Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_47.182521051055352e-72
Sklu_932.11061054996e-67
KLLA0E09273g1051054744e-63
KLLA0E09284g1071054744e-63
CAGL0H08283g1061054605e-61
YOR020C (HSP10)1061034606e-61
Scas_699.28*1061054536e-60
AEL235W104913782e-48
YHR208W (BAT1)39354650.38
KLLA0E04411g60059650.40
CAGL0M00176g37155602.0
Sklu_1951.317830592.1
ADR182W58525565.4
Sklu_2362.239754559.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_47.18252
         (105 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_47.18252                                                         210   2e-72
Sklu_932.1 YOR020C, Contig c932 254-574 reverse complement            196   6e-67
KLLA0E09273g complement(829846..830163) highly similar to sp|P38...   187   4e-63
KLLA0E09284g complement(829846..>830169) highly similar to sp|P3...   187   4e-63
CAGL0H08283g complement(812738..813058) highly similar to sp|P38...   181   5e-61
YOR020C (HSP10) [4833] chr15 complement(370523..370843) Mitochon...   181   6e-61
Scas_699.28*                                                          179   6e-60
AEL235W [2271] [Homologous to ScYOR020C (HSP10) - SH] complement...   150   2e-48
YHR208W (BAT1) [2493] chr8 (517530..518711) Mitochondrial branch...    30   0.38 
KLLA0E04411g 404611..406413 similar to sp|P40032 Saccharomyces c...    30   0.40 
CAGL0M00176g complement(24106..25221) highly similar to sp|P4717...    28   2.0  
Sklu_1951.3 YMR035W, Contig c1951 3521-4057 reverse complement         27   2.1  
ADR182W [1923] [Homologous to ScYML013W - SH] complement(1022135...    26   5.4  
Sklu_2362.2 YHR208W, Contig c2362 6995-8188 reverse complement         26   9.2  

>Kwal_47.18252
          Length = 105

 Score =  210 bits (535), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 105/105 (100%), Positives = 105/105 (100%)

Query: 1   MSTLIKSAKSIVPLMDRVLVQRVKAEAKTASGLYLPEKNVQKLNQATVLAVGPGFTDANG 60
           MSTLIKSAKSIVPLMDRVLVQRVKAEAKTASGLYLPEKNVQKLNQATVLAVGPGFTDANG
Sbjct: 1   MSTLIKSAKSIVPLMDRVLVQRVKAEAKTASGLYLPEKNVQKLNQATVLAVGPGFTDANG 60

Query: 61  NKVTPQVQPGDNVLIPQFGGSSIKLKDDDEVILFRDSEILAKLNE 105
           NKVTPQVQPGDNVLIPQFGGSSIKLKDDDEVILFRDSEILAKLNE
Sbjct: 61  NKVTPQVQPGDNVLIPQFGGSSIKLKDDDEVILFRDSEILAKLNE 105

>Sklu_932.1 YOR020C, Contig c932 254-574 reverse complement
          Length = 106

 Score =  196 bits (499), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 97/105 (92%), Positives = 103/105 (98%)

Query: 1   MSTLIKSAKSIVPLMDRVLVQRVKAEAKTASGLYLPEKNVQKLNQATVLAVGPGFTDANG 60
           MSTLIKSAKSIVPL+DRVLVQR+KAEAKTASGLYLPEKNVQKLNQATVLAVGPGFTDA+G
Sbjct: 1   MSTLIKSAKSIVPLLDRVLVQRIKAEAKTASGLYLPEKNVQKLNQATVLAVGPGFTDASG 60

Query: 61  NKVTPQVQPGDNVLIPQFGGSSIKLKDDDEVILFRDSEILAKLNE 105
           NKVTPQV+ GD VLIPQFGGSSIKLKDDDEVILFRDSEILAK+N+
Sbjct: 61  NKVTPQVKVGDQVLIPQFGGSSIKLKDDDEVILFRDSEILAKIND 105

>KLLA0E09273g complement(829846..830163) highly similar to sp|P38910
           Saccharomyces cerevisiae YOR020c HSP10 chaperonin,
           mitochondrial singleton, start by similarity
          Length = 105

 Score =  187 bits (474), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 90/105 (85%), Positives = 99/105 (94%)

Query: 1   MSTLIKSAKSIVPLMDRVLVQRVKAEAKTASGLYLPEKNVQKLNQATVLAVGPGFTDANG 60
           MSTL+KSAKSIVPL+DRVLVQR+KAEAKTASGLYLPEKNV+KLNQATVLA GPGFTD+NG
Sbjct: 1   MSTLLKSAKSIVPLLDRVLVQRIKAEAKTASGLYLPEKNVEKLNQATVLAAGPGFTDSNG 60

Query: 61  NKVTPQVQPGDNVLIPQFGGSSIKLKDDDEVILFRDSEILAKLNE 105
           NK+TP VQPGD VLIPQFGGS+IKL  DDEV+LFRDSEILAK+ E
Sbjct: 61  NKITPSVQPGDQVLIPQFGGSTIKLGKDDEVVLFRDSEILAKVVE 105

>KLLA0E09284g complement(829846..>830169) highly similar to
           sp|P38910 Saccharomyces cerevisiae YOR020c HSP10
           chaperonin, mitochondrial, start by similarity
          Length = 107

 Score =  187 bits (474), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 90/105 (85%), Positives = 99/105 (94%)

Query: 1   MSTLIKSAKSIVPLMDRVLVQRVKAEAKTASGLYLPEKNVQKLNQATVLAVGPGFTDANG 60
           MSTL+KSAKSIVPL+DRVLVQR+KAEAKTASGLYLPEKNV+KLNQATVLA GPGFTD+NG
Sbjct: 3   MSTLLKSAKSIVPLLDRVLVQRIKAEAKTASGLYLPEKNVEKLNQATVLAAGPGFTDSNG 62

Query: 61  NKVTPQVQPGDNVLIPQFGGSSIKLKDDDEVILFRDSEILAKLNE 105
           NK+TP VQPGD VLIPQFGGS+IKL  DDEV+LFRDSEILAK+ E
Sbjct: 63  NKITPSVQPGDQVLIPQFGGSTIKLGKDDEVVLFRDSEILAKVVE 107

>CAGL0H08283g complement(812738..813058) highly similar to sp|P38910
           Saccharomyces cerevisiae YOR020c HSP10, start by
           similarity
          Length = 106

 Score =  181 bits (460), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 88/105 (83%), Positives = 99/105 (94%)

Query: 1   MSTLIKSAKSIVPLMDRVLVQRVKAEAKTASGLYLPEKNVQKLNQATVLAVGPGFTDANG 60
           MSTL+KSAKSIVPLMDRVLVQR+KAEAKTASGL+LPEKNV+KLNQA V+AVGPGFTDANG
Sbjct: 1   MSTLLKSAKSIVPLMDRVLVQRIKAEAKTASGLFLPEKNVEKLNQAKVVAVGPGFTDANG 60

Query: 61  NKVTPQVQPGDNVLIPQFGGSSIKLKDDDEVILFRDSEILAKLNE 105
           NKVTPQV  GD VLIPQFGGS++KL +D+EVILFRDSEILAK+ +
Sbjct: 61  NKVTPQVSVGDQVLIPQFGGSTLKLANDEEVILFRDSEILAKIKD 105

>YOR020C (HSP10) [4833] chr15 complement(370523..370843)
           Mitochondrial chaperonin that cooperates with Hsp60p,
           counterpart of E. coli GroES [321 bp, 106 aa]
          Length = 106

 Score =  181 bits (460), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 88/103 (85%), Positives = 98/103 (95%)

Query: 1   MSTLIKSAKSIVPLMDRVLVQRVKAEAKTASGLYLPEKNVQKLNQATVLAVGPGFTDANG 60
           MSTL+KSAKSIVPLMDRVLVQR+KA+AKTASGLYLPEKNV+KLNQA V+AVGPGFTDANG
Sbjct: 1   MSTLLKSAKSIVPLMDRVLVQRIKAQAKTASGLYLPEKNVEKLNQAEVVAVGPGFTDANG 60

Query: 61  NKVTPQVQPGDNVLIPQFGGSSIKLKDDDEVILFRDSEILAKL 103
           NKV PQV+ GD VLIPQFGGS+IKL +DDEVILFRD+EILAK+
Sbjct: 61  NKVVPQVKVGDQVLIPQFGGSTIKLGNDDEVILFRDAEILAKI 103

>Scas_699.28*
          Length = 106

 Score =  179 bits (453), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 86/105 (81%), Positives = 98/105 (93%)

Query: 1   MSTLIKSAKSIVPLMDRVLVQRVKAEAKTASGLYLPEKNVQKLNQATVLAVGPGFTDANG 60
           M+T++KSA+SIVPLMDRVLVQRVKAEAKTASG+ LPEKNV+KLNQA VLAVGPGFTDANG
Sbjct: 1   MATILKSARSIVPLMDRVLVQRVKAEAKTASGILLPEKNVEKLNQAKVLAVGPGFTDANG 60

Query: 61  NKVTPQVQPGDNVLIPQFGGSSIKLKDDDEVILFRDSEILAKLNE 105
           NKV PQV+ GD VLIPQ+GGS+IKL  DDEV+LFRDSEILAK+N+
Sbjct: 61  NKVVPQVKIGDQVLIPQYGGSAIKLSGDDEVVLFRDSEILAKIND 105

>AEL235W [2271] [Homologous to ScYOR020C (HSP10) - SH]
          complement(191997..192311) [315 bp, 104 aa]
          Length = 104

 Score =  150 bits (378), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 81/91 (89%)

Query: 3  TLIKSAKSIVPLMDRVLVQRVKAEAKTASGLYLPEKNVQKLNQATVLAVGPGFTDANGNK 62
          + +KSAKSIVPLMDRVLVQR+KAE KT+SGLYLPEKNV+KLNQATVLAVGPG+TDA G +
Sbjct: 2  SFLKSAKSIVPLMDRVLVQRIKAEDKTSSGLYLPEKNVEKLNQATVLAVGPGYTDAQGRQ 61

Query: 63 VTPQVQPGDNVLIPQFGGSSIKLKDDDEVIL 93
          V+P VQ GD VLIPQFGGSSIKL  DDEV+ 
Sbjct: 62 VSPSVQVGDKVLIPQFGGSSIKLGKDDEVLC 92

>YHR208W (BAT1) [2493] chr8 (517530..518711) Mitochondrial
           branched-chain amino acid transaminase [1182 bp, 393 aa]
          Length = 393

 Score = 29.6 bits (65), Expect = 0.38,   Method: Composition-based stats.
 Identities = 14/54 (25%), Positives = 29/54 (53%)

Query: 33  LYLPEKNVQKLNQATVLAVGPGFTDANGNKVTPQVQPGDNVLIPQFGGSSIKLK 86
           ++ P+KN+ ++N++      P F      K+T ++   D  L+PQ  G S+ ++
Sbjct: 108 MFRPDKNMARMNKSAARICLPTFESEELIKLTGKLIEQDKHLVPQGNGYSLYIR 161

>KLLA0E04411g 404611..406413 similar to sp|P40032 Saccharomyces
           cerevisiae YER049w singleton, start by similarity
          Length = 600

 Score = 29.6 bits (65), Expect = 0.40,   Method: Composition-based stats.
 Identities = 19/59 (32%), Positives = 33/59 (55%)

Query: 10  SIVPLMDRVLVQRVKAEAKTASGLYLPEKNVQKLNQATVLAVGPGFTDANGNKVTPQVQ 68
           +I  L+D  L+Q V+ E +T+      E ++ K+NQ+  LA   G  DA+ +K+   V+
Sbjct: 60  TIRDLVDPNLLQEVRREIETSIHFTQKETDIYKVNQSGDLANLSGLDDADLSKLPSLVK 118

>CAGL0M00176g complement(24106..25221) highly similar to sp|P47176
           Saccharomyces cerevisiae YJR148w TWT2 or sp|P38891
           Saccharomyces cerevisiae YHR208w TWT1, hypothetical
           start
          Length = 371

 Score = 27.7 bits (60), Expect = 2.0,   Method: Composition-based stats.
 Identities = 14/55 (25%), Positives = 29/55 (52%)

Query: 32  GLYLPEKNVQKLNQATVLAVGPGFTDANGNKVTPQVQPGDNVLIPQFGGSSIKLK 86
            ++ PEKN++++N++      P F      K+  ++   D  LIP+  G S+ ++
Sbjct: 85  AMFRPEKNMERMNKSAARICLPTFDGEELIKLIGKLIELDKHLIPEGEGYSLYIR 139

>Sklu_1951.3 YMR035W, Contig c1951 3521-4057 reverse complement
          Length = 178

 Score = 27.3 bits (59), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 19/30 (63%)

Query: 66 QVQPGDNVLIPQFGGSSIKLKDDDEVILFR 95
          QV P D VL+ +FG  +I     ++V+LF+
Sbjct: 50 QVSPTDWVLLWKFGAKNINNLKKNDVVLFK 79

>ADR182W [1923] [Homologous to ScYML013W - SH]
           complement(1022135..1023892) [1758 bp, 585 aa]
          Length = 585

 Score = 26.2 bits (56), Expect = 5.4,   Method: Composition-based stats.
 Identities = 11/25 (44%), Positives = 16/25 (64%)

Query: 72  NVLIPQFGGSSIKLKDDDEVILFRD 96
           +V   Q    +I+L DDDEV+ F+D
Sbjct: 472 DVFATQILNKAIELSDDDEVLCFKD 496

>Sklu_2362.2 YHR208W, Contig c2362 6995-8188 reverse complement
          Length = 397

 Score = 25.8 bits (55), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 12/54 (22%), Positives = 29/54 (53%)

Query: 33  LYLPEKNVQKLNQATVLAVGPGFTDANGNKVTPQVQPGDNVLIPQFGGSSIKLK 86
           ++ P+KN++++N++      P F      K+  ++   D  L+P+  G S+ ++
Sbjct: 111 MFRPDKNMERMNKSAARICLPTFESEELIKLIGKLIEQDKRLVPEGQGYSLYIR 164

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.313    0.132    0.355 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 3,323,421
Number of extensions: 135254
Number of successful extensions: 295
Number of sequences better than 10.0: 22
Number of HSP's gapped: 295
Number of HSP's successfully gapped: 22
Length of query: 105
Length of database: 16,596,109
Length adjustment: 76
Effective length of query: 29
Effective length of database: 13,965,141
Effective search space: 404989089
Effective search space used: 404989089
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 54 (25.4 bits)