous to ScYER043C (SAH1) - SH] (876308..87...   800   0.0  
Scas_687.21                                                           798   0.0  
CAGL0C02189g 222418..223767 highly similar to sp|P39954 Saccharo...   791   0.0  
YCR045C (YCR045C) [578] chr3 complement(208130..209605) Member o...    37   0.021
CAGL0M12837g 1265948..1267348 highly similar to sp|P40510 Saccha...    36   0.050
Scas_701.20                                                            35   0.13 
YIL074C (SER33) [2597] chr9 complement(221078..222487) 3-phospho...    33   0.30 
YER081W (SER3) [1513] chr5 (322682..324091) 3-phosphoglycerate d...    33   0.37 
Sklu_2438.2 YER081W, Contig c2438 2568-3980                            30   3.2  
YKL060C (FBA1) [3199] chr11 complement(326053..327132) Fructose-...    30   4.9  
KLLA0E19723g 1743508..1749933 highly similar to sp|Q12680 Saccha...    30   5.3  
KLLA0C09306g complement(810584..811996) highly similar to sp|P40...    30   5.4  
Kwal_23.5953                                                           29   6.9  
YAL060W (BDH1) [10] chr1 (35156..36304) Stereospecific (2R, 3R)-...    29   8.4  

>Kwal_47.19180
          Length = 449

 Score =  877 bits (2266), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/443 (96%), Positives = 426/443 (96%)

Query: 1   MSSPAQNCKVADISLAAFGRKEIELAEHEMPGLMAIREAYGEAQPLKGARIAGCLHMTIQ 60
           MSSPAQNCKVADISLAAFGRKEIELAEHEMPGLMAIREAYGEAQPLKGARIAGCLHMTIQ
Sbjct: 1   MSSPAQNCKVADISLAAFGRKEIELAEHEMPGLMAIREAYGEAQPLKGARIAGCLHMTIQ 60

Query: 61  TAVLIETLVALGAEVTWSSCNIYSTQDHXXXXXXXSGVPVFAWKGETEEEYLWCIEQQLF 120
           TAVLIETLVALGAEVTWSSCNIYSTQDH       SGVPVFAWKGETEEEYLWCIEQQLF
Sbjct: 61  TAVLIETLVALGAEVTWSSCNIYSTQDHAAAAIAASGVPVFAWKGETEEEYLWCIEQQLF 120

Query: 121 AFKDNKKLNLIXXXXXXXXXXVHEKHPEMLKDCFGLSEETTTGVHHLYRMVKDAKLKVPA 180
           AFKDNKKLNLI          VHEKHPEMLKDCFGLSEETTTGVHHLYRMVKDAKLKVPA
Sbjct: 121 AFKDNKKLNLILDDGGDLTTLVHEKHPEMLKDCFGLSEETTTGVHHLYRMVKDAKLKVPA 180

Query: 181 INVNDAVTKSKFDNLYGCRESLIDGIKRATDVMLAGKVSVVAGYGDVGKGCAAALRGMGS 240
           INVNDAVTKSKFDNLYGCRESLIDGIKRATDVMLAGKVSVVAGYGDVGKGCAAALRGMGS
Sbjct: 181 INVNDAVTKSKFDNLYGCRESLIDGIKRATDVMLAGKVSVVAGYGDVGKGCAAALRGMGS 240

Query: 241 RVIVTEIDPINALQAAMEGYQVCPMEEAVSIGQVFVTTTGCRDIITAEHFMAMPEDAIVC 300
           RVIVTEIDPINALQAAMEGYQVCPMEEAVSIGQVFVTTTGCRDIITAEHFMAMPEDAIVC
Sbjct: 241 RVIVTEIDPINALQAAMEGYQVCPMEEAVSIGQVFVTTTGCRDIITAEHFMAMPEDAIVC 300

Query: 301 NIGHFDIEIDVAWLKANAKECVNIKPQVDRFLLPSGKHVILLADGRLVNLGCATGHSSFV 360
           NIGHFDIEIDVAWLKANAKECVNIKPQVDRFLLPSGKHVILLADGRLVNLGCATGHSSFV
Sbjct: 301 NIGHFDIEIDVAWLKANAKECVNIKPQVDRFLLPSGKHVILLADGRLVNLGCATGHSSFV 360

Query: 361 MSCSFSNQVLAQIALFKAHDNEFRQKYIEFQKTGPFEIGVHVLPKILDEAVAKFHLGKLG 420
           MSCSFSNQVLAQIALFKAHDNEFRQKYIEFQKTGPFEIGVHVLPKILDEAVAKFHLGKLG
Sbjct: 361 MSCSFSNQVLAQIALFKAHDNEFRQKYIEFQKTGPFEIGVHVLPKILDEAVAKFHLGKLG 420

Query: 421 VRLTKLSEVQSEYLGIPEEGPYK 443
           VRLTKLSEVQSEYLGIPEEGPYK
Sbjct: 421 VRLTKLSEVQSEYLGIPEEGPYK 443

>Sklu_2433.19 YER043C, Contig c2433 31749-33098
          Length = 449

 Score =  828 bits (2140), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/443 (89%), Positives = 417/443 (94%)

Query: 1   MSSPAQNCKVADISLAAFGRKEIELAEHEMPGLMAIREAYGEAQPLKGARIAGCLHMTIQ 60
           MS+PAQN K+ADISLAAFGRKEIELAEHEMPGLMAIREAY EAQPLKGARIAGCLHMTIQ
Sbjct: 1   MSAPAQNYKIADISLAAFGRKEIELAEHEMPGLMAIREAYAEAQPLKGARIAGCLHMTIQ 60

Query: 61  TAVLIETLVALGAEVTWSSCNIYSTQDHXXXXXXXSGVPVFAWKGETEEEYLWCIEQQLF 120
           TAVLIETLVALGAEVTWSSCNIYSTQDH       SGVPVFAWKGETEEEYLWCIEQQLF
Sbjct: 61  TAVLIETLVALGAEVTWSSCNIYSTQDHAAAAIAASGVPVFAWKGETEEEYLWCIEQQLF 120

Query: 121 AFKDNKKLNLIXXXXXXXXXXVHEKHPEMLKDCFGLSEETTTGVHHLYRMVKDAKLKVPA 180
           AFKD KKLNLI          VHEKHPEML+DCFG+SEETTTGVHHLYRMVK+AKLKVPA
Sbjct: 121 AFKDGKKLNLILDDGGDLTSLVHEKHPEMLEDCFGISEETTTGVHHLYRMVKEAKLKVPA 180

Query: 181 INVNDAVTKSKFDNLYGCRESLIDGIKRATDVMLAGKVSVVAGYGDVGKGCAAALRGMGS 240
           INVND+VTKSKFDNLYGCRESLIDGIKRATDVMLAGKV+VVAGYGDVGKGCAAALRGMG+
Sbjct: 181 INVNDSVTKSKFDNLYGCRESLIDGIKRATDVMLAGKVAVVAGYGDVGKGCAAALRGMGA 240

Query: 241 RVIVTEIDPINALQAAMEGYQVCPMEEAVSIGQVFVTTTGCRDIITAEHFMAMPEDAIVC 300
           RV+VTEIDPINALQAAMEGYQV PMEEA S GQVFVTTTGCRDIIT+EHF++MPEDAIVC
Sbjct: 241 RVVVTEIDPINALQAAMEGYQVIPMEEAASFGQVFVTTTGCRDIITSEHFLSMPEDAIVC 300

Query: 301 NIGHFDIEIDVAWLKANAKECVNIKPQVDRFLLPSGKHVILLADGRLVNLGCATGHSSFV 360
           NIGHFDIEIDVAWLKANAKEC+NIKPQVDR+LL SGKHVILLADGRLVNLGCATGHSSFV
Sbjct: 301 NIGHFDIEIDVAWLKANAKECINIKPQVDRYLLSSGKHVILLADGRLVNLGCATGHSSFV 360

Query: 361 MSCSFSNQVLAQIALFKAHDNEFRQKYIEFQKTGPFEIGVHVLPKILDEAVAKFHLGKLG 420
           MSCSFSNQVLAQIALFKA+D EFR+KYIEFQKTGPFE+GVHVLPKILDEAVAKFHL KLG
Sbjct: 361 MSCSFSNQVLAQIALFKANDKEFREKYIEFQKTGPFELGVHVLPKILDEAVAKFHLDKLG 420

Query: 421 VRLTKLSEVQSEYLGIPEEGPYK 443
           V+LT+LS+VQSEYLGIP+EGPYK
Sbjct: 421 VKLTQLSDVQSEYLGIPQEGPYK 443

>YER043C (SAH1) [1469] chr5 complement(235769..237118)
           Adenosylhomocysteinase (S-adenosylhomocysteine
           hydrolase) [1350 bp, 449 aa]
          Length = 449

 Score =  813 bits (2100), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/443 (87%), Positives = 412/443 (93%)

Query: 1   MSSPAQNCKVADISLAAFGRKEIELAEHEMPGLMAIREAYGEAQPLKGARIAGCLHMTIQ 60
           MS+PAQN K+ADISLAAFGRKEIELAEHEMPGLMAIR+AYG+ QPLKGARIAGCLHMTIQ
Sbjct: 1   MSAPAQNYKIADISLAAFGRKEIELAEHEMPGLMAIRKAYGDVQPLKGARIAGCLHMTIQ 60

Query: 61  TAVLIETLVALGAEVTWSSCNIYSTQDHXXXXXXXSGVPVFAWKGETEEEYLWCIEQQLF 120
           TAVLIETLVALGAEVTWSSCNIYSTQDH       SGVPVFAWKGETEEEYLWCIEQQLF
Sbjct: 61  TAVLIETLVALGAEVTWSSCNIYSTQDHAAAAIAASGVPVFAWKGETEEEYLWCIEQQLF 120

Query: 121 AFKDNKKLNLIXXXXXXXXXXVHEKHPEMLKDCFGLSEETTTGVHHLYRMVKDAKLKVPA 180
           AFKDNKKLNLI          VHEKHPEML+DCFGLSEETTTGVHHLYRMVK+ KLKVPA
Sbjct: 121 AFKDNKKLNLILDDGGDLTTLVHEKHPEMLEDCFGLSEETTTGVHHLYRMVKEGKLKVPA 180

Query: 181 INVNDAVTKSKFDNLYGCRESLIDGIKRATDVMLAGKVSVVAGYGDVGKGCAAALRGMGS 240
           INVND+VTKSKFDNLYGCRESL+DGIKRATDVMLAGKV+VVAGYGDVGKGCAAALRGMG+
Sbjct: 181 INVNDSVTKSKFDNLYGCRESLVDGIKRATDVMLAGKVAVVAGYGDVGKGCAAALRGMGA 240

Query: 241 RVIVTEIDPINALQAAMEGYQVCPMEEAVSIGQVFVTTTGCRDIITAEHFMAMPEDAIVC 300
           RV+VTEIDPINALQAAMEGYQV  ME+A  IGQVFVTTTGCRDII  EHF+ MPEDAIVC
Sbjct: 241 RVLVTEIDPINALQAAMEGYQVVTMEDASHIGQVFVTTTGCRDIINGEHFINMPEDAIVC 300

Query: 301 NIGHFDIEIDVAWLKANAKECVNIKPQVDRFLLPSGKHVILLADGRLVNLGCATGHSSFV 360
           NIGHFDIEIDVAWLKANAKEC+NIKPQVDR+LL SG+HVILLA+GRLVNLGCATGHSSFV
Sbjct: 301 NIGHFDIEIDVAWLKANAKECINIKPQVDRYLLSSGRHVILLANGRLVNLGCATGHSSFV 360

Query: 361 MSCSFSNQVLAQIALFKAHDNEFRQKYIEFQKTGPFEIGVHVLPKILDEAVAKFHLGKLG 420
           MSCSFSNQVLAQIALFK++D  FR+K+IEFQKTGPFE+GVHVLPKILDEAVAKFHLG LG
Sbjct: 361 MSCSFSNQVLAQIALFKSNDKSFREKHIEFQKTGPFEVGVHVLPKILDEAVAKFHLGNLG 420

Query: 421 VRLTKLSEVQSEYLGIPEEGPYK 443
           VRLTKLS+VQSEYLGIPEEGP+K
Sbjct: 421 VRLTKLSKVQSEYLGIPEEGPFK 443

>KLLA0A01199g 111159..112508 highly similar to sp|P39954
           Saccharomyces cerevisiae YER043c SAH1
           S-adenosyl-L-homocysteine hydrolase singleton, start by
           similarity
          Length = 449

 Score =  809 bits (2090), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/443 (88%), Positives = 408/443 (92%)

Query: 1   MSSPAQNCKVADISLAAFGRKEIELAEHEMPGLMAIREAYGEAQPLKGARIAGCLHMTIQ 60
           MS+PA N KVADISLAAFGRKEIELAEHEMPGL+AIREAYG  QPLKGARIAGCLHMTIQ
Sbjct: 1   MSAPAHNYKVADISLAAFGRKEIELAEHEMPGLIAIREAYGAEQPLKGARIAGCLHMTIQ 60

Query: 61  TAVLIETLVALGAEVTWSSCNIYSTQDHXXXXXXXSGVPVFAWKGETEEEYLWCIEQQLF 120
           TAVLIETLVALGAEVTWSSCNIYSTQDH       SGVPVFAWKGETEEEYLWCIEQQLF
Sbjct: 61  TAVLIETLVALGAEVTWSSCNIYSTQDHAAAAIAASGVPVFAWKGETEEEYLWCIEQQLF 120

Query: 121 AFKDNKKLNLIXXXXXXXXXXVHEKHPEMLKDCFGLSEETTTGVHHLYRMVKDAKLKVPA 180
           AFKD+KKLNLI          VH+K+P+ML DCFGLSEETTTGVHHLYRMVK+ KLKVPA
Sbjct: 121 AFKDDKKLNLILDDGGDLTSLVHDKYPDMLMDCFGLSEETTTGVHHLYRMVKENKLKVPA 180

Query: 181 INVNDAVTKSKFDNLYGCRESLIDGIKRATDVMLAGKVSVVAGYGDVGKGCAAALRGMGS 240
           INVND+VTKSKFDNLYGCRESLIDGIKRATDVMLAGKV+VVAGYGDVGKGCAAALRG G+
Sbjct: 181 INVNDSVTKSKFDNLYGCRESLIDGIKRATDVMLAGKVAVVAGYGDVGKGCAAALRGFGA 240

Query: 241 RVIVTEIDPINALQAAMEGYQVCPMEEAVSIGQVFVTTTGCRDIITAEHFMAMPEDAIVC 300
           RVIVTEIDPINALQAAMEGYQV PMEEAVS GQVFVTTTGCRDIIT EHF+ MPEDAIVC
Sbjct: 241 RVIVTEIDPINALQAAMEGYQVIPMEEAVSSGQVFVTTTGCRDIITKEHFLQMPEDAIVC 300

Query: 301 NIGHFDIEIDVAWLKANAKECVNIKPQVDRFLLPSGKHVILLADGRLVNLGCATGHSSFV 360
           NIGHFDIEIDVAWLKANA E +NIKPQVDR+LLPSGKHVILLADGRLVNLGCATGHSSFV
Sbjct: 301 NIGHFDIEIDVAWLKANATEVINIKPQVDRYLLPSGKHVILLADGRLVNLGCATGHSSFV 360

Query: 361 MSCSFSNQVLAQIALFKAHDNEFRQKYIEFQKTGPFEIGVHVLPKILDEAVAKFHLGKLG 420
           MSCSFSNQVLAQIALFKA D  FR+KYIEFQKTGPF+IGVHVLPKILDEAVAKFHL  LG
Sbjct: 361 MSCSFSNQVLAQIALFKAQDKAFREKYIEFQKTGPFDIGVHVLPKILDEAVAKFHLDNLG 420

Query: 421 VRLTKLSEVQSEYLGIPEEGPYK 443
           V+LTKLS+VQSEYLGIPEEGPYK
Sbjct: 421 VKLTKLSDVQSEYLGIPEEGPYK 443

>AFR243C [3435] [Homologous to ScYER043C (SAH1) - SH]
           (876308..877657) [1350 bp, 449 aa]
          Length = 449

 Score =  800 bits (2065), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/443 (86%), Positives = 406/443 (91%)

Query: 1   MSSPAQNCKVADISLAAFGRKEIELAEHEMPGLMAIREAYGEAQPLKGARIAGCLHMTIQ 60
           MS PAQN KVAD+SLAAFGRKEIEL+EHEMPGLMAIR+AYG+AQPLKGARIAGCLHMTIQ
Sbjct: 1   MSIPAQNYKVADLSLAAFGRKEIELSEHEMPGLMAIRKAYGDAQPLKGARIAGCLHMTIQ 60

Query: 61  TAVLIETLVALGAEVTWSSCNIYSTQDHXXXXXXXSGVPVFAWKGETEEEYLWCIEQQLF 120
           TAVLIETLVALGAEVTW+SCNIYSTQDH       SGVPVFAWKGETEEEYLWCIEQQLF
Sbjct: 61  TAVLIETLVALGAEVTWTSCNIYSTQDHAAAAIAASGVPVFAWKGETEEEYLWCIEQQLF 120

Query: 121 AFKDNKKLNLIXXXXXXXXXXVHEKHPEMLKDCFGLSEETTTGVHHLYRMVKDAKLKVPA 180
           AFKD KKLNLI          VHEK+PEML DCFG+SEETTTGVHHLYRM+K+ KLKVPA
Sbjct: 121 AFKDGKKLNLILDDGGDLTTLVHEKYPEMLDDCFGVSEETTTGVHHLYRMLKEGKLKVPA 180

Query: 181 INVNDAVTKSKFDNLYGCRESLIDGIKRATDVMLAGKVSVVAGYGDVGKGCAAALRGMGS 240
           INVND+VTKSKFDNLYGCRESL+DG+KRATDVMLAGKV+VVAGYGDVGKGCAAALRGMG+
Sbjct: 181 INVNDSVTKSKFDNLYGCRESLVDGLKRATDVMLAGKVAVVAGYGDVGKGCAAALRGMGA 240

Query: 241 RVIVTEIDPINALQAAMEGYQVCPMEEAVSIGQVFVTTTGCRDIITAEHFMAMPEDAIVC 300
           RVIVTEIDPINALQAAMEGYQV  M++  S GQVFVTTTGCRDII  EHF+AMPEDAIVC
Sbjct: 241 RVIVTEIDPINALQAAMEGYQVTTMDQCASYGQVFVTTTGCRDIIKKEHFLAMPEDAIVC 300

Query: 301 NIGHFDIEIDVAWLKANAKECVNIKPQVDRFLLPSGKHVILLADGRLVNLGCATGHSSFV 360
           NIGHFDIEIDVAWLKANA E VNIKPQVDR+LL SG+HVILLADGRLVNLGCATGHSSFV
Sbjct: 301 NIGHFDIEIDVAWLKANAVEAVNIKPQVDRYLLSSGRHVILLADGRLVNLGCATGHSSFV 360

Query: 361 MSCSFSNQVLAQIALFKAHDNEFRQKYIEFQKTGPFEIGVHVLPKILDEAVAKFHLGKLG 420
           MSCSFSNQVLAQIALFKA+D  FRQKYIEFQKTGPF+IGVHVLPKILDEAVAKFHL KLG
Sbjct: 361 MSCSFSNQVLAQIALFKANDEAFRQKYIEFQKTGPFDIGVHVLPKILDEAVAKFHLDKLG 420

Query: 421 VRLTKLSEVQSEYLGIPEEGPYK 443
           V+LTKLS  QSEYLGIPEEGP+K
Sbjct: 421 VKLTKLSSTQSEYLGIPEEGPFK 443

>Scas_687.21
          Length = 449

 Score =  798 bits (2060), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/443 (85%), Positives = 405/443 (91%)

Query: 1   MSSPAQNCKVADISLAAFGRKEIELAEHEMPGLMAIREAYGEAQPLKGARIAGCLHMTIQ 60
           MS+PAQN KVADISLAAFGRKEIELAEHEMPGLMAIR+AY   QPLKGARIAGCLHMTIQ
Sbjct: 1   MSAPAQNYKVADISLAAFGRKEIELAEHEMPGLMAIRKAYAGVQPLKGARIAGCLHMTIQ 60

Query: 61  TAVLIETLVALGAEVTWSSCNIYSTQDHXXXXXXXSGVPVFAWKGETEEEYLWCIEQQLF 120
           TAVLIETLVALGAEVTWSSCNIYSTQDH       SGVPVFAWKGETEEEYLWCIEQQLF
Sbjct: 61  TAVLIETLVALGAEVTWSSCNIYSTQDHAASAIAASGVPVFAWKGETEEEYLWCIEQQLF 120

Query: 121 AFKDNKKLNLIXXXXXXXXXXVHEKHPEMLKDCFGLSEETTTGVHHLYRMVKDAKLKVPA 180
           AFKD KKLNLI          VH+KHPEML DCFGLSEETTTGVH+LY+MVK+ +LKVPA
Sbjct: 121 AFKDGKKLNLILDDGGDLTSLVHDKHPEMLDDCFGLSEETTTGVHYLYKMVKENRLKVPA 180

Query: 181 INVNDAVTKSKFDNLYGCRESLIDGIKRATDVMLAGKVSVVAGYGDVGKGCAAALRGMGS 240
           INVND+VTKSKFDNLYGCRESLIDGIKRATDVMLAGKV+VVAGYGDVGKGCAAALRGMG+
Sbjct: 181 INVNDSVTKSKFDNLYGCRESLIDGIKRATDVMLAGKVAVVAGYGDVGKGCAAALRGMGA 240

Query: 241 RVIVTEIDPINALQAAMEGYQVCPMEEAVSIGQVFVTTTGCRDIITAEHFMAMPEDAIVC 300
           RVIVTE+DPINALQAAMEGYQV  ME A +IGQ+FVTTTGCRDIIT  HF  MPEDAIVC
Sbjct: 241 RVIVTEVDPINALQAAMEGYQVDTMESASNIGQIFVTTTGCRDIITGAHFANMPEDAIVC 300

Query: 301 NIGHFDIEIDVAWLKANAKECVNIKPQVDRFLLPSGKHVILLADGRLVNLGCATGHSSFV 360
           NIGHFDIEIDVAWLKANAKEC+NIKPQVDR+LLP+G+HVILLA+GRLVNLGCATGHSSFV
Sbjct: 301 NIGHFDIEIDVAWLKANAKECINIKPQVDRYLLPTGRHVILLANGRLVNLGCATGHSSFV 360

Query: 361 MSCSFSNQVLAQIALFKAHDNEFRQKYIEFQKTGPFEIGVHVLPKILDEAVAKFHLGKLG 420
           MSCSFSNQVLAQIALFKA D  FR+K+IEFQKTGPF +GVHVLPKILDEAVAKFHL KLG
Sbjct: 361 MSCSFSNQVLAQIALFKADDKAFREKHIEFQKTGPFTVGVHVLPKILDEAVAKFHLDKLG 420

Query: 421 VRLTKLSEVQSEYLGIPEEGPYK 443
           V+LTKLS+ QSEYLG+P+EGPYK
Sbjct: 421 VQLTKLSDTQSEYLGVPQEGPYK 443

>CAGL0C02189g 222418..223767 highly similar to sp|P39954
           Saccharomyces cerevisiae YER043c SAH1, start by
           similarity
          Length = 449

 Score =  791 bits (2043), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/443 (84%), Positives = 407/443 (91%)

Query: 1   MSSPAQNCKVADISLAAFGRKEIELAEHEMPGLMAIREAYGEAQPLKGARIAGCLHMTIQ 60
           MS+PAQN K+ADISLAAFGRKEIELAE+EMPGLMAIR+AY EAQPLKGARIAGCLHMTIQ
Sbjct: 1   MSAPAQNYKIADISLAAFGRKEIELAENEMPGLMAIRKAYAEAQPLKGARIAGCLHMTIQ 60

Query: 61  TAVLIETLVALGAEVTWSSCNIYSTQDHXXXXXXXSGVPVFAWKGETEEEYLWCIEQQLF 120
           TAVLIETLVALGAEVTW+SCNIYSTQDH       SGVPVFAWKGETEEEY+WCIEQQLF
Sbjct: 61  TAVLIETLVALGAEVTWTSCNIYSTQDHAAAAIAASGVPVFAWKGETEEEYMWCIEQQLF 120

Query: 121 AFKDNKKLNLIXXXXXXXXXXVHEKHPEMLKDCFGLSEETTTGVHHLYRMVKDAKLKVPA 180
           AFKDNKKLNLI          VHEK+PEML DCFGLSEETTTGVHHLYRM+++ KLKVPA
Sbjct: 121 AFKDNKKLNLILDDGGDLTSFVHEKYPEMLTDCFGLSEETTTGVHHLYRMMREGKLKVPA 180

Query: 181 INVNDAVTKSKFDNLYGCRESLIDGIKRATDVMLAGKVSVVAGYGDVGKGCAAALRGMGS 240
           INVNDAVTKSKFDNLYGCRESL+DGIKRATDVMLAGKV+VVAG+GDVGKGCAA+LRGMG+
Sbjct: 181 INVNDAVTKSKFDNLYGCRESLVDGIKRATDVMLAGKVAVVAGFGDVGKGCAASLRGMGA 240

Query: 241 RVIVTEIDPINALQAAMEGYQVCPMEEAVSIGQVFVTTTGCRDIITAEHFMAMPEDAIVC 300
           RV+VTEIDPINALQAAMEGY+V  ME+A S+GQVFVTTTGCRDII  EHF  MPEDAIVC
Sbjct: 241 RVLVTEIDPINALQAAMEGYEVTTMEDAASVGQVFVTTTGCRDIIKGEHFEKMPEDAIVC 300

Query: 301 NIGHFDIEIDVAWLKANAKECVNIKPQVDRFLLPSGKHVILLADGRLVNLGCATGHSSFV 360
           NIGHFDIEIDVAWLK NAKEC+NIKPQVDR+LL SG+HVILLA+GRLVNLGCATGHSSFV
Sbjct: 301 NIGHFDIEIDVAWLKENAKECINIKPQVDRYLLSSGRHVILLANGRLVNLGCATGHSSFV 360

Query: 361 MSCSFSNQVLAQIALFKAHDNEFRQKYIEFQKTGPFEIGVHVLPKILDEAVAKFHLGKLG 420
           MSCSFSNQVLAQIALFK+ D  FR K++EF+KTGPFE+GVHVLPKILDEAVAKFHL KLG
Sbjct: 361 MSCSFSNQVLAQIALFKSDDKAFRTKFVEFEKTGPFEVGVHVLPKILDEAVAKFHLEKLG 420

Query: 421 VRLTKLSEVQSEYLGIPEEGPYK 443
           V+LT LS+VQSEYLGIP++GP+K
Sbjct: 421 VKLTTLSDVQSEYLGIPQQGPFK 443

>YCR045C (YCR045C) [578] chr3 complement(208130..209605) Member of
           the subtilase family of serine proteases, has moderate
           similarity to S. pombe Isp6p, which is a putative
           subtilase-type proteinase involved in sexual
           differentiation [1476 bp, 491 aa]
          Length = 491

 Score = 37.4 bits (85), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 45/167 (26%), Positives = 77/167 (46%), Gaps = 24/167 (14%)

Query: 265 MEEAVSIGQVFVTTTGCRDIITAEHFMAMPEDA-IVCNIGHFDIEIDVAWLKANAKECVN 323
           +E A+  G VFV   G  ++   + + A P  A  V  +G FD  ID     +N   CVN
Sbjct: 283 VEGAIEEGIVFVAAAGNFNL---DAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVN 339

Query: 324 I-KPQVDRFLLPSGKHV----ILLADGRLVNLGCATGHSSFVMSCSFSNQVLAQIALFKA 378
           I  P V+   + S  H+     L+  G  ++    TG ++ ++S     +++AQ   + +
Sbjct: 340 IFAPGVE---IESLSHLNYNDTLILSGTSMSTPIVTGVAAILLSKGIEPEMIAQEIEYLS 396

Query: 379 HDNEFRQKYIEFQKTGPFEI---GVHVL---------PKILDEAVAK 413
             N F ++ + F+ + P +I   GV  L         P++  EA+AK
Sbjct: 397 TRNVFHRRTLFFKPSTPNQILYNGVDKLDDPYDDETFPRLNIEAIAK 443

>CAGL0M12837g 1265948..1267348 highly similar to sp|P40510
           Saccharomyces cerevisiae YIL074c SER33
           3-phosphoglycerate dehydrogenase, hypothetical start
          Length = 466

 Score = 36.2 bits (82), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 43/91 (47%), Gaps = 9/91 (9%)

Query: 216 GKVSVVAGYGDVGKGCAAALRGMGSRVIVTEIDPINALQAAMEGYQVCPMEEAVSIGQVF 275
           GK   V GYG +G   +     MG  V+  +I  I AL  A    QV  ++E ++    F
Sbjct: 195 GKTLGVVGYGHIGSQLSVLAESMGMHVLYYDIVTIMALGTAK---QVSTLDELLNKSD-F 250

Query: 276 VT-----TTGCRDIITAEHFMAMPEDAIVCN 301
           VT     T   +++++A  F AM + A V N
Sbjct: 251 VTLHVPETPETKNLLSAPQFAAMKDGAYVIN 281

>Scas_701.20
          Length = 469

 Score = 35.0 bits (79), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 55/122 (45%), Gaps = 14/122 (11%)

Query: 216 GKVSVVAGYGDVGKGCAAALRGMGSRVIVTEIDPINALQAAMEGYQVCPMEEAVSIGQVF 275
           GK   + GYG +G   +     MG  VI  +I  + AL  +    QV  ++E ++    F
Sbjct: 198 GKTLGIIGYGHIGSQVSVLAEAMGMHVIYYDIVTVMALGTSK---QVPTLDELLNKAD-F 253

Query: 276 VT-----TTGCRDIITAEHFMAMPEDAIVCNIGH---FDIEIDVAWLKAN--AKECVNIK 325
           VT     T   +++++A  F AM + A V N+      DI   +  +K N  A   +++ 
Sbjct: 254 VTLHVPETPETKNMLSAPQFAAMKDGAYVINLSRGTVVDIPSLIQAMKVNKIAGAAIDVY 313

Query: 326 PQ 327
           P 
Sbjct: 314 PN 315

>YIL074C (SER33) [2597] chr9 complement(221078..222487)
           3-phosphoglycerate dehydrogenase, catalyzes the first
           step in the synthesis of serine from 3-phosphoglycerate
           [1410 bp, 469 aa]
          Length = 469

 Score = 33.5 bits (75), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 48/110 (43%), Gaps = 12/110 (10%)

Query: 216 GKVSVVAGYGDVGKGCAAALRGMGSRVIVTEIDPINALQAAMEGYQVCPMEEAVSIGQVF 275
           GK   + GYG +G   +     MG  V+  +I  I AL  A    QV  ++E ++    F
Sbjct: 198 GKTLGIIGYGHIGSQLSVLAEAMGLHVLYYDIVTIMALGTAR---QVSTLDELLNKSD-F 253

Query: 276 VT-----TTGCRDIITAEHFMAMPEDAIVCNIGH---FDIEIDVAWLKAN 317
           VT     T     +++A  F AM + A V N       DI   +  +KAN
Sbjct: 254 VTLHVPATPETEKMLSAPQFAAMKDGAYVINASRGTVVDIPSLIQAVKAN 303

>YER081W (SER3) [1513] chr5 (322682..324091) 3-phosphoglycerate
           dehydrogenase, catalyzes the first step in synthesis of
           serine from 3-phosphoglycerate [1410 bp, 469 aa]
          Length = 469

 Score = 33.5 bits (75), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 48/110 (43%), Gaps = 12/110 (10%)

Query: 216 GKVSVVAGYGDVGKGCAAALRGMGSRVIVTEIDPINALQAAMEGYQVCPMEEAVSIGQVF 275
           GK   + GYG +G   +     MG  V+  +I  I AL  A    QV  ++E ++    F
Sbjct: 198 GKTLGIIGYGHIGSQLSVLAEAMGLHVLYYDIVTIMALGTAR---QVSTLDELLNKSD-F 253

Query: 276 VT-----TTGCRDIITAEHFMAMPEDAIVCNIGH---FDIEIDVAWLKAN 317
           VT     T     +++A  F AM + A V N       DI   +  +KAN
Sbjct: 254 VTLHVPATPETEKMLSAPQFAAMKDGAYVINASRGTVVDIPSLIQAVKAN 303

>Sklu_2438.2 YER081W, Contig c2438 2568-3980
          Length = 470

 Score = 30.4 bits (67), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 43/93 (46%), Gaps = 9/93 (9%)

Query: 214 LAGKVSVVAGYGDVGKGCAAALRGMGSRVIVTEIDPINALQAAMEGYQVCPMEEAVSIGQ 273
           + GK   + GYG +G   +      G  V+  +I  I AL  A    QV  ++E ++   
Sbjct: 197 IRGKTLGIIGYGHIGAQLSVLAEAFGMHVLYYDIVTIMALGTAK---QVSTLDELLNKSD 253

Query: 274 VFVT-----TTGCRDIITAEHFMAMPEDAIVCN 301
            FV+     T   +++++A  F AM + + V N
Sbjct: 254 -FVSCHVPATPETKNLLSAPQFAAMKDGSYVIN 285

>YKL060C (FBA1) [3199] chr11 complement(326053..327132)
           Fructose-bisphosphate aldolase II, catalyzes cleavage or
           condensation of fructose-1,6-bisphosphate into
           dihydroxyacetonephosphate and glyceraldehyde-3-phosphate
           at the sixth step in glycolysis [1080 bp, 359 aa]
          Length = 359

 Score = 29.6 bits (65), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 36/74 (48%), Gaps = 6/74 (8%)

Query: 164 VHHLYRMVKDAKLKVPAINVNDAVTKSKFDNLYGCRESLIDGIKRATDVMLAGKVSVVAG 223
           VH+L+   K+ K  +PAINV  + T      L   R+S    I + ++    G  +  AG
Sbjct: 19  VHNLFTYAKEHKFAIPAINVTSSST--AVAALEAARDSKSPIILQTSN----GGAAYFAG 72

Query: 224 YGDVGKGCAAALRG 237
            G   +G  A+++G
Sbjct: 73  KGISNEGQNASIKG 86

>KLLA0E19723g 1743508..1749933 highly similar to sp|Q12680
            Saccharomyces cerevisiae YDL171c GLT1 glutamate synthase
            (NAPDPH) (GOGAT) singleton, start by similarity
          Length = 2141

 Score = 30.0 bits (66), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 49/201 (24%), Positives = 80/201 (39%), Gaps = 42/201 (20%)

Query: 215  AGKVSVVAGYGDVGKGCAAALRGMGSRVIVTE-IDPINALQAAMEGYQVCPMEEAV---- 269
             GK+  V G G  G  CA  L   G  V+V E  D    L   M G     +++++    
Sbjct: 1780 TGKIVAVIGSGPAGMACADQLNRAGHSVVVYERADRCGGL--LMYGIPNMKLDKSIVQRR 1837

Query: 270  -----SIGQVFVTTTGCRDIITAEHFMAMPEDAIVCNIGHF-------------DIEIDV 311
                 + G  F+T T     I+ E   +   DAIV  +G               +I+  +
Sbjct: 1838 LDLLAAEGVQFITNTEVGKDISVEELKSK-FDAIVYTVGSTIPRDLRIPGRELKNIDFAM 1896

Query: 312  AWLKANAKECVN-----IKPQVDRFLLPSGKHVILLADGRLVN--LGCATGHSSFVMSCS 364
              LK+N +  ++     IK Q+       GK VI++  G   N  LG +  H +   +  
Sbjct: 1897 TLLKSNTQALLDRDLETIKKQI------KGKKVIVIGGGDTGNDCLGTSVRHGA---ASV 1947

Query: 365  FSNQVLAQIALFKAHDNEFRQ 385
             + ++L Q    ++ DN + Q
Sbjct: 1948 LNFELLPQPPNERSKDNPWPQ 1968

>KLLA0C09306g complement(810584..811996) highly similar to sp|P40054
           Saccharomyces cerevisiae YER081w SER3 3-phosphoglycerate
           dehydrogenase, start by similarity
          Length = 470

 Score = 29.6 bits (65), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 41/91 (45%), Gaps = 9/91 (9%)

Query: 216 GKVSVVAGYGDVGKGCAAALRGMGSRVIVTEIDPINALQAAMEGYQVCPMEEAVSIGQVF 275
           GK   + GYG +G   +     +G  V+  +I  I +L  A    QV  + E ++    F
Sbjct: 199 GKTLGIIGYGHIGSQLSVLAEALGMNVLYYDIVTIMSLGTAK---QVSTLNELLN-NSDF 254

Query: 276 VT-----TTGCRDIITAEHFMAMPEDAIVCN 301
           VT     T   +++++   F AM + + V N
Sbjct: 255 VTCHVPATPETKNLLSGPQFAAMKDGSYVIN 285

>Kwal_23.5953
          Length = 470

 Score = 29.3 bits (64), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 41/91 (45%), Gaps = 9/91 (9%)

Query: 216 GKVSVVAGYGDVGKGCAAALRGMGSRVIVTEIDPINALQAAMEGYQVCPMEEAVSIGQVF 275
           GK   + GYG +G   +      G  V+  +I  I AL  A    QV  +++ +     F
Sbjct: 199 GKTLGIIGYGHIGAQLSVLAEAFGMHVLYYDIVTIMALGTAK---QVSTLDKLLGESD-F 254

Query: 276 VT-----TTGCRDIITAEHFMAMPEDAIVCN 301
           VT     T   +++++A  F AM + + V N
Sbjct: 255 VTCHVPETEDTKNLLSAPQFAAMKDGSYVLN 285

>YAL060W (BDH1) [10] chr1 (35156..36304) Stereospecific (2R,
           3R)-2,3-butanediol dehydrogenase with similarity to
           alcohol/sorbitol dehydrogenases, member of the
           zinc-containing alcohol dehydrogenase family [1149 bp,
           382 aa]
          Length = 382

 Score = 28.9 bits (63), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 42/94 (44%), Gaps = 17/94 (18%)

Query: 155 GLSEETTTGVHHLYRMVKDAKLKVPAINVNDAVTKSKFDNLYGCRESLIDGIKRATDVML 214
           G +E+     HH+  + K+  L V A+    +VT              I G K+      
Sbjct: 145 GFAEQVVVSQHHIIPVPKEIPLDVAALVEPLSVTWHAVK---------ISGFKK------ 189

Query: 215 AGKVSVVAGYGDVGKGCAAALRGMG-SRVIVTEI 247
            G  ++V G G +G      L+GMG S+++V+EI
Sbjct: 190 -GSSALVLGAGPIGLCTILVLKGMGASKIVVSEI 222

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.136    0.405 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 12,814,052
Number of extensions: 494148
Number of successful extensions: 943
Number of sequences better than 10.0: 18
Number of HSP's gapped: 962
Number of HSP's successfully gapped: 18
Length of query: 443
Length of database: 16,596,109
Length adjustment: 105
Effective length of query: 338
Effective length of database: 12,961,219
Effective search space: 4380892022
Effective search space used: 4380892022
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 63 (28.9 bits)