Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_47.1824942340519870.0
CAGL0M08976g4564308221e-106
Scas_660.314804278151e-104
YDR473C (PRP3)4694277419e-94
KLLA0E09251g4244186892e-86
AEL234C4004026027e-74
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_47.18249
         (418 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_47.18249                                                         769   0.0  
CAGL0M08976g 893866..895236 similar to tr|Q03338 Saccharomyces c...   321   e-106
Scas_660.31                                                           318   e-104
YDR473C (PRP3) [1290] chr4 complement(1404433..1405842) Pre-mRNA...   290   9e-94
KLLA0E09251g 828244..829518 similar to sgd|S0002881 Saccharomyce...   270   2e-86
AEL234C [2272] [Homologous to ScYDR473C (PRP3) - SH] (192343..19...   236   7e-74

>Kwal_47.18249
          Length = 423

 Score =  769 bits (1987), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/405 (92%), Positives = 376/405 (92%)

Query: 14  RADHHSKVGTGLNVEIHPALLSENVNLIRHRDNPYLSHETPSTVDKKVAKRYSRGLKFHT 73
           RADHHSKVGTGLNVEIHPALLSENVNLIRHRDNPYLSHETPSTVDKKVAKRYSRGLKFHT
Sbjct: 14  RADHHSKVGTGLNVEIHPALLSENVNLIRHRDNPYLSHETPSTVDKKVAKRYSRGLKFHT 73

Query: 74  PGALTKRLQEERAQIAKEQELQKERDEIKKAKVRSGELPDELIGEQNYLINEVPEIEWWD 133
           PGALTKRLQEERAQIAKEQELQKERDEIKKAKVRSGELPDELIGEQNYLINEVPEIEWWD
Sbjct: 74  PGALTKRLQEERAQIAKEQELQKERDEIKKAKVRSGELPDELIGEQNYLINEVPEIEWWD 133

Query: 134 AIYVNNLLDWSIKEKYTKEAETMDIXXXXXXXXXXXLPTIRYVQHPVPLQSEPTTLKMPK 193
           AIYVNNLLDWSIKEKYTKEAETMDI           LPTIRYVQHPVPLQSEPTTLKMPK
Sbjct: 134 AIYVNNLLDWSIKEKYTKEAETMDIDSEEGDDSGSELPTIRYVQHPVPLQSEPTTLKMPK 193

Query: 194 VYLVXXXXXXXXXXXXXXXXXXHEQKVRLGLEPKPAPKVKLSNMMNVYQNTENITDPTSW 253
           VYLV                  HEQKVRLGLEPKPAPKVKLSNMMNVYQNTENITDPTSW
Sbjct: 194 VYLVKREQKKLRRNRRKLLREEHEQKVRLGLEPKPAPKVKLSNMMNVYQNTENITDPTSW 253

Query: 254 EQTVKAGVEERHKKHVETNLRRHFEAKERKQEKSAEKSSSPTDLCCRVFRFTGLRNPKIR 313
           EQTVKAGVEERHKKHVETNLRRHFEAKERKQEKSAEKSSSPTDLCCRVFRFTGLRNPKIR
Sbjct: 254 EQTVKAGVEERHKKHVETNLRRHFEAKERKQEKSAEKSSSPTDLCCRVFRFTGLRNPKIR 313

Query: 314 FKLAKNSRQLGMRGVCLRVGDGPGILVVIGTEKNCRFYSKLVLQRLKWSEPYVDSATNQL 373
           FKLAKNSRQLGMRGVCLRVGDGPGILVVIGTEKNCRFYSKLVLQRLKWSEPYVDSATNQL
Sbjct: 314 FKLAKNSRQLGMRGVCLRVGDGPGILVVIGTEKNCRFYSKLVLQRLKWSEPYVDSATNQL 373

Query: 374 IDCSKDKSELVWEGILKETKFRGWFMKQCESEDELKSTLAQFDAD 418
           IDCSKDKSELVWEGILKETKFRGWFMKQCESEDELKSTLAQFDAD
Sbjct: 374 IDCSKDKSELVWEGILKETKFRGWFMKQCESEDELKSTLAQFDAD 418

>CAGL0M08976g 893866..895236 similar to tr|Q03338 Saccharomyces
           cerevisiae YDR473c essential splicing factor,
           hypothetical start
          Length = 456

 Score =  321 bits (822), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 180/430 (41%), Positives = 256/430 (59%), Gaps = 37/430 (8%)

Query: 20  KVGTGLNVEIHPALLSENVNLIRHRD---NPYLSHETPSTVDKKVAKRYSRGLKFHTPGA 76
           + G GL+VE+HPAL S N N+I+ +    NPYLS       + KV K+Y  GL+F+  G 
Sbjct: 12  RSGRGLDVELHPALASSNANIIKAQQKQVNPYLSD--IGQQNGKVFKKYKDGLRFYKKGE 69

Query: 77  LTKRLQEERAQIA---KEQELQKERD--------EIKKAKVRSGELPDELIGEQNYL--I 123
           ++ +L +ER ++A   KE+EL+   +        E K+ ++ + E+PD+ IGE+ Y+   
Sbjct: 70  ISAQLHKEREELARRLKEEELRAAAEKAHRVSLAEQKRERIANAEIPDDSIGEELYMQRF 129

Query: 124 NEVPEIEWWDAIYVNNLLDWSIKEKYTKE------------AETMDIXXXXXXXXXXXLP 171
            ++P  EWWD  Y++     +I  KYT E                 +            P
Sbjct: 130 KDIPNYEWWDESYLDK--SGNILPKYTTEYPEDMDSDYDSDDMNSGVECMKSQTEETGPP 187

Query: 172 TIRYVQHPVPLQSEPTTLKMPKVYLVXXXXXXXXXXXXXXXXXXHEQKVRLGLEPKPAPK 231
           +IRYVQHPVP++  P  +  PK+YL                      KV+LGLEPKP  K
Sbjct: 188 SIRYVQHPVPIKI-PEEITAPKMYLTKLEHKKARRRNRKLQREEKMAKVQLGLEPKPETK 246

Query: 232 VKLSNMMNVYQNTENITDPTSWEQTVKAGVEERHKKHVETNLRRHFEAKERKQEKSAEKS 291
           VKLSNMMNV  N +NI+DPT+WE  VK  +EER ++H++ N +RH EA  RK+ K +++ 
Sbjct: 247 VKLSNMMNVLDNNKNISDPTAWENMVKDQIEERRQRHIQENEKRHEEAVLRKKSKVSDQI 306

Query: 292 SSPTDLCCRVFRFTGLRNPKIRFKLAKNSRQLGMRGVCLRVGD-GPGILVVIGTEKNCRF 350
               DL C+ F F  L+NPKIR+KL  NS+QL ++G CLRVG+ GPGI+VVIG EK+C F
Sbjct: 307 EGSEDLFCKAFYFQSLQNPKIRYKLKMNSQQLNLKGFCLRVGEGGPGIIVVIGKEKSCNF 366

Query: 351 YSKLVLQRLKWSEPY-VDSATN--QLIDCSKDKSELVWEGILKETKFRGWFMKQCESEDE 407
           Y KLV  R+KW+E + +  ATN  +LID + + +  +W+G+LKETK R WFMK C++EDE
Sbjct: 367 YKKLVCTRIKWNENFKIKDATNNGELIDMTGNYAVEIWDGLLKETKLRNWFMKICQTEDE 426

Query: 408 LKSTLAQFDA 417
           +K+ L Q DA
Sbjct: 427 MKNILQQNDA 436

>Scas_660.31
          Length = 480

 Score =  318 bits (815), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 182/427 (42%), Positives = 257/427 (60%), Gaps = 33/427 (7%)

Query: 20  KVGTGLNVEIHPALLSENVNLIR---HRDNPYLSHETPST-VDKKVAKRYSRGLKFHTPG 75
           K G GLN EIHPALL+ N+N IR   H DNPYLS     T  + K+ KRY RGL F   G
Sbjct: 45  KEGRGLNTEIHPALLTSNLNFIREQQHNDNPYLSTLNKHTGYENKIHKRYQRGLSFFQKG 104

Query: 76  ALTKRLQEERAQIAKEQELQKER-------------DEIKKAKVRSGELPDELIGEQNYL 122
            ++ ++ +ER Q+ +E EL++ R             D+ ++ K+  GELPD  +GE  Y+
Sbjct: 105 EISSKISDER-QVQRE-ELERNRQFNEREKIRLEKEDKKRRIKIERGELPDLELGEDKYI 162

Query: 123 I--NEVPEIEWWDAIYVNNLLDWSIKEKYTKEAETMDIXXXXXXXXXXXLPTIRYVQHPV 180
           +  + VP +EWWD  ++       I +KY+      +             P+IRY+QHPV
Sbjct: 163 LKASSVPTVEWWDLPFLEEK-SLQILDKYSMPYPNDEDFISDEGDVEEIHPSIRYIQHPV 221

Query: 181 PLQSEPTTLKMPKVYLVXXXXXXXXXXXXXXXXXXHEQKVRLGLEPKPAPKVKLSNMMNV 240
           P++ E   +K  K+YL                    E+K++LGLEPKP PKVKLSNMMNV
Sbjct: 222 PIKVEEVKIK-DKIYLTKKEQKKVRRNTRKLIRQEKEEKIKLGLEPKPLPKVKLSNMMNV 280

Query: 241 YQNTENITDPTSWEQTVKAGVEERHKK-HVETNLRRHFEAKERKQEKSA---EKSSSPTD 296
           ++N +NITDPT+WE TVK  V  R +K   E N R     + RK+E+++    K+ + T 
Sbjct: 281 FENNQNITDPTTWETTVKQQVNARMRKHEEENNERHELAVRRRKEERNSMLGNKNQTTTQ 340

Query: 297 L--CCRVFRFTGLRNPKIRFKLAKNSRQLGMRGVCLRVGD-GPGILVVIGTEKNCRFYSK 353
           L  CC+VF F  LRNPKIR+KL  N++QL ++G  +R+GD GPGI++VIGTEK+C+F+  
Sbjct: 341 LESCCKVFWFKNLRNPKIRYKLKTNAKQLDLKGFSIRLGDPGPGIIIVIGTEKSCKFFEN 400

Query: 354 LVLQRLKWSEPYVDS---ATNQLIDCSKDKSELVWEGILKETKFRGWFMKQCESEDELKS 410
           LVL+R+KWSE + D     + +++D S +++E VWEG LKE KF  WFM+ C ++DE K 
Sbjct: 401 LVLRRIKWSENFKDQNIENSERVVDQSGNRAEKVWEGYLKEHKFPRWFMRACANDDEFKG 460

Query: 411 TLAQFDA 417
            L +FDA
Sbjct: 461 ILEKFDA 467

>YDR473C (PRP3) [1290] chr4 complement(1404433..1405842) Pre-mRNA
           splicing factor required for stability of U4/U6 snRNPs
           and for assembly of U4/U6.U5 triplex snRNP particle from
           U4/U6 and U5 snRNPs [1410 bp, 469 aa]
          Length = 469

 Score =  290 bits (741), Expect = 9e-94,   Method: Compositional matrix adjust.
 Identities = 167/427 (39%), Positives = 243/427 (56%), Gaps = 34/427 (7%)

Query: 22  GTGLNVEIHPALLSENVNLIRHR----DNPYLSHETPSTVDKKVAKRYSRGLKFHTPGAL 77
           G GL  E+H AL S N+NLIR      +NPYLS         +  +RY RGLKF+  G +
Sbjct: 39  GHGLKTELHSALKSSNLNLIRRTYQTGENPYLSDPHDRGSSSRFNRRYERGLKFYQKGEI 98

Query: 78  TKRLQEERAQIAKEQE-------LQKERDEIKKAK-VRSGELPDELIGEQNYLIN----- 124
           +KR+ +ER  + K+QE       L++E DE  K K + SG+LP+  + E  +L++     
Sbjct: 99  SKRIAQERT-LQKQQEEEELKRKLKQEEDEKDKRKLIESGDLPNLELHEDKFLLDLSKFK 157

Query: 125 ----EVPEIEWWDAIYVNNLLDWSIKEKYT------KEAETMDIXXXXXXXXXXXLPTIR 174
                    EWWD  Y++      + EKY        E +  +             P+IR
Sbjct: 158 IYYDNNHGYEWWDTAYLDE--KGELMEKYDMNGTSPAEEKLAEDIDEVDDDDDDEHPSIR 215

Query: 175 YVQHPVPLQSEPTTLKMPKVYLVXXXXXXXXXXXXXXXXXXHEQKVRLGLEPKPAPKVKL 234
           YV HP+P +     + + K YL                    E K++LGL PKP PKVKL
Sbjct: 216 YVAHPLPEKINEAKVSI-KAYLTQHERKRLRRNRRKMAREAREIKIKLGLLPKPEPKVKL 274

Query: 235 SNMMNVYQNTENITDPTSWEQTVKAGVEERHKKHVETNLRRHFEAKERKQEKSAEKSSSP 294
           SNMM+V++N +NITDPT+WE+ VK  V+ R +KH+E N RRH +A +R++E        P
Sbjct: 275 SNMMSVFENDQNITDPTAWEKVVKDQVDLRKRKHLEENERRHEDAIKRRKEAVNMNVEKP 334

Query: 295 TDLCCRVFRFTGLRNPKIRFKLAKNSRQLGMRGVCLRV-GDGPGILVVIGTEKNCRFYSK 353
           T   C+VF+F  L+NPKIRFKL  NS++L ++G+CLR+  DGPGI++V+G EK+C+FY  
Sbjct: 335 TVYHCKVFQFKNLQNPKIRFKLKMNSKELSLKGLCLRIRDDGPGIIIVVGNEKSCKFYEN 394

Query: 354 LVLQRLKWSEPY-VDSATNQL-IDCSKDKSELVWEGILKETKFRGWFMKQCESEDELKST 411
           LV++R+KW+E + + + T  + +D   +     WEG L++ KF+GWFMK C  +D L  T
Sbjct: 395 LVMKRIKWNEDFELHTNTGDIKMDMHNNSISKTWEGYLQDCKFKGWFMKVCNDQDSLLRT 454

Query: 412 LAQFDAD 418
           L QFD++
Sbjct: 455 LGQFDSE 461

>KLLA0E09251g 828244..829518 similar to sgd|S0002881 Saccharomyces
           cerevisiae YDR473c PRP3 essential splicing factor,
           hypothetical start
          Length = 424

 Score =  270 bits (689), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 156/418 (37%), Positives = 235/418 (56%), Gaps = 36/418 (8%)

Query: 24  GLNVEIHPALLSENVNLIRHRD----NPYLSHETPSTVDKKVAKRYSRGLKFHTPGALTK 79
           GLN ++H AL  ENVNL+R +     NPYL        + K   R S    ++ PG + +
Sbjct: 10  GLNRKLHSALSVENVNLLRFQGRRCGNPYLQDVQAHGFEPKA--RVSS--HWYEPGEVVQ 65

Query: 80  ---------RLQEERAQIAKEQELQKERDEIKKAKVRSGELPDELIGEQNYL--INEVPE 128
                    R + E  +I  E EL+K++ EI++ K+  GELPD+   E+ Y   +++VP+
Sbjct: 66  HAAKLRQENREKSEEERIRWEAELEKQQ-EIER-KIEIGELPDK--HEEVYFTDLSDVPD 121

Query: 129 IEWWDAIYVNNLLDWSIKEKYTKEAETMDIXXXXXXX-------XXXXLPTIRYVQHPVP 181
           +EWWD  Y+    D SI EKY+ +  T++                    P+IRY+QHPVP
Sbjct: 122 VEWWDVPYIK---DGSIHEKYSLDYSTLNSDDESDDEEEEEEEGAQDKFPSIRYIQHPVP 178

Query: 182 LQSEPTTLKMPKVYLVXXXXXXXXXXXXXXXXXXHEQKVRLGLEPKPAPKVKLSNMMNVY 241
           ++     + + +++L                    E+K++LG+EPKP PKVKLSNMMNVY
Sbjct: 179 IERPRAAVPVAEIFLTKNERKKARRNTRKLVRQEKEEKIKLGIEPKPEPKVKLSNMMNVY 238

Query: 242 QNTENITDPTSWEQTVKAGVEERHKKHVETNLRRHFEAKERKQEK--SAEKSSSPTDLCC 299
           +N  NI DPT WE  V+  V ER +KH E N  RH E+ +R++E    A  + SP +  C
Sbjct: 239 ENDANIADPTQWESIVRRQVAERKRKHFEENEIRHQESLKRRKESQLQAHSNDSPLEYTC 298

Query: 300 RVFRFTGLRNPKIRFKLAKNSRQLGMRGVCLRVGDGPGILVVIGTEKNCRFYSKLVLQRL 359
            V+ F  ++NP IR+K+  N +QL ++G CL + +G GI+V  G EK+ RF+ KLV +R+
Sbjct: 299 VVYMFDEIQNPSIRYKIKTNGKQLKLKGCCLHIQNGKGIIVAFGDEKSIRFFDKLVTKRI 358

Query: 360 KWSEPYVDSATNQLIDCSKDKSELVWEGILKETKFRGWFMKQCESEDELKSTLAQFDA 417
            WSEPY D  T + + C   K   VW+G++ + +F+GWFM  C+ +++L + L Q DA
Sbjct: 359 NWSEPYKDRDTEETVPCD-GKITKVWQGLIGDCRFKGWFMLDCKDKNQLNNILEQHDA 415

>AEL234C [2272] [Homologous to ScYDR473C (PRP3) - SH]
           (192343..193545) [1203 bp, 400 aa]
          Length = 400

 Score =  236 bits (602), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 147/402 (36%), Positives = 216/402 (53%), Gaps = 36/402 (8%)

Query: 24  GLNVEIHPALLSENVNLIRH-RDNPYLSHETPSTVDKKVAKRYSRGLKFHTPGALTKRLQ 82
           GL  EIHPAL S N+NL+R  R+NPYLS + P    ++   +  + L F+ PG +++R +
Sbjct: 8   GLATEIHPALRSSNLNLLRSKRENPYLSSDAP----RQRQPKRRQPLAFYKPGEISQRAE 63

Query: 83  EERAQIAKE---QEL----QKERDEIKKAKVRSGELPDELIGEQNYL--INEVPEIEWWD 133
           EER + A+E   Q+L    Q+E + I++ K+ + ELPD+   E  Y   I+ +P IEWWD
Sbjct: 64  EERQRRARELEEQQLLLRKQEEEEHIRREKIAAAELPDD--DETCYFDAISALPSIEWWD 121

Query: 134 AIYVNNLLDWSIKEKYTKE-AETMDIXXXXXXXXXXXLPTIRYVQHPVPLQSEPTTLK-- 190
             + +     +   KYT   A+  D             P+IR+V+HP+P Q   T     
Sbjct: 122 TKFCDGSQP-AAHAKYTASYADLEDDSDCSDDEQEDERPSIRFVKHPLPFQPSVTAAATI 180

Query: 191 MPKVYLVXXXXXXXXXXXXXXXXXXHEQKVRLGLEPKPAPKVKLSNMMNVYQNTENITDP 250
           +PK+YL                    E+++RLGLEP+P PKV+L+NMM+VY +   I DP
Sbjct: 181 VPKIYLTKHEQRKVRRNQRKTARQMAEERIRLGLEPRPPPKVRLNNMMHVYDSNTKIQDP 240

Query: 251 TSWEQTVKAGVEERHKKHVETNLRRHFEAKERKQEKSAEKSSSPTDLCCRVFRFTGLRNP 310
           T+WE TV+  +E+R ++H+ TN  R  EA+ ++  + A       D+ CRV+    L +P
Sbjct: 241 TAWEHTVREQIEQRRQQHLRTNEERRLEARAQRAAQPAPAPDPGQDI-CRVYSLPPLADP 299

Query: 311 KIRFKLAKNSRQLGMRGVCLRVGDGPGILVVIGTEKNCRFYSKLVLQRLKWSEPYVDSAT 370
           K R+KL  N+RQL +RG CL V DGP ++V IG  + C FY +L+ +RL W         
Sbjct: 300 KARYKLVTNARQLHLRGCCLHVPDGPALVVAIGPPRACTFYDRLLTRRLAW--------- 350

Query: 371 NQLIDCSKDKSELVWEGILKETKFRGWFMKQCESEDELKSTL 412
                       L+W G      FRGWFMKQC    +L+  L
Sbjct: 351 ------HASAPALLWTGAAAGHTFRGWFMKQCAEPADLRRIL 386

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.132    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 12,664,188
Number of extensions: 520008
Number of successful extensions: 2625
Number of sequences better than 10.0: 32
Number of HSP's gapped: 2642
Number of HSP's successfully gapped: 32
Length of query: 418
Length of database: 16,596,109
Length adjustment: 104
Effective length of query: 314
Effective length of database: 12,995,837
Effective search space: 4080692818
Effective search space used: 4080692818
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 63 (28.9 bits)