Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_47.1824123022812071e-171
KLLA0F02662g2532295552e-71
AEL232C3092365446e-69
Sklu_2365.21971212067e-20
Kwal_27.118721971211858e-17
Sklu_1358.12181381814e-16
CAGL0L12826g1991231796e-16
Scas_567.91991241771e-15
AGL261W1981221655e-14
ACL078W1811181647e-14
Scas_697.54*1811171621e-13
KLLA0C13563g1821261594e-13
YOR094W (ARF3)1831171551e-12
YPL051W (ARL3)1981211552e-12
Kwal_23.29441841171542e-12
Scas_680.211831271532e-12
YMR138W (CIN4)1911231532e-12
Sklu_2320.21641191513e-12
KLLA0F17072g1901151533e-12
KLLA0E12837g1991261524e-12
Kwal_47.178571981281481e-11
CAGL0I00858g1971321472e-11
ADR094W1811161443e-11
Kwal_56.244621811171444e-11
KLLA0F05225g1811161436e-11
CAGL0J09064g1811181436e-11
Kwal_56.244531811161411e-10
YDL137W (ARF2)1811181411e-10
ADR251W2201191421e-10
YDL192W (ARF1)1811181401e-10
Scas_624.4*1811181392e-10
CAGL0I03916g1811181392e-10
Scas_701.42*1811181392e-10
AFL114W1901161383e-10
KLLA0B02046g1901161374e-10
CAGL0E05896g1891161367e-10
Scas_706.2*1901221331e-09
Kwal_56.224402081441341e-09
YPL218W (SAR1)1901161331e-09
Sklu_1681.21621141294e-09
Kwal_23.29782111461305e-09
Sklu_2373.32081441281e-08
YLR293C (GSP1)2191201281e-08
YOR185C (GSP2)2201201271e-08
YOR089C (VPS21)2101461262e-08
ACR003C2081441262e-08
CAGL0I00594g2141201262e-08
YML001W (YPT7)2081211252e-08
CAGL0J08635g2081191243e-08
Sklu_2285.42141201243e-08
KLLA0C05126g2141201244e-08
KLLA0A04499g2141201244e-08
Scas_586.62191201244e-08
AGR294C2141201234e-08
Scas_674.52081251234e-08
CAGL0E02607g2081221225e-08
YNL093W (YPT53)2201341227e-08
KLLA0F20471g2121211218e-08
Scas_662.262121201218e-08
Kwal_56.233612141201182e-07
ACL084C2071331163e-07
Sklu_2202.61831181153e-07
CAGL0F02123g2151301164e-07
YFL005W (SEC4)2151301164e-07
Kwal_23.50582131301155e-07
KLLA0D01265g2071751155e-07
Scas_707.262101301155e-07
Sklu_2293.32141201148e-07
Kwal_34.161421921501139e-07
CAGL0I10835g1831181121e-06
Kwal_56.24149149831101e-06
KLLA0C13728g2081221121e-06
Scas_700.111831181111e-06
Sklu_1815.22131291121e-06
AGR221W1831171111e-06
Kwal_56.225552121191121e-06
KLLA0D02376g2071291121e-06
AER132W2321391122e-06
Kwal_47.169832231431112e-06
YER031C (YPT31)2231161103e-06
Scas_574.22221161103e-06
YBR164C (ARL1)1831161083e-06
AAL176C2051231075e-06
AGR257C2201201068e-06
CAGL0C02453g2181181061e-05
YCR027C (RHB1)2092031041e-05
YLR262C (YPT6)2151191042e-05
KLLA0E12111g2141201042e-05
CAGL0K06017g2191161042e-05
Scas_712.412191181042e-05
AGL021W2121301032e-05
Sklu_2345.52191451032e-05
KLLA0E24805g1831161013e-05
Sklu_2144.32041181014e-05
Sklu_1653.32561251014e-05
ABR220W2041181005e-05
Scas_656.22181181005e-05
KLLA0D05313g204118996e-05
KLLA0F01232g210128996e-05
AGL093W191126987e-05
YFL038C (YPT1)206118989e-05
YKR014C (YPT52)234150989e-05
CAGL0K12672g206118981e-04
Scas_675.28216125981e-04
Kwal_23.3135191126971e-04
YGL210W (YPT32)222118981e-04
CAGL0K09394g221118971e-04
Kwal_14.2394207124971e-04
Scas_713.5211118971e-04
AER434C219118971e-04
YLR229C (CDC42)191126961e-04
KLLA0A04213g191126952e-04
Kwal_14.1116204118952e-04
CAGL0F05269g191126942e-04
YML064C (TEM1)245124952e-04
YBR264C (YPT10)199129943e-04
Scas_721.96191126933e-04
CAGL0G07689g215124934e-04
Sklu_2238.2207122934e-04
AEL187C208133926e-04
ACL087C187121908e-04
Scas_628.21208128918e-04
Sklu_2366.3218136890.002
Scas_703.41225124880.002
ADL262W270105880.002
Kwal_14.2484203150860.003
CAGL0I09306g206131860.004
Kwal_26.8387292105860.004
YGR152C (RSR1)272119850.006
AFR464W264118840.006
ACR257C259128830.009
KLLA0B05038g223124820.010
Sklu_1816.1188173810.012
CAGL0K08316g32387820.012
YNL098C (RAS2)32271820.013
CAGL0L11242g254123810.015
YOR101W (RAS1)30971810.020
Sklu_2007.2261140800.020
CAGL0E03113g323119810.020
Kwal_33.14452260138800.022
Scas_610.1446267800.029
KLLA0C12001g259118790.032
Kwal_33.14015271123790.033
Scas_697.46324105790.037
Scas_547.3223128780.038
KLLA0A05643g218122780.039
Kwal_55.21941209154770.042
CAGL0B04521g33973780.047
YKR055W (RHO4)291123770.055
ADR402W66135780.056
Kwal_14.2244244118770.058
Sklu_2151.3209155760.068
KLLA0C13816g187165740.097
Kwal_47.19055179105740.100
KLLA0A11330g190121740.10
Scas_575.1027166750.11
CAGL0G05764g290129750.12
Scas_578.7187131730.12
YNL090W (RHO2)192161730.15
Scas_203.2251126730.17
Sklu_1136.118298720.17
Scas_417.3291146730.20
YAL048C662121730.23
CAGL0M12276g64939730.24
Scas_539.165635730.25
AFL002C1151104730.26
Scas_556.741735720.26
ABR183W207140710.28
KLLA0B10626g208128710.28
ABL139C294140710.38
Scas_444.4*289124700.42
CAGL0E03311g339106690.56
ADR093W194114680.57
KLLA0F25916g44796690.59
YER020W (GPA2)44967690.66
ABR158W41538680.81
AAL093C73465680.98
KLLA0A03465g65935680.98
Sklu_2434.1157739680.99
KLLA0A04708g351108671.1
KLLA0D08327g254140661.3
Sklu_1655.1287126651.9
Kwal_55.1977844638633.4
CAGL0I08195g44862633.4
YHR022C25662633.6
AGL046C339109624.5
Scas_689.14697136625.1
KLLA0F18392g58835616.1
Kwal_23.342672666608.4
ADL360C64565608.6
YMR129W (POM152)133778609.1
Kwal_26.681066438609.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_47.18241
         (228 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_47.18241                                                         469   e-171
KLLA0F02662g 241804..242565 some similarities with sp|Q8VEH3 Mus...   218   2e-71
AEL232C [2274] [Homologous to NOHBY] (196356..197285) [930 bp, 3...   214   6e-69
Sklu_2365.2 YPL051W, Contig c2365 827-1420 reverse complement          84   7e-20
Kwal_27.11872                                                          76   8e-17
Sklu_1358.1 YMR138W, Contig c1358 536-1192                             74   4e-16
CAGL0L12826g complement(1370767..1371366) highly similar to tr|Q...    74   6e-16
Scas_567.9                                                             73   1e-15
AGL261W [4051] [Homologous to ScYPL051W (ARL3) - SH] complement(...    68   5e-14
ACL078W [971] [Homologous to ScYOR094W (ARF3) - SH] complement(2...    68   7e-14
Scas_697.54*                                                           67   1e-13
KLLA0C13563g complement(1157278..1157826) highly similar to sp|P...    66   4e-13
YOR094W (ARF3) [4899] chr15 (502795..503346) Protein with simila...    64   1e-12
YPL051W (ARL3) [5389] chr16 (459958..460554) ADP-ribosylation fa...    64   2e-12
Kwal_23.2944                                                           64   2e-12
Scas_680.21                                                            64   2e-12
YMR138W (CIN4) [4095] chr13 (545154..545729) GTP-binding protein...    64   2e-12
Sklu_2320.2 YOR094W, Contig c2320 3571-4065                            63   3e-12
KLLA0F17072g complement(1566668..1567240) similar to sp|P39110 S...    64   3e-12
KLLA0E12837g 1135181..1135780 similar to sgd|S0005972 Saccharomy...    63   4e-12
Kwal_47.17857                                                          62   1e-11
CAGL0I00858g complement(63365..63958) similar to sp|P39110 Sacch...    61   2e-11
ADR094W [1835] [Homologous to ScYDL192W (ARF1) - SH; ScYDL137W (...    60   3e-11
Kwal_56.24462                                                          60   4e-11
KLLA0F05225g 515391..515936 highly similar to sp|P19146 Saccharo...    60   6e-11
CAGL0J09064g 892556..893101 highly similar to sp|P11076 Saccharo...    60   6e-11
Kwal_56.24453                                                          59   1e-10
YDL137W (ARF2) [731] chr4 (216529..217074) GTP-binding protein o...    59   1e-10
ADR251W [1992] [Homologous to ScYMR138W (CIN4) - SH] complement(...    59   1e-10
YDL192W (ARF1) [681] chr4 (116322..116867) GTP-binding protein i...    59   1e-10
Scas_624.4*                                                            58   2e-10
CAGL0I03916g 343014..343559 highly similar to sp|P11076 Saccharo...    58   2e-10
Scas_701.42*                                                           58   2e-10
AFL114W [3081] [Homologous to ScYPL218W (SAR1) - SH] complement(...    58   3e-10
KLLA0B02046g 178646..179218 highly similar to sp|P20606 Saccharo...    57   4e-10
CAGL0E05896g join(complement(585178..585202),complement(584348.....    57   7e-10
Scas_706.2*                                                            56   1e-09
Kwal_56.22440                                                          56   1e-09
YPL218W (SAR1) [5231] chr16 (138697..138724,138864..139408) Comp...    56   1e-09
Sklu_1681.2 YDL137W, Contig c1681 2279-2767                            54   4e-09
Kwal_23.2978                                                           55   5e-09
Sklu_2373.3 YML001W, Contig c2373 10977-11603                          54   1e-08
YLR293C (GSP1) [3684] chr12 complement(720773..721432) Ran, a GT...    54   1e-08
YOR185C (GSP2) [4981] chr15 complement(681444..682106) Ran, a GT...    54   1e-08
YOR089C (VPS21) [4894] chr15 complement(490197..490829) GTP-bind...    53   2e-08
ACR003C [1051] [Homologous to ScYML001W (YPT7) - SH] (359762..36...    53   2e-08
CAGL0I00594g 44835..45479 highly similar to sp|P32835 Saccharomy...    53   2e-08
YML001W (YPT7) [3965] chr13 (267174..267800) GTP-binding protein...    53   2e-08
CAGL0J08635g complement(853978..854604) highly similar to sp|P36...    52   3e-08
Sklu_2285.4 YLR293C, Contig c2285 4349-4993 reverse complement         52   3e-08
KLLA0C05126g complement(463657..464301) highly similar to sp|P32...    52   4e-08
KLLA0A04499g complement(404732..405376) highly similar to sp|P32...    52   4e-08
Scas_586.6                                                             52   4e-08
AGR294C [4605] [Homologous to ScYOR185C (GSP2) - SH; ScYLR293C (...    52   4e-08
Scas_674.5                                                             52   4e-08
CAGL0E02607g complement(248761..249387) highly similar to sp|P32...    52   5e-08
YNL093W (YPT53) [4498] chr14 (449868..450530) GTP-binding protei...    52   7e-08
KLLA0F20471g 1901749..1902387 highly similar to sp|Q99260 Saccha...    51   8e-08
Scas_662.26                                                            51   8e-08
Kwal_56.23361                                                          50   2e-07
ACL084C [965] [Homologous to ScYOR089C (VPS21) - SH; ScYNL093W (...    49   3e-07
Sklu_2202.6 YBR164C, Contig c2202 5407-5958                            49   3e-07
CAGL0F02123g 212117..212764 highly similar to sp|P07560 Saccharo...    49   4e-07
YFL005W (SEC4) [1676] chr6 (130329..130976) GTP-binding protein ...    49   4e-07
Kwal_23.5058                                                           49   5e-07
KLLA0D01265g 110784..111407 highly similar to sp|P32939 Saccharo...    49   5e-07
Scas_707.26                                                            49   5e-07
Sklu_2293.3 YLR262C, Contig c2293 4975-5619                            49   8e-07
Kwal_34.16142                                                          48   9e-07
CAGL0I10835g 1060258..1060809 highly similar to sp|P38116 Saccha...    48   1e-06
Kwal_56.24149                                                          47   1e-06
KLLA0C13728g 1173329..1173955 highly similar to sp|P36017 Saccha...    48   1e-06
Scas_700.11                                                            47   1e-06
Sklu_1815.2 YFL005W, Contig c1815 3148-3789 reverse complement         48   1e-06
AGR221W [4532] [Homologous to ScYBR164C (ARL1) - SH] complement(...    47   1e-06
Kwal_56.22555                                                          48   1e-06
KLLA0D02376g 201512..202135 similar to sp|P36018 Saccharomyces c...    48   1e-06
AER132W [2636] [Homologous to ScYML064C (TEM1) - SH] complement(...    48   2e-06
Kwal_47.16983                                                          47   2e-06
YER031C (YPT31) [1456] chr5 complement(214075..214746) GTP-bindi...    47   3e-06
Scas_574.2                                                             47   3e-06
YBR164C (ARL1) [350] chr2 complement(567832..568383) GTP-binding...    46   3e-06
AAL176C [11] [Homologous to ScYKR014C (YPT52) - SH] (31588..3220...    46   5e-06
AGR257C [4568] [Homologous to ScYLR262C (YPT6) - SH] (1225886..1...    45   8e-06
CAGL0C02453g 247493..248149 highly similar to sp|P38555 Saccharo...    45   1e-05
YCR027C (RHB1) [561] chr3 complement(167365..167994) Protein inv...    45   1e-05
YLR262C (YPT6) [3655] chr12 complement(668246..668893) GTP-bindi...    45   2e-05
KLLA0E12111g 1075299..1075943 highly similar to sp|P07560 Saccha...    45   2e-05
CAGL0K06017g complement(586093..586752) highly similar to sp|Q99...    45   2e-05
Scas_712.41                                                            45   2e-05
AGL021W [4290] [Homologous to ScYFL005W (SEC4) - SH] complement(...    44   2e-05
Sklu_2345.5 YCR027C, Contig c2345 9936-10595                           44   2e-05
KLLA0E24805g 2194554..2195105 highly similar to sp|P38116 Saccha...    44   3e-05
Sklu_2144.3 YFL038C, Contig c2144 4079-4693                            44   4e-05
Sklu_1653.3 YML064C, Contig c1653 2277-3047                            44   4e-05
ABR220W [814] [Homologous to ScYFL038C (YPT1) - SH] complement(8...    43   5e-05
Scas_656.2                                                             43   5e-05
KLLA0D05313g 459496..460110 gi|10129780|emb|CAC08198.1 Kluyverom...    43   6e-05
KLLA0F01232g complement(114430..115062) similar to sp|P36019 Sac...    43   6e-05
AGL093W [4218] [Homologous to ScYLR229C (CDC42) - SH] complement...    42   7e-05
YFL038C (YPT1) [1645] chr6 complement(55365..55985) GTP-binding ...    42   9e-05
YKR014C (YPT52) [3269] chr11 complement(465010..465714) GTP-bind...    42   9e-05
CAGL0K12672g 1255541..1256161 highly similar to sp|P01123 Saccha...    42   1e-04
Scas_675.28                                                            42   1e-04
Kwal_23.3135                                                           42   1e-04
YGL210W (YPT32) [1786] chr7 (93795..94463) GTP-binding protein r...    42   1e-04
CAGL0K09394g complement(929234..929899) highly similar to sp|P51...    42   1e-04
Kwal_14.2394                                                           42   1e-04
Scas_713.5                                                             42   1e-04
AER434C [2934] [Homologous to ScYGL210W (YPT32) - SH; ScYER031C ...    42   1e-04
YLR229C (CDC42) [3629] chr12 complement(604214..604789) Rho-type...    42   1e-04
KLLA0A04213g complement(382243..382818) highly similar to sp|P19...    41   2e-04
Kwal_14.1116                                                           41   2e-04
CAGL0F05269g complement(533759..534334) highly similar to sp|P19...    41   2e-04
YML064C (TEM1) [3905] chr13 complement(145139..145876) GTP-bindi...    41   2e-04
YBR264C (YPT10) [444] chr2 complement(737727..738326) Member of ...    41   3e-04
Scas_721.96                                                            40   3e-04
CAGL0G07689g complement(729919..730566) highly similar to sp|P36...    40   4e-04
Sklu_2238.2 YKR014C, Contig c2238 2956-3579 reverse complement         40   4e-04
AEL187C [2319] [Homologous to ScYBR264C (YPT10) - SH] (284984..2...    40   6e-04
ACL087C [962] [Homologous to ScYNL090W (RHO2) - SH] (191573..192...    39   8e-04
Scas_628.21                                                            40   8e-04
Sklu_2366.3 , Contig c2366 5288-5944 reverse complement                39   0.002
Scas_703.41                                                            39   0.002
ADL262W [1479] [Homologous to ScYOR101W (RAS1) - SH; ScYNL098C (...    39   0.002
Kwal_14.2484                                                           38   0.003
CAGL0I09306g complement(897087..897707) similar to sp|P38146 Sac...    38   0.004
Kwal_26.8387                                                           38   0.004
YGR152C (RSR1) [2106] chr7 complement(794677..795495) GTP-bindin...    37   0.006
AFR464W [3656] [Homologous to ScYGR152C (RSR1) - SH] complement(...    37   0.006
ACR257C [1304] [Homologous to ScYKR055W (RHO4) - SH] (808667..80...    37   0.009
KLLA0B05038g complement(457608..458279) similar to sp|P38987 Sac...    36   0.010
Sklu_1816.1 YNL090W, Contig c1816 115-681                              36   0.012
CAGL0K08316g 838393..839364 some similarities with sp|Q00246 Sac...    36   0.012
YNL098C (RAS2) [4493] chr14 complement(439602..440570) GTP-bindi...    36   0.013
CAGL0L11242g 1197075..1197839 highly similar to sp|P38987 Saccha...    36   0.015
YOR101W (RAS1) [4906] chr15 (515244..516173) GTP-binding protein...    36   0.020
Sklu_2007.2 YNL180C, Contig c2007 789-1574 reverse complement          35   0.020
CAGL0E03113g complement(289164..290135) some similarities with s...    36   0.020
Kwal_33.14452                                                          35   0.022
Scas_610.14                                                            35   0.029
KLLA0C12001g complement(1029092..1029871) similar to sp|P13856 S...    35   0.032
Kwal_33.14015                                                          35   0.033
Scas_697.46                                                            35   0.037
Scas_547.3                                                             35   0.038
KLLA0A05643g 528976..529632 similar to sp|Q00246 Saccharomyces c...    35   0.039
Kwal_55.21941                                                          34   0.042
CAGL0B04521g complement(439732..440751) similar to sp|P01120 Sac...    35   0.047
YKR055W (RHO4) [3306] chr11 (547858..548733) GTP-binding protein...    34   0.055
ADR402W [2142] [Homologous to ScYAL048C - SH] complement(1426900...    35   0.056
Kwal_14.2244                                                           34   0.058
Sklu_2151.3 YPR165W, Contig c2151 2495-3124 reverse complement         34   0.068
KLLA0C13816g 1183412..1183975 highly similar to sp|P06781 Saccha...    33   0.097
Kwal_47.19055                                                          33   0.100
KLLA0A11330g 982552..983124 similar to ca|CA6070|IPF4842 Candida...    33   0.10 
Scas_575.10                                                            33   0.11 
CAGL0G05764g complement(552809..553681) similar to sp|P53879 Sac...    33   0.12 
Scas_578.7                                                             33   0.12 
YNL090W (RHO2) [4501] chr14 (456565..457143) GTP-binding protein...    33   0.15 
Scas_203.2                                                             33   0.17 
Sklu_1136.1 YGL210W, Contig c1136 1284-1832                            32   0.17 
Scas_417.3                                                             33   0.20 
YAL048C (YAL048C) [19] chr1 complement(52804..54792) Protein inv...    33   0.23 
CAGL0M12276g 1223585..1225534 highly similar to sp|P39722 Saccha...    33   0.24 
Scas_539.1                                                             33   0.25 
AFL002C [3191] [Homologous to ScYAL001C (TFC3) - SH] (432329..43...    33   0.26 
Scas_556.7                                                             32   0.26 
ABR183W [776] [Homologous to ScYPR165W (RHO1) - SH] complement(7...    32   0.28 
KLLA0B10626g 936497..937123 gi|22858698|gb|AAN05733.1 Kluyveromy...    32   0.28 
ABL139C [453] [Homologous to ScYNL180C (RHO5) - SH] (134875..135...    32   0.38 
Scas_444.4*                                                            32   0.42 
CAGL0E03311g 305748..306767 highly similar to sp|P53290 Saccharo...    31   0.56 
ADR093W [1834] [Homologous to NOHBY] complement(876839..877423) ...    31   0.57 
KLLA0F25916g 2406597..2407940 gi|12230105|sp|Q9Y7B7|GBA1_KLULA K...    31   0.59 
YER020W (GPA2) [1445] chr5 (195167..196516) Guanine nucleotide-b...    31   0.66 
ABR158W [751] [Homologous to ScYER020W (GPA2) - SH] complement(6...    31   0.81 
AAL093C [94] [Homologous to ScYPL164C (MLH3) - SH] (177137..1793...    31   0.98 
KLLA0A03465g complement(314573..316552) similar to sp|P39722 Sac...    31   0.98 
Sklu_2434.11 YAL048C, Contig c2434 25881-27614 reverse complement      31   0.99 
KLLA0A04708g complement(420317..421372) similar to sp|P53290 Sac...    30   1.1  
KLLA0D08327g 708240..709004 similar to sp|P53879 Saccharomyces c...    30   1.3  
Sklu_1655.1 YKR055W, Contig c1655 395-1258 reverse complement          30   1.9  
Kwal_55.19778                                                          29   3.4  
CAGL0I08195g 797893..799239 similar to sp|P10823 Saccharomyces c...    29   3.4  
YHR022C (YHR022C) [2309] chr8 complement(149567..150337) Protein...    29   3.6  
AGL046C [4265] [Homologous to ScYGR163W (GTR2) - SH] (619357..62...    28   4.5  
Scas_689.14                                                            28   5.1  
KLLA0F18392g 1693928..1695694 highly similar to sp|P15180 Saccha...    28   6.1  
Kwal_23.3426                                                           28   8.4  
ADL360C [1380] [Homologous to ScYML128C (MSC1) - SH] (72250..741...    28   8.6  
YMR129W (POM152) [4086] chr13 (527803..531816) Nuclear pore memb...    28   9.1  
Kwal_26.6810                                                           28   9.4  

>Kwal_47.18241
          Length = 230

 Score =  469 bits (1207), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 228/228 (100%), Positives = 228/228 (100%)

Query: 1   MSKQLNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLNIVRIFDLAGQY 60
           MSKQLNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLNIVRIFDLAGQY
Sbjct: 1   MSKQLNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLNIVRIFDLAGQY 60

Query: 61  RFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKIDLIT 120
           RFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKIDLIT
Sbjct: 61  RFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKIDLIT 120

Query: 121 TLDTPNNGRTRKPVKRSAGDQNALEQWKYMAPLLRNYEYDDIPTYQLDESNLYVLRNIET 180
           TLDTPNNGRTRKPVKRSAGDQNALEQWKYMAPLLRNYEYDDIPTYQLDESNLYVLRNIET
Sbjct: 121 TLDTPNNGRTRKPVKRSAGDQNALEQWKYMAPLLRNYEYDDIPTYQLDESNLYVLRNIET 180

Query: 181 LSKELGLDLKNGVLHLPESQIYLDRDLAVFTISCKNGDYIQDILEWIG 228
           LSKELGLDLKNGVLHLPESQIYLDRDLAVFTISCKNGDYIQDILEWIG
Sbjct: 181 LSKELGLDLKNGVLHLPESQIYLDRDLAVFTISCKNGDYIQDILEWIG 228

>KLLA0F02662g 241804..242565 some similarities with sp|Q8VEH3 Mus
           musculus Hypothetical 21.4 kDa protein, hypothetical
           start
          Length = 253

 Score =  218 bits (555), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 108/229 (47%), Positives = 163/229 (71%), Gaps = 4/229 (1%)

Query: 3   KQLNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLNI-VRIFDLAGQYR 61
           KQL+I +VGLQNSGKT+ T  +  + F  DTIPTLG+ ++   +  +  ++++DLAGQ R
Sbjct: 22  KQLSIAVVGLQNSGKTTFTNLIAGEEFVVDTIPTLGVNIKDVKLPNHTNLKVYDLAGQTR 81

Query: 62  FQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKIDLITT 121
           FQ LWDR F + DL++++IDL+D TNW + K  +  VI+ TN + +P+LILGNK+DLI  
Sbjct: 82  FQKLWDRCFQQVDLLVFMIDLSDLTNWEQAKNKLHDVIIATNLEHVPILILGNKVDLIPK 141

Query: 122 LDTP-NNGRTRKPVKRSAGDQNALEQ-WKYMAPLLRNYEYDDIPTYQLDESNLYVLRNIE 179
                   ++    +RS+ + +A +Q W Y++PLL NYEY+DIP Y L+  N +VL  +E
Sbjct: 142 FHRDLYVAKSDVSDQRSSVENSARKQTWNYVSPLLHNYEYEDIPKYDLNPENQHVLSKVE 201

Query: 180 TLSKELGLDLKNGVLHLP-ESQIYLDRDLAVFTISCKNGDYIQDILEWI 227
            LSKELG+DLK+G+LHLP +S++ L+RD+A+F++SCK+G  I  +++WI
Sbjct: 202 VLSKELGIDLKHGLLHLPHDSKVKLNRDIALFSVSCKDGTLIDTVIDWI 250

>AEL232C [2274] [Homologous to NOHBY] (196356..197285) [930 bp, 309
           aa]
          Length = 309

 Score =  214 bits (544), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 104/236 (44%), Positives = 154/236 (65%), Gaps = 15/236 (6%)

Query: 7   IVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLNIVRIFDLAGQYRFQHLW 66
           I IVGLQNSGKT+L   L   PF  DTIPTLG+ +   T+G  +++++DLAGQ R + LW
Sbjct: 71  IAIVGLQNSGKTTLAALLTGHPFRADTIPTLGIDVRHATIGQTLLQVYDLAGQARHRFLW 130

Query: 67  DRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKIDLIT------ 120
           DR  D  DL++YV+DL+D T W   K A++ V+V TN    P+LI+GNK DL+       
Sbjct: 131 DRCLDTTDLVVYVLDLSDDTAWEAAKHALQSVLVATNARRTPVLIIGNKADLVAPPPILP 190

Query: 121 --TLDTPNNGRTRKPVKRSAGDQNALE------QWKYMAPLLRNYEYDDIPTYQLDESNL 172
                    G +++  + ++   NA         W++M PLL +Y+YDDIPTY +D SN 
Sbjct: 191 PDDASPAPPGPSQQSHRSASVSSNARPFDISPYHWRFMTPLLSHYDYDDIPTYVIDTSNH 250

Query: 173 YVLRNIETLSKELGLDLKNGVLHLP-ESQIYLDRDLAVFTISCKNGDYIQDILEWI 227
           ++L +++ LS+ELGLDL+NG+LHL  E+ + +DRD+ +FT+SC++G  I D++EW+
Sbjct: 251 HLLLDLQVLSRELGLDLRNGILHLTNETVLAMDRDIGLFTVSCRDGTGISDVIEWL 306

>Sklu_2365.2 YPL051W, Contig c2365 827-1420 reverse complement
          Length = 197

 Score = 84.0 bits (206), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 43/121 (35%), Positives = 73/121 (60%), Gaps = 7/121 (5%)

Query: 3   KQLNIVIVGLQNSGKTSLTR------ALLSKPFEQDTIPTLGMRMEQFTMGLNIVRIFDL 56
           KQ +I+I+GL N+GKT+         +L SKP E+ T PT+G  +    +   +++ +D+
Sbjct: 16  KQFSILILGLDNAGKTTFLETLKKEYSLHSKPLEKIT-PTVGQNVATIPVQDCVLKFWDV 74

Query: 57  AGQYRFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKI 116
            GQ   + LW  Y+ +A  II+V+D  D+    ECKE +R +++D + + +P+L+L NK 
Sbjct: 75  GGQETLRSLWAEYYSQAHGIIFVVDSTDRDRLDECKETLRSIVMDEDVEGVPVLMLANKQ 134

Query: 117 D 117
           D
Sbjct: 135 D 135

>Kwal_27.11872
          Length = 197

 Score = 75.9 bits (185), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 42/121 (34%), Positives = 70/121 (57%), Gaps = 5/121 (4%)

Query: 2   SKQLNIVIVGLQNSGKTS----LTRALLSKPFEQDTI-PTLGMRMEQFTMGLNIVRIFDL 56
            +Q +I+I+GL N+GKT+    L R         D I PT+G  +    +G  +++ +D+
Sbjct: 15  KEQYSILILGLDNAGKTTFLEMLKREYSKSGKAPDKITPTVGQNVATVPVGNCLLKFWDV 74

Query: 57  AGQYRFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKI 116
            GQ   + LW  Y+ +A  II+VID AD+    EC + +R +++D + + IP+L+L NK 
Sbjct: 75  GGQESLRALWPEYYKQAHGIIFVIDSADRERLDECCQTLRTIVMDEDVEGIPVLMLANKQ 134

Query: 117 D 117
           D
Sbjct: 135 D 135

>Sklu_1358.1 YMR138W, Contig c1358 536-1192
          Length = 218

 Score = 74.3 bits (181), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 42/138 (30%), Positives = 82/138 (59%), Gaps = 5/138 (3%)

Query: 3   KQLNIVIVGLQNSGKTSLTRALLSKPFEQDTI-PTLGMRMEQFTMGLNIVRIFDLAGQYR 61
           K+L  +++GL NSGK+++   LL +  ++  I PT+G R+       + V+++D+ GQ  
Sbjct: 41  KELRSLVLGLDNSGKSTVVDWLLERGEKRSRITPTVGFRIHTIEYAGHNVQLWDIGGQRT 100

Query: 62  FQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNR---DCIPMLILGNKIDL 118
            +  WD YFD+ D++++VID+  ++ ++E    + K++ D +R    C  M++L NK+DL
Sbjct: 101 LRPFWDNYFDKTDVLLWVIDVTARSRFSESFAELEKLLQDRDRLGYRC-KMIVLLNKMDL 159

Query: 119 ITTLDTPNNGRTRKPVKR 136
           I   ++  +   R  ++R
Sbjct: 160 IDEDESVTDDVRRAVIER 177

>CAGL0L12826g complement(1370767..1371366) highly similar to
           tr|Q02804 Saccharomyces cerevisiae YPL051w
           ADP-ribosylation factor-like protein, start by
           similarity
          Length = 199

 Score = 73.6 bits (179), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 40/123 (32%), Positives = 70/123 (56%), Gaps = 9/123 (7%)

Query: 3   KQLNIVIVGLQNSGKTSLTRAL------LSKPFEQDTIPTLGMRMEQFTMGLN--IVRIF 54
           +Q +I+I+GL N+GKT+    L       SKP ++   PT+G  +    +  N  I++ +
Sbjct: 16  EQYSILILGLDNAGKTTFLETLKKEYSMHSKPLDK-IAPTVGQNVATIPVDNNRSILKFW 74

Query: 55  DLAGQYRFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGN 114
           D+ GQ   + +W  Y+ +   II+V+D  D++   EC E +R +++D   + IP+L+L N
Sbjct: 75  DVGGQASLRAMWSEYYPQCHGIIFVVDSTDRSRIDECSETLRTIVMDDEIEGIPILMLAN 134

Query: 115 KID 117
           K D
Sbjct: 135 KQD 137

>Scas_567.9
          Length = 199

 Score = 72.8 bits (177), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 38/124 (30%), Positives = 73/124 (58%), Gaps = 9/124 (7%)

Query: 3   KQLNIVIVGLQNSGKTSLTRA------LLSKPFEQDTIPTLGMRMEQFTMGLN--IVRIF 54
           +Q +I+I+GL N+GKT+          L SKP ++ T PT+G  +   ++  N  +++ +
Sbjct: 16  EQYSILILGLDNAGKTTFLETCKKEFNLNSKPLDKIT-PTVGQNVATISVENNKKLLKFW 74

Query: 55  DLAGQYRFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGN 114
           D+ GQ   + +W  Y+ +   II+V+D  D++   EC + + K+++D   + +P+L+L N
Sbjct: 75  DVGGQENLRSMWSEYYSQCHGIIFVVDSTDRSRIDECSKTLGKIVMDDEVEGVPILMLAN 134

Query: 115 KIDL 118
           K D+
Sbjct: 135 KQDM 138

>AGL261W [4051] [Homologous to ScYPL051W (ARL3) - SH]
           complement(218211..218807) [597 bp, 198 aa]
          Length = 198

 Score = 68.2 bits (165), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 68/122 (55%), Gaps = 8/122 (6%)

Query: 3   KQLNIVIVGLQNSGKTSLTRAL------LSKPFEQDTIPTLGMRMEQFTM-GLNIVRIFD 55
           +  +++I+GL N+GKT+    L       +KP E+  +PT+G  +    +    +++ +D
Sbjct: 16  EHYSVLILGLDNAGKTTFLEQLKAVYHLYAKPLEK-IVPTVGQNVATVPLDKTTLLKFWD 74

Query: 56  LAGQYRFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNK 115
           + GQ   + +W  Y+ +   II++ID  D+    EC +++R ++ D   + +P+L+L NK
Sbjct: 75  VGGQEALRAMWSEYYVQTHGIIFIIDSTDRERLQECCDSLRSIVTDDGVEGVPILMLANK 134

Query: 116 ID 117
            D
Sbjct: 135 QD 136

>ACL078W [971] [Homologous to ScYOR094W (ARF3) - SH]
           complement(212664..213209) [546 bp, 181 aa]
          Length = 181

 Score = 67.8 bits (164), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 66/118 (55%), Gaps = 3/118 (2%)

Query: 2   SKQLNIVIVGLQNSGKTSLTRAL-LSKPFEQDTIPTLGMRMEQFTMGLNIVRIFDLAGQY 60
           S+++ I+++GL N+GKT++   L L+K   + + PT+G  +E          ++D+ GQ 
Sbjct: 15  SREMKILMLGLDNAGKTTILYKLKLNKI--KTSAPTVGFNVETVAFRNVKFNMWDVGGQE 72

Query: 61  RFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKIDL 118
           R + LW  YF     +I+VID  DQ    E KE +  +I +   + + +L+L NK DL
Sbjct: 73  RLRPLWRHYFPATTALIFVIDSHDQARLNEAKEELYSIIGEKEMENVVLLVLANKQDL 130

>Scas_697.54*
          Length = 181

 Score = 67.0 bits (162), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 37/117 (31%), Positives = 63/117 (53%), Gaps = 1/117 (0%)

Query: 2   SKQLNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLNIVRIFDLAGQYR 61
           S ++ I+++GL N+GKT++   L     +  T PT+G  +E  +       ++D+ GQ R
Sbjct: 15  STEMKILMLGLDNAGKTTILYKLKLNKIKTST-PTVGFNVETVSYKNVKFNMWDVGGQER 73

Query: 62  FQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKIDL 118
            + LW  YF     +I+VID +DQ    E KE +  +I +   + + +L+  NK DL
Sbjct: 74  LRPLWRHYFPATTALIFVIDSSDQERLNEAKEELYSIISEKEMEKVVLLVWANKQDL 130

>KLLA0C13563g complement(1157278..1157826) highly similar to
           sp|P40994 Saccharomyces cerevisiae YOR094w ARF3
           ADP-ribosylation factor 3, start by similarity
          Length = 182

 Score = 65.9 bits (159), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 39/126 (30%), Positives = 71/126 (56%), Gaps = 4/126 (3%)

Query: 2   SKQLNIVIVGLQNSGKTSLTRAL-LSKPFEQDTIPTLGMRMEQFTMGLNIVRIFDLAGQY 60
           ++++ I+++GL N+GKT++   L L+K   + + PT+G  +E  +       ++D+ GQ 
Sbjct: 15  TREMKILMLGLDNAGKTTILYKLKLNKI--KTSAPTVGFNVETLSFKNVKFNMWDVGGQA 72

Query: 61  RFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKIDLIT 120
           R + LW  YF     +I+VID  D+    + KE +  +I +   + + +L+L NK DL  
Sbjct: 73  RLRPLWRHYFPATSALIFVIDSNDKERLDQAKEELFSIIGEKEMEKVVLLVLANKQDLPG 132

Query: 121 TLDTPN 126
            L +PN
Sbjct: 133 AL-SPN 137

>YOR094W (ARF3) [4899] chr15 (502795..503346) Protein with
           similarity to members of the arf family (ras
           superfamily) of GTP-binding proteins [552 bp, 183 aa]
          Length = 183

 Score = 64.3 bits (155), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 36/117 (30%), Positives = 62/117 (52%), Gaps = 1/117 (0%)

Query: 2   SKQLNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLNIVRIFDLAGQYR 61
           SK++ I+++GL  +GKT++   L     +  T PT+G  +E  T       ++D+ GQ R
Sbjct: 15  SKEMKILMLGLDKAGKTTILYKLKLNKIKTST-PTVGFNVETVTYKNVKFNMWDVGGQQR 73

Query: 62  FQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKIDL 118
            + LW  YF     +I+VID + +    E KE +  +I +   + + +L+  NK DL
Sbjct: 74  LRPLWRHYFPATTALIFVIDSSARNRMEEAKEELYSIIGEKEMENVVLLVWANKQDL 130

>YPL051W (ARL3) [5389] chr16 (459958..460554) ADP-ribosylation
           factor-like protein, member of the arf-sar family in the
           ras superfamily [597 bp, 198 aa]
          Length = 198

 Score = 64.3 bits (155), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 35/121 (28%), Positives = 66/121 (54%), Gaps = 6/121 (4%)

Query: 3   KQLNIVIVGLQNSGKTSLTRAL---LSKPFE--QDTIPTLGMRMEQFTM-GLNIVRIFDL 56
           +Q +I+I+GL N+GKT+    L    S  F+  +   PT+G  +    +    I++ +D+
Sbjct: 16  EQYSILILGLDNAGKTTFLETLKKEYSLAFKALEKIQPTVGQNVATIPVDSKQILKFWDV 75

Query: 57  AGQYRFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKI 116
            GQ   + +W  Y+     II+++D +D+    EC   ++ V++D   + +P+L+L NK 
Sbjct: 76  GGQESLRSMWSEYYSLCHGIIFIVDSSDRERLDECSTTLQSVVMDEEIEGVPILMLANKQ 135

Query: 117 D 117
           D
Sbjct: 136 D 136

>Kwal_23.2944
          Length = 184

 Score = 63.9 bits (154), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 37/117 (31%), Positives = 65/117 (55%), Gaps = 3/117 (2%)

Query: 3   KQLNIVIVGLQNSGKTSLTRAL-LSKPFEQDTIPTLGMRMEQFTMGLNIVRIFDLAGQYR 61
           +++ I+++GL N+GKT++   L L+K   + + PT+G  +E  +       ++D+ GQ R
Sbjct: 16  REMKILMLGLDNAGKTTILYKLKLNKI--KTSAPTVGFNVETVSFRNVKFNMWDVGGQDR 73

Query: 62  FQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKIDL 118
            + LW  YF     +I+V+D  D     E KE +  +I D   + + +L+L NK DL
Sbjct: 74  LRPLWRHYFPATTALIFVVDSQDMERLNEAKEELYSIIGDKEMENVVLLVLANKQDL 130

>Scas_680.21
          Length = 183

 Score = 63.5 bits (153), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 72/127 (56%), Gaps = 12/127 (9%)

Query: 3   KQLNIVIVGLQNSGKTSLTRALLSKPFEQ----DTIPTLGMRMEQFTMGLNIVRIFDLAG 58
           K+L  +I+GL NSGK++L   LL  P E+    +  PT+G ++  F  G   + ++D+ G
Sbjct: 15  KELKCLILGLDNSGKSTLVNKLL--PEEERSQVEITPTIGFQIVNFNHGGYTISMWDIGG 72

Query: 59  QYRFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVI----VDTNRDCIP--MLIL 112
           Q   +  WD YFD+ + +++ +D++  + + E    + +++       + + +P  ++++
Sbjct: 73  QTTLRPFWDNYFDKMEALVWCVDVSAPSRFQESLRELSQLLNLDRTVESGETLPFKLIVV 132

Query: 113 GNKIDLI 119
            NKIDL+
Sbjct: 133 LNKIDLV 139

>YMR138W (CIN4) [4095] chr13 (545154..545729) GTP-binding protein
           involved in chromosome segregation, mutants arrest at
           mitosis with loss of microtubule structure [576 bp, 191
           aa]
          Length = 191

 Score = 63.5 bits (153), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 72/123 (58%), Gaps = 7/123 (5%)

Query: 3   KQLNIVIVGLQNSGKTSLTRALLSKPFEQD--TIPTLGMRMEQFTMGLNIVRIFDLAGQY 60
           K++  +I+GL NSGK+++   LL K  + +   +PT+G ++    +    + ++D+ GQ 
Sbjct: 15  KEIRCLILGLDNSGKSTIVNKLLPKDEQNNDGIMPTVGFQIHSLMIKDVTISLWDIGGQR 74

Query: 61  RFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVI-VDTNR---DCIPMLILGNKI 116
             +  WD YFD+   +I+ ID++    + E  + ++++I  D NR   +C  +++L NKI
Sbjct: 75  TLRPFWDNYFDKTQAMIWCIDVSLSMRFDETLQELKELINRDENRIGYECAVIVVL-NKI 133

Query: 117 DLI 119
           DL+
Sbjct: 134 DLV 136

>Sklu_2320.2 YOR094W, Contig c2320 3571-4065
          Length = 164

 Score = 62.8 bits (151), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 38/119 (31%), Positives = 64/119 (53%), Gaps = 3/119 (2%)

Query: 5   LNIVIVGLQNSGKTSLTRAL-LSKPFEQDTIPTLGMRMEQFTMGLNIVRIFDLAGQYRFQ 63
           + I+++GL N+GKT++   L L+K   + + PT+G  +E  T       ++D+ GQ R +
Sbjct: 1   MKILMLGLDNAGKTTILYKLKLNKI--KTSAPTVGFNVETVTYKNVKFNMWDVGGQERLR 58

Query: 64  HLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKIDLITTL 122
            LW  YF     +I+VID  D+    E KE    ++ +   + + +L+L NK DL   L
Sbjct: 59  PLWRHYFPATTALIFVIDSQDKDRLNEAKEEFYSIVGEKEMEKVVLLVLANKQDLKGAL 117

>KLLA0F17072g complement(1566668..1567240) similar to sp|P39110
           Saccharomyces cerevisiae YMR138w CIN4 GTP-binding
           protein, start by similarity
          Length = 190

 Score = 63.5 bits (153), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 70/115 (60%), Gaps = 4/115 (3%)

Query: 7   IVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLNIVRIFDLAGQYRFQHLW 66
           ++++GL NSGKT++   LL++P ++   PT+G +++   +   +++++D+ GQ   +  W
Sbjct: 19  VLLLGLDNSGKTTVLNQLLNEPIDK-IQPTIGFQIKTLKLSNKVLQMWDIGGQKTLRPFW 77

Query: 67  DRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCI--PMLILGNKIDLI 119
             YF++ D +I+VID+ D     E    + +++ + +R  +   + IL NKIDL+
Sbjct: 78  FNYFEKTDYLIWVIDILD-NRLMESLTLLEEIVQENDRINLQFEVFILLNKIDLL 131

>KLLA0E12837g 1135181..1135780 similar to sgd|S0005972 Saccharomyces
           cerevisiae YPL051w ARL3 ADP-ribosylation factor-like
           protein, member of the arf-sar family in the ras
           superfamily, start by similarity
          Length = 199

 Score = 63.2 bits (152), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 72/126 (57%), Gaps = 9/126 (7%)

Query: 1   MSKQLNIVIVGLQNSGKTSLT---RALLSKPFE--QDTIPTLGMRMEQFTMGLN-IVRIF 54
           + +Q +I+I+GL  SGKTS     +A LSKP +      PT+G  +   +M  + I +I 
Sbjct: 14  LREQHDILILGLDGSGKTSFIETLKAYLSKPSKALNKIQPTIGQNVSFVSMDTHHIWKII 73

Query: 55  DLAGQYRFQHLWDRYFDRADL--IIYVIDLADQTNWAECKEAVRKVIVDTNRDC-IPMLI 111
           D++GQ  F++LWD YF++ ++  I+Y++D +D     E    ++   V+T     IP+ +
Sbjct: 74  DVSGQESFRYLWDSYFNKDNIHGIVYMVDTSDSDRLQESINELQARYVNTPAAVDIPIAV 133

Query: 112 LGNKID 117
           + NK D
Sbjct: 134 VLNKTD 139

>Kwal_47.17857
          Length = 198

 Score = 61.6 bits (148), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 37/128 (28%), Positives = 72/128 (56%), Gaps = 7/128 (5%)

Query: 3   KQLNIVIVGLQNSGKTSLTRALLS---KPFEQDTIPTLGMRMEQFTMGLNIVRIFDLAGQ 59
           +++  +++GL NSGK+++   +LS   K   Q   PT+G ++       + V+++D+ GQ
Sbjct: 15  REIRCLVLGLDNSGKSTVVDWILSVYKKRPRQLITPTVGFQIHTIPFQNHNVQLWDIGGQ 74

Query: 60  YRFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNR---DCIPMLILGNKI 116
              +  WD YFD+ D++++VID A      E    ++ ++ + +R    C  +++L NK 
Sbjct: 75  STLRPYWDNYFDKTDVLMWVIDAAAAQRLEESIGELKVILQNRDRLGYGC-KIVVLLNKT 133

Query: 117 DLITTLDT 124
           DLI  L++
Sbjct: 134 DLIPDLES 141

>CAGL0I00858g complement(63365..63958) similar to sp|P39110
           Saccharomyces cerevisiae YMR138w CIN4 GTP-binding
           protein, start by similarity
          Length = 197

 Score = 61.2 bits (147), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 74/132 (56%), Gaps = 12/132 (9%)

Query: 3   KQLNIVIVGLQNSGKTSLTRALLSKPFEQDTI-PTLGMRMEQFTM------GLNIVRIFD 55
           +++  +I+GL NSGK+++   LL +  + ++I PT+G ++    +          V ++D
Sbjct: 15  REIRCLILGLDNSGKSTIVNGLLPESEKCNSITPTVGFQIHSIVVESAQDGKTYKVNLWD 74

Query: 56  LAGQYRFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCI----PMLI 111
           + GQ   +  WD YFD+ D++++ +D+A    + E    +R++++  +RD I     +++
Sbjct: 75  IGGQRTLRPFWDNYFDKTDVLLWCVDIASSLRFDESFNELRELVM-QDRDRIGYQCKLVV 133

Query: 112 LGNKIDLITTLD 123
             NKIDL+   D
Sbjct: 134 AINKIDLVEQAD 145

>ADR094W [1835] [Homologous to ScYDL192W (ARF1) - SH; ScYDL137W
           (ARF2) - SH] complement(878123..878668) [546 bp, 181 aa]
          Length = 181

 Score = 60.1 bits (144), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 63/116 (54%), Gaps = 1/116 (0%)

Query: 3   KQLNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLNIVRIFDLAGQYRF 62
           K++ I++VGL  +GKT++   L        TIPT+G  +E          ++D+ GQ + 
Sbjct: 16  KEMRILMVGLDGAGKTTVLYKLKLGEV-VTTIPTIGFNVETVEYKNISFTVWDVGGQDKI 74

Query: 63  QHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKIDL 118
           + LW  YF   + II+V+D  D++  AE +E +++++ +       +L+  NK DL
Sbjct: 75  RPLWRHYFRNTEGIIFVVDSNDRSRIAEAREVLQRMLNEDEIRNAVLLVFANKQDL 130

>Kwal_56.24462
          Length = 181

 Score = 60.1 bits (144), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 64/117 (54%), Gaps = 1/117 (0%)

Query: 2   SKQLNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLNIVRIFDLAGQYR 61
           SK++ I++VGL  +GKT++   L        TIPT+G  +E          ++D+ GQ +
Sbjct: 15  SKEMRILMVGLDGAGKTTVLYKLKLGEV-VTTIPTIGFNVETVEYKNISFTVWDVGGQDK 73

Query: 62  FQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKIDL 118
            + LW  Y+   + II+V+D  D++  +E +E +++++ +       +L+  NK DL
Sbjct: 74  IRPLWRHYYRNTEGIIFVVDSNDRSRISEAREVLQRMLNEDEIRNASLLVFANKQDL 130

>KLLA0F05225g 515391..515936 highly similar to sp|P19146
           Saccharomyces cerevisiae YDL137w ARF2 GTP-binding
           protein of the ARF family, start by similarity
          Length = 181

 Score = 59.7 bits (143), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 62/116 (53%), Gaps = 1/116 (0%)

Query: 3   KQLNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLNIVRIFDLAGQYRF 62
           K++ I++VGL  +GKT++   L        TIPT+G  +E          ++D+ GQ + 
Sbjct: 16  KEMRILMVGLDGAGKTTVLYKLKLGEV-VTTIPTIGFNVETVEYKNISFTVWDVGGQDKI 74

Query: 63  QHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKIDL 118
           + LW  YF   + II+V+D  D+   AE +E +++++ +       +L+  NK DL
Sbjct: 75  RPLWRHYFRNTEGIIFVVDSNDRARIAEAREVLQRMLNEDEIRNAVLLVFANKQDL 130

>CAGL0J09064g 892556..893101 highly similar to sp|P11076
           Saccharomyces cerevisiae YDL192w ARF1 or sp|P19146
           Saccharomyces cerevisiae YDL137w ARF2, start by
           similarity
          Length = 181

 Score = 59.7 bits (143), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 35/118 (29%), Positives = 64/118 (54%), Gaps = 3/118 (2%)

Query: 2   SKQLNIVIVGLQNSGKTSLTRAL-LSKPFEQDTIPTLGMRMEQFTMGLNIVRIFDLAGQY 60
           SK++ I++VGL  +GKT++   L L +     TIPT+G  +E          ++D+ GQ 
Sbjct: 15  SKEMRILMVGLDGAGKTTVLYKLKLGEVI--TTIPTIGFNVETVQYKNISFTVWDVGGQD 72

Query: 61  RFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKIDL 118
           R + LW  Y+   + +I+V+D  D++   E +E +++++ +        L+  NK DL
Sbjct: 73  RIRSLWRHYYRNTEGVIFVVDSNDRSRIGEAREVMQRMLNEDELRNAVWLVFANKQDL 130

>Kwal_56.24453
          Length = 181

 Score = 58.9 bits (141), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 63/116 (54%), Gaps = 1/116 (0%)

Query: 3   KQLNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLNIVRIFDLAGQYRF 62
           K++ I++VGL  +GKT++   L        TIPT+G  +E          ++D+ GQ + 
Sbjct: 16  KEMRILMVGLDGAGKTTVLYKLKLGEV-VTTIPTIGFNVETVEYKNISFTVWDVGGQDKI 74

Query: 63  QHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKIDL 118
           + LW  YF   + II+V+D  D++  +E +E +++++ +       +L+  NK DL
Sbjct: 75  RPLWRHYFRNTEGIIFVVDSNDRSRISEAREVLQRMLNEDEIRNAVLLVFANKQDL 130

>YDL137W (ARF2) [731] chr4 (216529..217074) GTP-binding protein of
           the arf family (ras superfamily) involved in assembly of
           coated vesicles of the secretory system [546 bp, 181 aa]
          Length = 181

 Score = 58.9 bits (141), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 35/118 (29%), Positives = 64/118 (54%), Gaps = 3/118 (2%)

Query: 2   SKQLNIVIVGLQNSGKTSLTRAL-LSKPFEQDTIPTLGMRMEQFTMGLNIVRIFDLAGQY 60
           +K++ I++VGL  +GKT++   L L +     TIPT+G  +E          ++D+ GQ 
Sbjct: 15  NKEMRILMVGLDGAGKTTVLYKLKLGEVI--TTIPTIGFNVETVQYKNISFTVWDVGGQD 72

Query: 61  RFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKIDL 118
           R + LW  Y+   + +I+VID  D++   E +E +++++ +        L+  NK DL
Sbjct: 73  RIRSLWRHYYRNTEGVIFVIDSNDRSRIGEAREVMQRMLNEDELRNAVWLVFANKQDL 130

>ADR251W [1992] [Homologous to ScYMR138W (CIN4) - SH]
           complement(1139711..1140373) [663 bp, 220 aa]
          Length = 220

 Score = 59.3 bits (142), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 66/119 (55%), Gaps = 5/119 (4%)

Query: 7   IVIVGLQNSGKTSLTRALLSKPFEQDTI-PTLGMRMEQFTMGLNIVRIFDLAGQYRFQHL 65
           +  +GL NSGKT++   LL    +   + PT+G ++   T+    ++++D+ GQ   +  
Sbjct: 52  VSCLGLDNSGKTTIVYRLLHPEGDLPPVTPTIGFQIHTLTIEPYNLQLWDIGGQSTLRPF 111

Query: 66  WDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNR---DCIPMLILGNKIDLITT 121
           W+ YFD  DL+++ +D A  +  AE    +  ++ + +R    C  +++L NK+DL+ +
Sbjct: 112 WENYFDSTDLLLWCVDAAAASRVAENHRELYTLLTERDRLGLQCA-IVVLLNKVDLLPS 169

>YDL192W (ARF1) [681] chr4 (116322..116867) GTP-binding protein
           involved in assembly of coated vesicles of the secretory
           system, member of the arf family in the ras superfamily
           [546 bp, 181 aa]
          Length = 181

 Score = 58.5 bits (140), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 34/118 (28%), Positives = 64/118 (54%), Gaps = 3/118 (2%)

Query: 2   SKQLNIVIVGLQNSGKTSLTRAL-LSKPFEQDTIPTLGMRMEQFTMGLNIVRIFDLAGQY 60
           +K++ I++VGL  +GKT++   L L +     TIPT+G  +E          ++D+ GQ 
Sbjct: 15  NKEMRILMVGLDGAGKTTVLYKLKLGEVI--TTIPTIGFNVETVQYKNISFTVWDVGGQD 72

Query: 61  RFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKIDL 118
           R + LW  Y+   + +I+V+D  D++   E +E +++++ +        L+  NK DL
Sbjct: 73  RIRSLWRHYYRNTEGVIFVVDSNDRSRIGEAREVMQRMLNEDELRNAAWLVFANKQDL 130

>Scas_624.4*
          Length = 181

 Score = 58.2 bits (139), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 34/118 (28%), Positives = 64/118 (54%), Gaps = 3/118 (2%)

Query: 2   SKQLNIVIVGLQNSGKTSLTRAL-LSKPFEQDTIPTLGMRMEQFTMGLNIVRIFDLAGQY 60
           +K++ I++VGL  +GKT++   L L +     TIPT+G  +E          ++D+ GQ 
Sbjct: 15  NKEMRILMVGLDGAGKTTVLYKLKLGEVI--TTIPTIGFNVETVQYKNISFTVWDVGGQD 72

Query: 61  RFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKIDL 118
           R + LW  Y+   + +I+V+D  D++   E +E +++++ +        L+  NK DL
Sbjct: 73  RIRSLWRHYYRNTEGVIFVVDSNDRSRIGEAREVMQRMLNEDELRNAVWLVFANKQDL 130

>CAGL0I03916g 343014..343559 highly similar to sp|P11076
           Saccharomyces cerevisiae YDL192w ARF1 or sp|P19146
           Saccharomyces cerevisiae YDL137w ARF2, start by
           similarity
          Length = 181

 Score = 58.2 bits (139), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 34/118 (28%), Positives = 64/118 (54%), Gaps = 3/118 (2%)

Query: 2   SKQLNIVIVGLQNSGKTSLTRAL-LSKPFEQDTIPTLGMRMEQFTMGLNIVRIFDLAGQY 60
           +K++ I++VGL  +GKT++   L L +     TIPT+G  +E          ++D+ GQ 
Sbjct: 15  NKEMRILMVGLDGAGKTTVLYKLKLGEVI--TTIPTIGFNVETVQYKNISFTVWDVGGQD 72

Query: 61  RFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKIDL 118
           R + LW  Y+   + +I+V+D  D++   E +E +++++ +        L+  NK DL
Sbjct: 73  RIRSLWRHYYRNTEGVIFVVDSNDRSRIGEAREVMQRMLNEDELRNAVWLVFANKQDL 130

>Scas_701.42*
          Length = 181

 Score = 58.2 bits (139), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 34/118 (28%), Positives = 64/118 (54%), Gaps = 3/118 (2%)

Query: 2   SKQLNIVIVGLQNSGKTSLTRAL-LSKPFEQDTIPTLGMRMEQFTMGLNIVRIFDLAGQY 60
           +K++ I++VGL  +GKT++   L L +     TIPT+G  +E          ++D+ GQ 
Sbjct: 15  NKEMRILMVGLDGAGKTTVLYKLKLGEVI--TTIPTIGFNVETVQYKNISFTVWDVGGQD 72

Query: 61  RFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKIDL 118
           R + LW  Y+   + +I+V+D  D++   E +E +++++ +        L+  NK DL
Sbjct: 73  RIRSLWRHYYRNTEGVIFVVDSNDRSRIGEAREVMQRMLNEDELRNAVWLVFANKQDL 130

>AFL114W [3081] [Homologous to ScYPL218W (SAR1) - SH]
           complement(222754..223326) [573 bp, 190 aa]
          Length = 190

 Score = 57.8 bits (138), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 56/116 (48%), Gaps = 1/116 (0%)

Query: 2   SKQLNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLNIVRIFDLAGQYR 61
           +K   ++ +GL N+GKT+L   L +        PT     E+  +G      FDL G  +
Sbjct: 21  NKHGKLLFLGLDNAGKTTLLHMLKNDRLAT-LQPTWHPTSEELAIGSIKFTTFDLGGHIQ 79

Query: 62  FQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKID 117
            + LW  YF   + I++++D AD   + E +  +  +        +P +ILGNKID
Sbjct: 80  ARRLWKDYFPEVNGIVFLVDAADSERFNEARVELDALFQIPELKTVPFVILGNKID 135

>KLLA0B02046g 178646..179218 highly similar to sp|P20606
           Saccharomyces cerevisiae YPL218w SAR1 GTP-binding
           protein of the ARF family, start by similarity
          Length = 190

 Score = 57.4 bits (137), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 56/116 (48%), Gaps = 1/116 (0%)

Query: 2   SKQLNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLNIVRIFDLAGQYR 61
           +K   ++ +GL N+GKT+L   L +        PT     E+  +G      FDL G  +
Sbjct: 21  NKHGKLLFLGLDNAGKTTLLHMLKNDRLAT-LQPTWHPTSEELAIGNIKFTTFDLGGHLQ 79

Query: 62  FQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKID 117
            + LW  YF   + I++++D AD   + E +  +  +      D +P  +LGNKID
Sbjct: 80  ARRLWKDYFPEVNGIVFLVDAADPERFNEARIELDALFQIKELDNVPFAVLGNKID 135

>CAGL0E05896g
           join(complement(585178..585202),
           complement(584348..584892)) highly similar to sp|P20606
           Saccharomyces cerevisiae YPL218w SAR1 GTP-binding
           protein of the ARF family
          Length = 189

 Score = 57.0 bits (136), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 57/116 (49%), Gaps = 1/116 (0%)

Query: 2   SKQLNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLNIVRIFDLAGQYR 61
           +K   ++ +GL N+GKT+L   L +        PT     E+  +G      FDL G  +
Sbjct: 20  NKHGKLLFLGLDNAGKTTLLHMLKNDRLAT-LQPTWHPTSEELAIGNIKFTTFDLGGHVQ 78

Query: 62  FQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKID 117
            + LW  YF   + I++++D AD   + E +  +  +   T    +P +ILGNKID
Sbjct: 79  ARRLWKDYFPEVNGIVFLVDSADPDRFDEARVELDALFNITELKDVPFVILGNKID 134

>Scas_706.2*
          Length = 190

 Score = 55.8 bits (133), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 57/122 (46%), Gaps = 1/122 (0%)

Query: 2   SKQLNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLNIVRIFDLAGQYR 61
           +K   ++ +GL N+GKT+L   L +        PT     E+  +G      FDL G  +
Sbjct: 21  NKHGKLLFLGLDNAGKTTLLHMLKNDRLAT-LQPTWHPTSEELAIGNIKFTTFDLGGHIQ 79

Query: 62  FQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKIDLITT 121
            + LW  YF   + I++++D AD   + E    +  +        +P +ILGNKID  T 
Sbjct: 80  ARRLWKDYFPEVNGIVFLVDAADPERFHEAYVELDALFKIAELKDVPFVILGNKIDAPTA 139

Query: 122 LD 123
           + 
Sbjct: 140 VS 141

>Kwal_56.22440
          Length = 208

 Score = 56.2 bits (134), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 40/144 (27%), Positives = 73/144 (50%), Gaps = 9/144 (6%)

Query: 5   LNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRM--EQFTM---GLNIVRIFDLAGQ 59
           L ++I+G    GKTSL    +S  F Q    T+G     ++ +M    +  ++++D AGQ
Sbjct: 9   LKVIILGDSGVGKTSLMHRYVSDKFSQQYKATIGADFLTKEVSMDGDKVATMQVWDTAGQ 68

Query: 60  YRFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTN---RDCIPMLILGNKI 116
            RFQ L   ++  AD  + V D+ +  ++   K    + +V  N    +  P +ILGNK+
Sbjct: 69  ERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKL 128

Query: 117 DLITTLDTPNNGRTRKPVKRSAGD 140
           D+  +    +N R+ + + +S G+
Sbjct: 129 DVEESKKVVSN-RSAQDMAKSLGN 151

>YPL218W (SAR1) [5231] chr16 (138697..138724,138864..139408)
           Component of COPII coat of vesicles involved in
           endoplasmic reticulum to Golgi transport, GTP-binding
           protein of the arf family in the ras superfamily [573
           bp, 190 aa]
          Length = 190

 Score = 55.8 bits (133), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 56/116 (48%), Gaps = 1/116 (0%)

Query: 2   SKQLNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLNIVRIFDLAGQYR 61
           +K   ++ +GL N+GKT+L   L +        PT     E+  +G      FDL G  +
Sbjct: 21  NKHGKLLFLGLDNAGKTTLLHMLKNDRLAT-LQPTWHPTSEELAIGNIKFTTFDLGGHIQ 79

Query: 62  FQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKID 117
            + LW  YF   + I++++D AD   + E +  +  +        +P +ILGNKID
Sbjct: 80  ARRLWKDYFPEVNGIVFLVDAADPERFDEARVELDALFNIAELKDVPFVILGNKID 135

>Sklu_1681.2 YDL137W, Contig c1681 2279-2767
          Length = 162

 Score = 54.3 bits (129), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 60/114 (52%), Gaps = 1/114 (0%)

Query: 5   LNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLNIVRIFDLAGQYRFQH 64
           + +++VGL  +GK ++   L        TIPT+G  +E          ++D+ GQ + + 
Sbjct: 1   MRVLMVGLDGAGKATILYKLKLGEV-VTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRP 59

Query: 65  LWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKIDL 118
           LW  YF   + II+V+D  D++  +E +E +++++ +       +L+  NK DL
Sbjct: 60  LWRHYFRNTEGIIFVVDSNDRSRISEAREVLQRMLNEDEIRNAVLLVFANKQDL 113

>Kwal_23.2978
          Length = 211

 Score = 54.7 bits (130), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 38/146 (26%), Positives = 74/146 (50%), Gaps = 11/146 (7%)

Query: 5   LNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRM--EQFTMGLNIVR--IFDLAGQY 60
           + +V++G    GK+S+    +S  F ++  PT+G     ++  MG + ++  I+D AGQ 
Sbjct: 8   IKLVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQRVNMGDHTIKFEIWDTAGQE 67

Query: 61  RFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKIDLIT 120
           RF  L   Y+  A   + V D+    ++ + +  V+++    ++D +  L+ GNK+D++ 
Sbjct: 68  RFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKELREQASKDIVIALV-GNKLDIVE 126

Query: 121 TLDTPNNGRTRKPVKRSAGDQNALEQ 146
           +      G  RK  +  A +  A EQ
Sbjct: 127 S------GGERKVAREEAENLAAQEQ 146

>Sklu_2373.3 YML001W, Contig c2373 10977-11603
          Length = 208

 Score = 53.9 bits (128), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 39/144 (27%), Positives = 72/144 (50%), Gaps = 9/144 (6%)

Query: 5   LNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRM--EQFTM---GLNIVRIFDLAGQ 59
           L ++I+G    GKTSL    ++  + Q    T+G     ++ T+    +  ++++D AGQ
Sbjct: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDEDKVATMQVWDTAGQ 68

Query: 60  YRFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTN---RDCIPMLILGNKI 116
            RFQ L   ++  AD  + V D+ +  ++   K    + +V  N    +  P +ILGNKI
Sbjct: 69  ERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPESFPFVILGNKI 128

Query: 117 DLITTLDTPNNGRTRKPVKRSAGD 140
           D+  +    N  R+ + + +S G+
Sbjct: 129 DVEESKKVVNT-RSAQELAKSLGN 151

>YLR293C (GSP1) [3684] chr12 complement(720773..721432) Ran, a
           GTP-binding protein of the ras superfamily involved in
           trafficking through nuclear pores [660 bp, 219 aa]
          Length = 219

 Score = 53.9 bits (128), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 59/120 (49%), Gaps = 10/120 (8%)

Query: 5   LNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLNIVRI----FDLAGQY 60
             +V+VG   +GKT+  +  L+  FE+  I T+G+ +   +   N   I    +D AGQ 
Sbjct: 13  FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEIKFDVWDTAGQE 72

Query: 61  RFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDC--IPMLILGNKIDL 118
           +F  L D Y+  A   I + D+  +  +       R ++    R C  IP+++ GNK+D+
Sbjct: 73  KFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDLV----RVCENIPIVLCGNKVDV 128

>YOR185C (GSP2) [4981] chr15 complement(681444..682106) Ran, a
           GTP-binding protein member of the ras superfamily
           involved in trafficking through nuclear pores [663 bp,
           220 aa]
          Length = 220

 Score = 53.5 bits (127), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 59/120 (49%), Gaps = 10/120 (8%)

Query: 5   LNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLNIVRI----FDLAGQY 60
             +V+VG   +GKT+  +  L+  FE+  I T+G+ +   +   N   I    +D AGQ 
Sbjct: 14  FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEIKFDVWDTAGQE 73

Query: 61  RFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDC--IPMLILGNKIDL 118
           +F  L D Y+  A   I + D+  +  +       R ++    R C  IP+++ GNK+D+
Sbjct: 74  KFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDLV----RVCENIPIVLCGNKVDV 129

>YOR089C (VPS21) [4894] chr15 complement(490197..490829) GTP-binding
           protein required for sorting of vacuolar proteins and
           involved in late stage of endocytosis, member of the rab
           family in the ras superfamily [633 bp, 210 aa]
          Length = 210

 Score = 53.1 bits (126), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 75/146 (51%), Gaps = 12/146 (8%)

Query: 5   LNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRM--EQFTMGLNIVR--IFDLAGQY 60
           + +V++G    GK+S+    +S  F ++  PT+G     ++ T+  + V+  I+D AGQ 
Sbjct: 8   IKLVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQRVTINEHTVKFEIWDTAGQE 67

Query: 61  RFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKIDLIT 120
           RF  L   Y+  A   + V D+    ++ + +  V+++    ++D I  L+ GNKID++ 
Sbjct: 68  RFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKELHEQASKDIIIALV-GNKIDML- 125

Query: 121 TLDTPNNGRTRKPVKRSAGDQNALEQ 146
                  G  RK V R  G++ A E+
Sbjct: 126 -----QEGGERK-VAREEGEKLAEEK 145

>ACR003C [1051] [Homologous to ScYML001W (YPT7) - SH]
           (359762..360388) [627 bp, 208 aa]
          Length = 208

 Score = 53.1 bits (126), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 39/144 (27%), Positives = 71/144 (49%), Gaps = 9/144 (6%)

Query: 5   LNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRM--EQFTM---GLNIVRIFDLAGQ 59
           L ++I+G    GKTSL    ++  + Q    T+G     ++ T+    +  ++++D AGQ
Sbjct: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDGDKVATMQVWDTAGQ 68

Query: 60  YRFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTN---RDCIPMLILGNKI 116
            RFQ L   ++  AD  + V D+ +  ++   K    + +V  N    +  P +ILGNKI
Sbjct: 69  ERFQSLGVAFYRGADCCVLVYDVTNAKSFENVKSWRDEFLVHANVPSPESFPFVILGNKI 128

Query: 117 DLITTLDTPNNGRTRKPVKRSAGD 140
           D+  +       RT + + +S G+
Sbjct: 129 DVEESKKVVTT-RTSQELAKSLGN 151

>CAGL0I00594g 44835..45479 highly similar to sp|P32835 Saccharomyces
           cerevisiae YLR293c GSP1, start by similarity
          Length = 214

 Score = 53.1 bits (126), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 58/120 (48%), Gaps = 10/120 (8%)

Query: 5   LNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLNIVRI----FDLAGQY 60
             +V+VG   +GKT+  +  L+  FE+  I T+G+ +       N   I    +D AGQ 
Sbjct: 8   FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLAFHTNFGEIKFDVWDTAGQE 67

Query: 61  RFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDC--IPMLILGNKIDL 118
           +F  L D Y+  A   I + D+  +  +       R ++    R C  IP+++ GNK+D+
Sbjct: 68  KFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDLV----RVCENIPIVLCGNKVDV 123

>YML001W (YPT7) [3965] chr13 (267174..267800) GTP-binding protein
           with a role in protein transport between endosome-like
           compartments, member of the rab family in the ras
           superfamily [627 bp, 208 aa]
          Length = 208

 Score = 52.8 bits (125), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 35/121 (28%), Positives = 62/121 (51%), Gaps = 8/121 (6%)

Query: 5   LNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRM--EQFTM---GLNIVRIFDLAGQ 59
           L ++I+G    GKTSL    ++  + Q    T+G     ++ T+    +  ++++D AGQ
Sbjct: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDGDKVATMQVWDTAGQ 68

Query: 60  YRFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTN---RDCIPMLILGNKI 116
            RFQ L   ++  AD  + V D+ + +++   K    + +V  N    +  P +ILGNKI
Sbjct: 69  ERFQSLGVAFYRGADCCVLVYDVTNASSFENIKSWRDEFLVHANVNSPETFPFVILGNKI 128

Query: 117 D 117
           D
Sbjct: 129 D 129

>CAGL0J08635g complement(853978..854604) highly similar to sp|P36017
           Saccharomyces cerevisiae YOR089c VPS21 GTP-binding
           protein, start by similarity
          Length = 208

 Score = 52.4 bits (124), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 34/119 (28%), Positives = 64/119 (53%), Gaps = 5/119 (4%)

Query: 5   LNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRM--EQFTMGLNIVR--IFDLAGQY 60
           L +V++G    GK+S+    +S  F ++  PT+G     ++ T+  + V+  I+D AGQ 
Sbjct: 8   LKLVLLGEAAVGKSSIVLRFVSNDFSENKEPTIGAAFLTQRVTINEHTVKFEIWDTAGQE 67

Query: 61  RFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKIDLI 119
           RF  L   Y+  A   + V D+    ++ + +  V+++    ++D I  L+ GNKID++
Sbjct: 68  RFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKELQEQASKDIIIALV-GNKIDVL 125

>Sklu_2285.4 YLR293C, Contig c2285 4349-4993 reverse complement
          Length = 214

 Score = 52.4 bits (124), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 58/120 (48%), Gaps = 10/120 (8%)

Query: 5   LNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLNIVRI----FDLAGQY 60
             +V+VG   +GKT+  +  L+  FE+  I T+G+ +       N   I    +D AGQ 
Sbjct: 8   FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLAFYTNFGEIKFDVWDTAGQE 67

Query: 61  RFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDC--IPMLILGNKIDL 118
           +F  L D Y+  A   I + D+  +  +       R ++    R C  IP+++ GNK+D+
Sbjct: 68  KFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDLV----RVCENIPIVLCGNKVDV 123

>KLLA0C05126g complement(463657..464301) highly similar to sp|P32836
           Saccharomyces cerevisiae YOR185c GSP2 GTP-binding
           protein of the RAS superfamily, start by similarity
          Length = 214

 Score = 52.4 bits (124), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 58/120 (48%), Gaps = 10/120 (8%)

Query: 5   LNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLNIVRI----FDLAGQY 60
             +V+VG   +GKT+  +  L+  FE+  I T+G+ +       N   I    +D AGQ 
Sbjct: 8   FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLAFYTNFGEIKFDVWDTAGQE 67

Query: 61  RFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDC--IPMLILGNKIDL 118
           +F  L D Y+  A   I + D+  +  +       R ++    R C  IP+++ GNK+D+
Sbjct: 68  KFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDLV----RVCENIPIVLCGNKVDV 123

>KLLA0A04499g complement(404732..405376) highly similar to sp|P32836
           Saccharomyces cerevisiae YOR185c GSP2 GTP-binding
           protein of the RAS superfamily, start by similarity
          Length = 214

 Score = 52.4 bits (124), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 58/120 (48%), Gaps = 10/120 (8%)

Query: 5   LNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLNIVRI----FDLAGQY 60
             +V+VG   +GKT+  +  L+  FE+  I T+G+ +       N   I    +D AGQ 
Sbjct: 8   FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLAFYTNFGEIKFDVWDTAGQE 67

Query: 61  RFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDC--IPMLILGNKIDL 118
           +F  L D Y+  A   I + D+  +  +       R ++    R C  IP+++ GNK+D+
Sbjct: 68  KFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDLV----RVCENIPIVLCGNKVDV 123

>Scas_586.6
          Length = 219

 Score = 52.4 bits (124), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 59/120 (49%), Gaps = 10/120 (8%)

Query: 5   LNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLNIVRI----FDLAGQY 60
             +V+VG   +GKT+  +  L+  FE+  I T+G+ +   +   N   I    +D AGQ 
Sbjct: 13  FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFFTNYGEIKFDCWDTAGQE 72

Query: 61  RFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDC--IPMLILGNKIDL 118
           +F  L D Y+  A   I + D+  +  +       R ++    R C  IP+++ GNK+D+
Sbjct: 73  KFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDLV----RVCENIPIVLCGNKVDV 128

>AGR294C [4605] [Homologous to ScYOR185C (GSP2) - SH; ScYLR293C
           (GSP1) - SH] (1287042..1287686) [645 bp, 214 aa]
          Length = 214

 Score = 52.0 bits (123), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 58/120 (48%), Gaps = 10/120 (8%)

Query: 5   LNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLNIVRI----FDLAGQY 60
             +V+VG   +GKT+  +  L+  FE+  I T+G+ +       N   I    +D AGQ 
Sbjct: 8   FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLAFYTNFGEIKFDVWDTAGQE 67

Query: 61  RFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDC--IPMLILGNKIDL 118
           +F  L D Y+  A   I + D+  +  +       R ++    R C  IP+++ GNK+D+
Sbjct: 68  KFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDLV----RVCENIPIVLCGNKVDV 123

>Scas_674.5
          Length = 208

 Score = 52.0 bits (123), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 63/125 (50%), Gaps = 8/125 (6%)

Query: 5   LNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRM--EQFTM---GLNIVRIFDLAGQ 59
           L ++I+G    GKTSL    ++  + Q    T+G     ++ T+    +  ++++D AGQ
Sbjct: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDDDKVATMQVWDTAGQ 68

Query: 60  YRFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTN---RDCIPMLILGNKI 116
            RFQ L   ++  AD  + V D+ +  ++   K    + +V  N    +  P +ILGNK+
Sbjct: 69  ERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILGNKV 128

Query: 117 DLITT 121
           D+  T
Sbjct: 129 DIDET 133

>CAGL0E02607g complement(248761..249387) highly similar to sp|P32939
           Saccharomyces cerevisiae YML001w YPT7 GTP-binding
           protein of the RAB family, start by similarity
          Length = 208

 Score = 51.6 bits (122), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 60/122 (49%), Gaps = 8/122 (6%)

Query: 5   LNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLN-----IVRIFDLAGQ 59
           L ++I+G    GKTSL    ++  + Q    T+G       + L+      ++++D AGQ
Sbjct: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDDDKVVTMQVWDTAGQ 68

Query: 60  YRFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTN---RDCIPMLILGNKI 116
            RFQ L   ++  AD  + V D+ +  ++   K    + +V  N    +  P +ILGNK+
Sbjct: 69  ERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILGNKV 128

Query: 117 DL 118
           D+
Sbjct: 129 DI 130

>YNL093W (YPT53) [4498] chr14 (449868..450530) GTP-binding protein
           involved in endocytosis and transport of proteins to the
           vacuole, member of the rab family in the ras superfamily
           [663 bp, 220 aa]
          Length = 220

 Score = 51.6 bits (122), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 34/134 (25%), Positives = 67/134 (50%), Gaps = 5/134 (3%)

Query: 5   LNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRM--EQFTMGLNIVR--IFDLAGQY 60
           + +V++G    GK+S+    +S  F++   PT+G     ++ T    +++  I+D AGQ 
Sbjct: 13  IKVVLLGESAVGKSSIVLRFVSDDFKESKEPTIGAAFLTKRITRDGKVIKFEIWDTAGQE 72

Query: 61  RFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKIDLIT 120
           RF  L   Y+  A   + V D+ ++ ++ + +  V ++      D I + ++GNK+DL+ 
Sbjct: 73  RFAPLAPMYYRNAQAALVVFDVTNEGSFYKAQNWVEELHEKVGHD-IVIALVGNKMDLLN 131

Query: 121 TLDTPNNGRTRKPV 134
             D   N   + P 
Sbjct: 132 NDDENENRAMKAPA 145

>KLLA0F20471g 1901749..1902387 highly similar to sp|Q99260
           Saccharomyces cerevisiae YLR262c YPT6 GTP-binding
           protein of the rab family, start by similarity
          Length = 212

 Score = 51.2 bits (121), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 33/121 (27%), Positives = 64/121 (52%), Gaps = 4/121 (3%)

Query: 3   KQLNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLN----IVRIFDLAG 58
           ++  IV +G Q  GKTSL    +   F+ +   T+G+     TM L+     ++++D AG
Sbjct: 10  RKYKIVFLGEQGVGKTSLITRFMYDTFDDNYQATIGIDFLSKTMYLDDKTIRLQLWDTAG 69

Query: 59  QYRFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKIDL 118
           Q RF+ L   Y   + + I V D+ ++ ++    + +  V ++   + + ++I+GNK DL
Sbjct: 70  QERFRSLIPSYIRDSHVAIVVYDVTNRKSFEYIDKWIEDVKMERGEENVILVIVGNKSDL 129

Query: 119 I 119
           +
Sbjct: 130 V 130

>Scas_662.26
          Length = 212

 Score = 51.2 bits (121), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 63/120 (52%), Gaps = 5/120 (4%)

Query: 4   QLNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRM--EQFTMGLNIVR--IFDLAGQ 59
            + +V++G    GK+S+    +S  F ++  PT+G     ++  +  N V+  I+D AGQ
Sbjct: 7   SIKLVLLGEAAVGKSSIVLRFVSNDFSENKEPTIGAAFLTQRVNINDNTVKFEIWDTAGQ 66

Query: 60  YRFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKIDLI 119
            RF  L   Y+  A   + V D+    ++ + +  ++++    N+D I  L+ GNK+D++
Sbjct: 67  ERFASLAPMYYRNAQAALIVYDVTKPQSFIKARHWIKELHEQANKDMIIALV-GNKVDVL 125

>Kwal_56.23361
          Length = 214

 Score = 50.1 bits (118), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 58/120 (48%), Gaps = 10/120 (8%)

Query: 5   LNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFT----MGLNIVRIFDLAGQY 60
             +V+VG   +GKT+  +  L+  FE+  I T+G+ +         G     ++D AGQ 
Sbjct: 8   FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLAFYTDFGELKFDVWDTAGQE 67

Query: 61  RFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDC--IPMLILGNKIDL 118
           +F  L D Y+  A   I + D+  +  +       R ++    R C  IP+++ GNK+D+
Sbjct: 68  KFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDLV----RVCENIPIVLCGNKVDV 123

>ACL084C [965] [Homologous to ScYOR089C (VPS21) - SH; ScYNL093W
           (YPT53) - SH] (199020..199643) [624 bp, 207 aa]
          Length = 207

 Score = 49.3 bits (116), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 65/133 (48%), Gaps = 11/133 (8%)

Query: 4   QLNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRM--EQFTMGLNIVR--IFDLAGQ 59
            + +V++G    GK+S+    +S  F ++  PT+G     ++  M    ++  I+D AGQ
Sbjct: 7   SIKLVLLGEAAVGKSSIVLRFVSNDFSENKEPTIGAAFLTQRVNMDSKTIKFEIWDTAGQ 66

Query: 60  YRFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKIDLI 119
            RF  L   Y+  A   + V D+    ++ + +  V+++    ++  +  L+ GNK+DL+
Sbjct: 67  ERFASLAPMYYRNAQAALVVYDITKPQSFIKARHWVKELHEQASKGIVIALV-GNKLDLL 125

Query: 120 TTLDTPNNGRTRK 132
                  NG  RK
Sbjct: 126 ------ENGEARK 132

>Sklu_2202.6 YBR164C, Contig c2202 5407-5958
          Length = 183

 Score = 48.9 bits (115), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 59/118 (50%), Gaps = 3/118 (2%)

Query: 1   MSKQLNIVIVGLQNSGKTS-LTRALLSKPFEQDTIPTLGMRMEQFTMGLNIVRIFDLAGQ 59
           ++K+L I+I+GL  +GKT+ L R  + +     T PT+G  +E  T     + ++DL GQ
Sbjct: 15  INKELRILILGLDGAGKTTILYRLQIGEVV--TTKPTIGFNVETLTYKNLKLNVWDLGGQ 72

Query: 60  YRFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKID 117
              +  W  Y+     +I+V+D  D+   +   + +  ++ +       +L+  NK D
Sbjct: 73  TSIRPYWRCYYANTAAVIFVVDSTDKDRMSTASKELHMMLQEEELQDAALLVFANKQD 130

>CAGL0F02123g 212117..212764 highly similar to sp|P07560
           Saccharomyces cerevisiae YFL005w SEC4, start by
           similarity
          Length = 215

 Score = 49.3 bits (116), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 65/130 (50%), Gaps = 5/130 (3%)

Query: 5   LNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLN----IVRIFDLAGQY 60
           + I+++G    GK+ L    +   F    I T+G+  +  T+ +N     ++++D AGQ 
Sbjct: 21  MKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGKKVKLQLWDTAGQE 80

Query: 61  RFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKIDLIT 120
           RF+ +   Y+  A  II V D+ D+  +A  K+  + V    N D   +L++GNK D+ T
Sbjct: 81  RFRTITTAYYRGAMGIILVYDVTDERTFANIKQWFKTVNEHAN-DEAQLLLVGNKSDMDT 139

Query: 121 TLDTPNNGRT 130
            + T   G  
Sbjct: 140 RVVTYEQGEA 149

>YFL005W (SEC4) [1676] chr6 (130329..130976) GTP-binding protein
           involved in vesicular transport between Golgi and plasma
           membrane, member of the rab family in the ras
           superfamily [648 bp, 215 aa]
          Length = 215

 Score = 49.3 bits (116), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 36/130 (27%), Positives = 65/130 (50%), Gaps = 5/130 (3%)

Query: 5   LNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLN----IVRIFDLAGQY 60
           + I+++G    GK+ L    +   F    I T+G+  +  T+ +N     ++++D AGQ 
Sbjct: 21  MKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGKKVKLQLWDTAGQE 80

Query: 61  RFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKIDLIT 120
           RF+ +   Y+  A  II V D+ D+  +   K+  + V    N D   +L++GNK D+ T
Sbjct: 81  RFRTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVNEHAN-DEAQLLLVGNKSDMET 139

Query: 121 TLDTPNNGRT 130
            + T + G  
Sbjct: 140 RVVTADQGEA 149

>Kwal_23.5058
          Length = 213

 Score = 48.9 bits (115), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 64/130 (49%), Gaps = 5/130 (3%)

Query: 5   LNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLNIVRI----FDLAGQY 60
           + I++VG    GK+ L    +   F    I T+G+  +  T+ +N  ++    +D AGQ 
Sbjct: 21  MKILLVGDSGVGKSCLLVRFVEDKFSPSFITTIGIDFKIKTVDINGKKVKLQLWDTAGQE 80

Query: 61  RFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKIDLIT 120
           RF+ +   Y+  A  II V D+ D+  +A  K+    V    N D   +L++GNK D+ T
Sbjct: 81  RFRTITTAYYRGAMGIILVYDVTDERTFANVKQWFSTVNQHAN-DEAQLLLVGNKSDMDT 139

Query: 121 TLDTPNNGRT 130
              + + G +
Sbjct: 140 RAVSTDQGES 149

>KLLA0D01265g 110784..111407 highly similar to sp|P32939
           Saccharomyces cerevisiae YML001w YPT7 GTP-binding
           protein of the RAB family, start by similarity
          Length = 207

 Score = 48.9 bits (115), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 45/175 (25%), Positives = 77/175 (44%), Gaps = 26/175 (14%)

Query: 1   MSKQLNI---VIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLN-----IVR 52
           MS++ NI   +I+G    GKTSL    ++  + Q    T+G       + +N      ++
Sbjct: 1   MSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIVNDDKVATMQ 60

Query: 53  IFDLAGQYRFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTN---RDCIPM 109
           ++D AGQ RFQ L   ++  AD  + V D+ +  ++   K    + +V  N    +  P 
Sbjct: 61  VWDTAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPF 120

Query: 110 LILGNKIDLITTLDTPNNGRTRKPVKRSAGDQNALEQWKYMA--PLLRNYEYDDI 162
           +IL NK+D+             +  K+    ++A EQ K +   PL      D I
Sbjct: 121 VILANKVDV-------------EESKKVVSSRSAQEQAKSLGNVPLFFTSAKDSI 162

>Scas_707.26
          Length = 210

 Score = 48.9 bits (115), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 36/130 (27%), Positives = 65/130 (50%), Gaps = 5/130 (3%)

Query: 5   LNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLNIVRI----FDLAGQY 60
           + I+++G    GK+ L    +   F    I T+G+  +  T+ +N  ++    +D AGQ 
Sbjct: 17  MKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGKKVKLQLWDTAGQE 76

Query: 61  RFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKIDLIT 120
           RF+ +   Y+  A  II V D+ D+  ++  K+  + V    N D   +L++GNK D+ T
Sbjct: 77  RFRTITTAYYRGAMGIILVYDVTDERTFSNVKQWFKTVNEHAN-DEAQLLLVGNKSDMDT 135

Query: 121 TLDTPNNGRT 130
            + T   G +
Sbjct: 136 RVVTYEQGES 145

>Sklu_2293.3 YLR262C, Contig c2293 4975-5619
          Length = 214

 Score = 48.5 bits (114), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 60/120 (50%), Gaps = 4/120 (3%)

Query: 4   QLNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLN----IVRIFDLAGQ 59
           +  IV +G Q  GKTSL    +   F+     T+G+     TM L+     ++++D AGQ
Sbjct: 12  KYKIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYLDDKTIRLQLWDTAGQ 71

Query: 60  YRFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKIDLI 119
            RF+ L   Y   + + I V D+ ++ ++    + +  V  +   + + + I+GNK DL+
Sbjct: 72  ERFRSLIPSYIRDSHVAIVVYDVTNKKSFEYIDKWIEDVKSERGEENVILCIVGNKNDLV 131

>Kwal_34.16142
          Length = 192

 Score = 48.1 bits (113), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 46/150 (30%), Positives = 71/150 (47%), Gaps = 17/150 (11%)

Query: 1   MSKQLNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLNIVR------IF 54
           ++K   I +VG +N GK+SLT   +   F +   PT+     QFT  + + R      I 
Sbjct: 8   IAKHRKIAVVGARNVGKSSLTVQFVESRFVEPYYPTI---ENQFTKQIVLGRTTYTLEIC 64

Query: 55  DLAGQYRFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVD-TNRDCIPMLILG 113
           D AGQ  F  +  +       +  V    ++ ++ E  E +R  I+D    + IP +ILG
Sbjct: 65  DTAGQDEFSLINTKSLIGVKGVAIVYSCVNRASF-EIVELIRDKILDQVGLEQIPTVILG 123

Query: 114 NKIDLITTLDTPNNGRTRKPVKRSAGDQNA 143
           NKIDL    D+  NG     V+R  G++ A
Sbjct: 124 NKIDL---RDSGING---GKVRRQEGEELA 147

>CAGL0I10835g 1060258..1060809 highly similar to sp|P38116
           Saccharomyces cerevisiae YBR164c ADP-ribosylation
           factor, start by similarity
          Length = 183

 Score = 47.8 bits (112), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 59/118 (50%), Gaps = 3/118 (2%)

Query: 1   MSKQLNIVIVGLQNSGKTS-LTRALLSKPFEQDTIPTLGMRMEQFTMGLNIVRIFDLAGQ 59
           ++K+L I+I+GL  +GKT+ L R  + +     T PT+G  +E  T     + ++DL GQ
Sbjct: 15  INKELRILILGLDGAGKTTILYRLQIGEVVT--TKPTIGFNVETLTYKNLKLNVWDLGGQ 72

Query: 60  YRFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKID 117
              +  W  Y+     +I+V+D  D+   +   + +  ++ +       +L+  NK D
Sbjct: 73  TSIRPYWRCYYADTAAVIFVVDSTDKDRMSTASKELHLMLQEEELQDAALLVFANKQD 130

>Kwal_56.24149
          Length = 149

 Score = 47.0 bits (110), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 39/83 (46%)

Query: 35  PTLGMRMEQFTMGLNIVRIFDLAGQYRFQHLWDRYFDRADLIIYVIDLADQTNWAECKEA 94
           PT     E+  +G      FDL G  + + LW  YF   + I++++D AD     E +  
Sbjct: 12  PTWHPTSEELAIGNIKFTTFDLGGHIQARRLWKDYFPEVNGIVFLVDAADPERLNEARVE 71

Query: 95  VRKVIVDTNRDCIPMLILGNKID 117
           +  +        +P +ILGNKID
Sbjct: 72  LDALFNIAELKDVPFVILGNKID 94

>KLLA0C13728g 1173329..1173955 highly similar to sp|P36017
           Saccharomyces cerevisiae YOR089c VPS21 GTP-binding
           protein, start by similarity
          Length = 208

 Score = 47.8 bits (112), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 63/122 (51%), Gaps = 5/122 (4%)

Query: 4   QLNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRM--EQFTMGLNIVR--IFDLAGQ 59
            + +V++G    GK+S+    +S  F ++  PT+G     ++  M  + ++  I+D AGQ
Sbjct: 7   SIKLVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQRVNMADHTIKFEIWDTAGQ 66

Query: 60  YRFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKIDLI 119
            RF  L   Y+  A   + V D+    ++ + +  V+++    ++  +  L+ GNK+DL+
Sbjct: 67  ERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKELHEQASKGIVIALV-GNKMDLL 125

Query: 120 TT 121
            +
Sbjct: 126 ES 127

>Scas_700.11
          Length = 183

 Score = 47.4 bits (111), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 58/118 (49%), Gaps = 3/118 (2%)

Query: 1   MSKQLNIVIVGLQNSGKTS-LTRALLSKPFEQDTIPTLGMRMEQFTMGLNIVRIFDLAGQ 59
           ++K+L I+I+GL  +GKT+ L R  + +     T PT+G  +E  T     + ++DL GQ
Sbjct: 15  VNKELRILILGLDGAGKTTILYRLQIGEVVT--TKPTIGFNVETLTYKNLKLNVWDLGGQ 72

Query: 60  YRFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKID 117
              +  W  Y+     +I+V+D  D+       + +  ++ +       +L+  NK D
Sbjct: 73  TSIRPYWRCYYADTAAVIFVVDSTDKDRMGTASKELHLMLQEEELQDAALLVFANKQD 130

>Sklu_1815.2 YFL005W, Contig c1815 3148-3789 reverse complement
          Length = 213

 Score = 47.8 bits (112), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 63/129 (48%), Gaps = 5/129 (3%)

Query: 5   LNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLNIVRI----FDLAGQY 60
           + I++VG    GK+ L    +   F    I T+G+  +  T+ +N  +I    +D AGQ 
Sbjct: 21  MKILLVGDSGVGKSCLLVRFVEDKFSPSFITTIGIDFKIKTVDINGKKIKLQLWDTAGQE 80

Query: 61  RFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKIDLIT 120
           RF+ +   Y+  A  II V D+ D+  ++  K+ +  V    N D   +L++GNK D+ T
Sbjct: 81  RFRTITTAYYRGAMGIILVYDVTDERTFSNIKQWLSTVNQHAN-DEAQLLLVGNKSDMDT 139

Query: 121 TLDTPNNGR 129
              T   G 
Sbjct: 140 RAVTYEQGE 148

>AGR221W [4532] [Homologous to ScYBR164C (ARL1) - SH]
           complement(1164831..1165382) [552 bp, 183 aa]
          Length = 183

 Score = 47.4 bits (111), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/117 (25%), Positives = 55/117 (47%), Gaps = 1/117 (0%)

Query: 1   MSKQLNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLNIVRIFDLAGQY 60
           ++K+L I+I+GL  +GKT++   L        T PT+G  +E  T     + ++DL GQ 
Sbjct: 15  VNKELRILILGLDGAGKTTILYRLQVGEV-VTTKPTIGFNVETLTYRNLKLNVWDLGGQT 73

Query: 61  RFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKID 117
             +  W  Y+     +I+V+D  D+         +  ++ +       +L+  NK D
Sbjct: 74  SIRPYWRCYYANTAAVIFVVDSTDKDRMGVAARELHTMLQEEELQDAALLVFANKQD 130

>Kwal_56.22555
          Length = 212

 Score = 47.8 bits (112), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 34/119 (28%), Positives = 59/119 (49%), Gaps = 4/119 (3%)

Query: 4   QLNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLN----IVRIFDLAGQ 59
           +  IV +G Q  GKTSL    +   F+     T+G+     TM L+     ++++D AGQ
Sbjct: 12  KYKIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYLDDKTIRLQLWDTAGQ 71

Query: 60  YRFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKIDL 118
            RF+ L   Y   + + I V D+ ++ ++    + V  V  +   + + + I+GNK DL
Sbjct: 72  ERFRSLIPSYIRDSHVAIVVYDVTNKKSFEYIDKWVEDVKSERGEENVVLCIVGNKNDL 130

>KLLA0D02376g 201512..202135 similar to sp|P36018 Saccharomyces
           cerevisiae YKR014c YPT52 GTP-binding protein of the rab
           family, start by similarity
          Length = 207

 Score = 47.8 bits (112), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/129 (24%), Positives = 64/129 (49%), Gaps = 8/129 (6%)

Query: 4   QLNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLN--------IVRIFD 55
           Q  +V++G  + GK+S+    +   F++    T+G      T+ L+           I+D
Sbjct: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEIWD 62

Query: 56  LAGQYRFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNK 115
            AGQ R++ L   Y+  A+  + V D+ +  +  + K  V ++    N D + + ++GNK
Sbjct: 63  TAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICLVGNK 122

Query: 116 IDLITTLDT 124
           +DL++  ++
Sbjct: 123 LDLVSERES 131

>AER132W [2636] [Homologous to ScYML064C (TEM1) - SH]
           complement(888052..888750) [699 bp, 232 aa]
          Length = 232

 Score = 47.8 bits (112), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 40/139 (28%), Positives = 60/139 (43%), Gaps = 6/139 (4%)

Query: 4   QLNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLN----IVRIFDLAGQ 59
           ++ I ++G    GKTSL    +   F+++   TLG+   +  + L     I  I DL GQ
Sbjct: 15  KIKIGLIGDAQVGKTSLMVKYVQNVFDEEYTQTLGVHYLERKINLGSTDVIFSIMDLGGQ 74

Query: 60  YRFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKIDLI 119
             F ++     +RA  II++ DL         +E  R+     N   IP+L+ G K DL 
Sbjct: 75  REFINMLPLVSNRAVAIIFLFDLTRPETLTSIREWYRQA-RGFNETAIPLLV-GTKYDLF 132

Query: 120 TTLDTPNNGRTRKPVKRSA 138
             LD        K   R A
Sbjct: 133 VNLDVAYQEELSKTSMRYA 151

>Kwal_47.16983
          Length = 223

 Score = 47.4 bits (111), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 41/143 (28%), Positives = 63/143 (44%), Gaps = 6/143 (4%)

Query: 5   LNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRM--EQFTMGLN--IVRIFDLAGQY 60
           L I ++G    GKTSL    +   F+++   TLG+    ++ T+G    +  I DL GQ 
Sbjct: 19  LKIGLIGDAQVGKTSLMVKYVENVFDEEYTQTLGVNCLSKKITLGSAEILFYIMDLGGQR 78

Query: 61  RFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKIDLIT 120
            F ++     + A  II++ DL         KE  R+     N   +P+L+ G K DL  
Sbjct: 79  EFINMLPLASEGAKAIIFLFDLTRPETLKSIKEWHRQA-TGFNEQAVPLLV-GTKYDLFV 136

Query: 121 TLDTPNNGRTRKPVKRSAGDQNA 143
            LD     +  K   R A   +A
Sbjct: 137 NLDPEYQAQISKQSMRYAQAMDA 159

>YER031C (YPT31) [1456] chr5 complement(214075..214746) GTP-binding
           protein required in the secretory pathway at the stage
           of formation of trans-Golgi vesicles, member of the rab
           family in the ras superfamily of small GTP-binding
           proteins [672 bp, 223 aa]
          Length = 223

 Score = 47.0 bits (110), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 59/116 (50%), Gaps = 5/116 (4%)

Query: 7   IVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLNIVRI----FDLAGQYRF 62
           IV++G    GK++L        F  D+  T+G+     T+ ++  RI    +D AGQ R+
Sbjct: 16  IVLIGDSGVGKSNLLSRFTKNEFNMDSKSTIGVEFATRTLEIDGKRIKAQIWDTAGQERY 75

Query: 63  QHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKIDL 118
           + +   Y+  A   + V D++  +++  C   + ++  + + D + + ++GNK DL
Sbjct: 76  RAITSAYYRGAVGALIVYDISKSSSYENCNHWLSELRENAD-DNVAVGLIGNKSDL 130

>Scas_574.2
          Length = 222

 Score = 47.0 bits (110), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 57/116 (49%), Gaps = 4/116 (3%)

Query: 7   IVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLN----IVRIFDLAGQYRF 62
           IV +G Q  GKTSL    +   F+     T+G+     TM L+     ++++D AGQ RF
Sbjct: 13  IVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYLDDKTIRLQLWDTAGQERF 72

Query: 63  QHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKIDL 118
           + L   Y   + + I V D+  + ++    + +  V  +   D + + I+GNK DL
Sbjct: 73  RSLIPSYIRDSRVAIVVYDITKKKSFEYIDKWIEDVKNERGDDNVILCIVGNKSDL 128

>YBR164C (ARL1) [350] chr2 complement(567832..568383) GTP-binding
           protein of the arf-sar family in the ras superfamily,
           possibly involved in signal transduction, and plays a
           role in membrane trafficking [552 bp, 183 aa]
          Length = 183

 Score = 46.2 bits (108), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 57/116 (49%), Gaps = 3/116 (2%)

Query: 3   KQLNIVIVGLQNSGKTS-LTRALLSKPFEQDTIPTLGMRMEQFTMGLNIVRIFDLAGQYR 61
           K+L I+I+GL  +GKT+ L R  + +     T PT+G  +E  +     + ++DL GQ  
Sbjct: 17  KELRILILGLDGAGKTTILYRLQIGEVV--TTKPTIGFNVETLSYKNLKLNVWDLGGQTS 74

Query: 62  FQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKID 117
            +  W  Y+     +I+V+D  D+   +   + +  ++ +       +L+  NK D
Sbjct: 75  IRPYWRCYYADTAAVIFVVDSTDKDRMSTASKELHLMLQEEELQDAALLVFANKQD 130

>AAL176C [11] [Homologous to ScYKR014C (YPT52) - SH] (31588..32205)
           [618 bp, 205 aa]
          Length = 205

 Score = 45.8 bits (107), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 29/123 (23%), Positives = 60/123 (48%), Gaps = 7/123 (5%)

Query: 4   QLNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLN-------IVRIFDL 56
           Q  +V++G  + GK+S+    +   F++    T+G      T+ L           I+D 
Sbjct: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHDDAMIKFEIWDT 62

Query: 57  AGQYRFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKI 116
           AGQ R++ L   Y+  A+  + V D+  + + A+ +  V ++      + + + ++GNK+
Sbjct: 63  AGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVGNKL 122

Query: 117 DLI 119
           DL+
Sbjct: 123 DLV 125

>AGR257C [4568] [Homologous to ScYLR262C (YPT6) - SH]
           (1225886..1226548) [663 bp, 220 aa]
          Length = 220

 Score = 45.4 bits (106), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 60/120 (50%), Gaps = 4/120 (3%)

Query: 4   QLNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLN----IVRIFDLAGQ 59
           +  IV +G Q  GKTSL    +   F+     T+G+     T+ L+     ++++D AGQ
Sbjct: 12  KYKIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTVYLDDRTIRLQLWDTAGQ 71

Query: 60  YRFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKIDLI 119
            RF+ L   Y   + + I V D+ ++ ++    + V  V  +   + + + I+GNK DL+
Sbjct: 72  ERFRSLIPSYIRDSHVAIVVYDITNKKSFEYIDKWVEDVRNERGEENLILCIVGNKSDLV 131

>CAGL0C02453g 247493..248149 highly similar to sp|P38555
           Saccharomyces cerevisiae YER031c YPT31, start by
           similarity
          Length = 218

 Score = 45.4 bits (106), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/118 (23%), Positives = 60/118 (50%), Gaps = 5/118 (4%)

Query: 5   LNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLN----IVRIFDLAGQY 60
             IV++G    GK++L     +  F  D+  T+G+     T+ ++      +I+D AGQ 
Sbjct: 14  FKIVLIGDSGVGKSNLLSRFTTNEFNIDSKSTIGVEFATRTIDVDGKKIKAQIWDTAGQE 73

Query: 61  RFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKIDL 118
           R++ +   Y+  A   + V D++  +++  C   + ++  + + D + + ++GNK DL
Sbjct: 74  RYRAITSAYYRGAVGALIVYDISKSSSYENCHHWLSELRENAD-DNVAVGLIGNKSDL 130

>YCR027C (RHB1) [561] chr3 complement(167365..167994) Protein
           involved in regulation of arginine and lysine uptake,
           member of the Rheb family in the Ras superfamily of G
           proteins [630 bp, 209 aa]
          Length = 209

 Score = 44.7 bits (104), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 48/203 (23%), Positives = 87/203 (42%), Gaps = 31/203 (15%)

Query: 4   QLNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLG---MRMEQFTMGLNIVRIFDLAGQY 60
           Q  I ++G +N GKT+LT   +   F +   PT+     R+  +      + I D AGQ 
Sbjct: 16  QRKIALIGARNVGKTTLTVRFVESRFVESYYPTIENEFTRIIPYKSHDCTLEILDTAGQD 75

Query: 61  RFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKIDLIT 120
               L  +       II    + ++ ++        K++    +D +P++++G K DL  
Sbjct: 76  EVSLLNIKSLTGVRGIILCYSIINRASFDLIPILWDKLVDQLGKDNLPVILVGTKADL-- 133

Query: 121 TLDTPNNGRTRKPVKR------------SAGDQNALEQWKYMAPLLRNYEYDDIPTYQLD 168
                  GR+ K VKR            + G Q+   Q  ++     + E D    Y ++
Sbjct: 134 -------GRSTKGVKRCVTKAEGEKLASTIGSQDKRNQAAFIEC---SAELD----YNVE 179

Query: 169 ESNLYVLRNIETLSKELGLDLKN 191
           E+ + +L+ +E +   LGLD +N
Sbjct: 180 ETFMLLLKQMERVEGTLGLDAEN 202

>YLR262C (YPT6) [3655] chr12 complement(668246..668893) GTP-binding
           protein involved in the secretory pathway, member of the
           rab family in the ras superfamily [648 bp, 215 aa]
          Length = 215

 Score = 44.7 bits (104), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 58/119 (48%), Gaps = 4/119 (3%)

Query: 4   QLNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLN----IVRIFDLAGQ 59
           +  IV +G Q  GKTSL    +   F+     T+G+     TM L+     ++++D AGQ
Sbjct: 10  KYKIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYLDDKTIRLQLWDTAGQ 69

Query: 60  YRFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKIDL 118
            RF+ L   Y   + + I V D+  + ++    + +  V  +   + + + I+GNK DL
Sbjct: 70  ERFRSLIPSYIRDSRVAIIVYDITKRKSFEYIDKWIEDVKNERGDENVILCIVGNKSDL 128

>KLLA0E12111g 1075299..1075943 highly similar to sp|P07560
           Saccharomyces cerevisiae YFL005w SEC4 GTP-binding
           protein of the ras superfamily, start by similarity
          Length = 214

 Score = 44.7 bits (104), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 60/120 (50%), Gaps = 5/120 (4%)

Query: 5   LNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLNIVRI----FDLAGQY 60
           + I+++G    GK+ L    +   F    I T+G+  +  T+ +N  R+    +D AGQ 
Sbjct: 21  MKILLLGDSGVGKSCLLVRFVEDKFTPTFITTIGIDFKIKTVDINGKRVKLQLWDTAGQE 80

Query: 61  RFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKIDLIT 120
           RF+ +   Y+  A  I+ + D+ D+  +   ++    V    + D + ML++GNK D+ T
Sbjct: 81  RFRTITTAYYRGAMGIVLIYDVTDERTFENIRQWFSTVNQHASEDVV-MLLVGNKKDMDT 139

>CAGL0K06017g complement(586093..586752) highly similar to sp|Q99260
           Saccharomyces cerevisiae YLR262c GTP-binding protein,
           start by similarity
          Length = 219

 Score = 44.7 bits (104), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/116 (27%), Positives = 58/116 (50%), Gaps = 4/116 (3%)

Query: 7   IVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLN----IVRIFDLAGQYRF 62
           IV +G Q  GKTSL    +   F+ +   T+G+     TM L+     ++++D AGQ RF
Sbjct: 14  IVFLGEQGVGKTSLITRFMYDTFDDNYQATIGIDFLSKTMYLDDKTIRLQLWDTAGQERF 73

Query: 63  QHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKIDL 118
           + L   Y   + + I V D+  + ++    + +  V  +   + + + ++GNK DL
Sbjct: 74  RSLIPSYIRDSRVAIVVYDITKRKSFEFIDKWIEDVKNERGAENVILCVVGNKSDL 129

>Scas_712.41
          Length = 219

 Score = 44.7 bits (104), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 58/118 (49%), Gaps = 5/118 (4%)

Query: 5   LNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTM---GLNI-VRIFDLAGQY 60
             IV++G    GK++L     +  F  ++  T+G+     T+   G  I  +I+D AGQ 
Sbjct: 14  FKIVLIGDSGVGKSNLLSRFTTNEFNIESKSTIGVEFATRTIEVEGKKIKAQIWDTAGQE 73

Query: 61  RFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKIDL 118
           R++ +   Y+  A   + V D++    +  C   +++ + D   D + + ++GNK DL
Sbjct: 74  RYRAITSAYYRGAVGALIVYDISKSGTYENCNHWLKE-LRDNADDNVAVGLIGNKSDL 130

>AGL021W [4290] [Homologous to ScYFL005W (SEC4) - SH]
           complement(681760..682398) [639 bp, 212 aa]
          Length = 212

 Score = 44.3 bits (103), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 61/130 (46%), Gaps = 5/130 (3%)

Query: 5   LNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLNIVRI----FDLAGQY 60
           + I++VG    GK+ L    +   F    I T+G+  +   + +N  +I    +D AGQ 
Sbjct: 20  MKILLVGDSGVGKSCLLVRFVEDKFSPSFITTIGIDFKIKAVDINGKKIKLQLWDTAGQE 79

Query: 61  RFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKIDLIT 120
           RF+ +   Y+  A  II V D+ D+  +   ++    V    N +   +L++GNK D+ T
Sbjct: 80  RFRTITTAYYRGAMGIILVYDVTDERTFENIRQWFTTVNQHANEEA-QLLLVGNKKDMDT 138

Query: 121 TLDTPNNGRT 130
              T   G +
Sbjct: 139 RAVTYEQGES 148

>Sklu_2345.5 YCR027C, Contig c2345 9936-10595
          Length = 219

 Score = 44.3 bits (103), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/145 (27%), Positives = 67/145 (46%), Gaps = 12/145 (8%)

Query: 2   SKQLNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLG---MRMEQFTMGLNIVRIFDLAG 58
           SK   I +VG +N GK+S+T   +   F +   PT+     R  +    +  + I D AG
Sbjct: 23  SKHRKIAVVGARNVGKSSITVQFVESHFVESYYPTIENEFSRTVKLGKVMYTLEICDTAG 82

Query: 59  QYRFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNR--DCIPMLILGNKI 116
           Q  F  + +R        + V  + ++ ++ E    +R  I+D     + +P+++ GNKI
Sbjct: 83  QDEFSLVNNRSLMGVAGFLVVYSVVNRHSF-ELVGLIRDKILDQLGLDENVPVVVAGNKI 141

Query: 117 DLITTLDTPNNGRTRKPVKRSAGDQ 141
           DL      P+ G  R+ V R  G Q
Sbjct: 142 DL-----CPDGGNNRQ-VTREEGQQ 160

>KLLA0E24805g 2194554..2195105 highly similar to sp|P38116
           Saccharomyces cerevisiae YBR164c ARL1 ADP-ribosylation
           factor, start by similarity
          Length = 183

 Score = 43.5 bits (101), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 55/116 (47%), Gaps = 3/116 (2%)

Query: 3   KQLNIVIVGLQNSGKTS-LTRALLSKPFEQDTIPTLGMRMEQFTMGLNIVRIFDLAGQYR 61
           K+L I+I+GL  +GKT+ L R  + +     T PT+G  +E        + ++DL GQ  
Sbjct: 17  KELRILILGLDGAGKTTILYRLQIGEVI--TTKPTIGFNVETLNYKNLKLNVWDLGGQTS 74

Query: 62  FQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKID 117
            +  W  Y+     +I+V+D  D+       + +  ++ +       +L+  NK D
Sbjct: 75  IRPYWRCYYANTAAVIFVVDSTDKDRMNIASKELHLMLQEEELQDSALLVFANKQD 130

>Sklu_2144.3 YFL038C, Contig c2144 4079-4693
          Length = 204

 Score = 43.5 bits (101), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 59/118 (50%), Gaps = 5/118 (4%)

Query: 5   LNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLN----IVRIFDLAGQY 60
             ++++G    GK+ L        +  D I T+G+  +  T+ L+     ++I+D AGQ 
Sbjct: 9   FKLLLIGDSGVGKSCLLLRFADDTYTNDYISTIGVDFKIKTVDLDGKTVKLQIWDTAGQE 68

Query: 61  RFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKIDL 118
           RF+ +   Y+  A  II V D+ DQ ++   K  ++++        + +L+ GNK DL
Sbjct: 69  RFRTITSSYYRGAHGIIIVYDVTDQESFNNVKTWLQEIDRYGTAGVLKLLV-GNKNDL 125

>Sklu_1653.3 YML064C, Contig c1653 2277-3047
          Length = 256

 Score = 43.5 bits (101), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 58/125 (46%), Gaps = 6/125 (4%)

Query: 4   QLNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLN----IVRIFDLAGQ 59
           ++ I ++G    GKTSL    +   F+++   TLG+   +  + L     +  I DL GQ
Sbjct: 59  KVKIGLIGDAQVGKTSLMVKYVQNVFDEEYTQTLGVHYLERKIALGSTDVVFSIMDLGGQ 118

Query: 60  YRFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKIDLI 119
             F ++     + A  II++ DL      +  KE  R+     N   I +L+ G K DL 
Sbjct: 119 REFINMLPLVSEGAVSIIFLFDLTRPETLSSIKEWYRQA-RGFNETAIALLV-GTKYDLF 176

Query: 120 TTLDT 124
            T+D+
Sbjct: 177 ITMDS 181

>ABR220W [814] [Homologous to ScYFL038C (YPT1) - SH]
           complement(817290..817904) [615 bp, 204 aa]
          Length = 204

 Score = 43.1 bits (100), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 59/118 (50%), Gaps = 5/118 (4%)

Query: 5   LNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLN----IVRIFDLAGQY 60
             ++++G    GK+ L        +  D I T+G+  +  T+ L+     ++I+D AGQ 
Sbjct: 9   FKLLLIGDSGVGKSCLLLRFADDTYTNDYISTIGVDFKIKTVELDGKTVKLQIWDTAGQE 68

Query: 61  RFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKIDL 118
           RF+ +   Y+  A  II V D+ DQ ++   K  ++++        + +L+ GNK DL
Sbjct: 69  RFRTITSSYYRGAHGIIIVYDVTDQESFDNMKTWLQEIDRYGTAGVVKLLV-GNKNDL 125

>Scas_656.2
          Length = 218

 Score = 43.1 bits (100), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 33/118 (27%), Positives = 59/118 (50%), Gaps = 5/118 (4%)

Query: 5   LNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTM---GLNI-VRIFDLAGQY 60
           + I+++G    GK+ L    +   F    I T+G+  +  T+   G  I ++++D AGQ 
Sbjct: 27  MKILLIGDSGVGKSCLLVRFVENKFNPSFITTIGIDFKIKTLDIQGRKIKLQLWDTAGQE 86

Query: 61  RFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKIDL 118
           RF+ +   Y+  A  II V D+ D+  +   ++    V    N   + +L++GNK DL
Sbjct: 87  RFRTITTAYYRGAMGIILVYDVTDERTFQNIRQWYSTVNEHANEQ-VQLLLVGNKSDL 143

>KLLA0D05313g 459496..460110 gi|10129780|emb|CAC08198.1
           Kluyveromyces lactis putative GTP-binding protein, start
           by similarity
          Length = 204

 Score = 42.7 bits (99), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 59/118 (50%), Gaps = 5/118 (4%)

Query: 5   LNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLN----IVRIFDLAGQY 60
             ++++G    GK+ L        +  D I T+G+  +  T+ L+     ++I+D AGQ 
Sbjct: 9   FKLLLIGDSGVGKSCLLLRFADDTYTNDYISTIGVDFKIKTVELDGKTVKLQIWDTAGQE 68

Query: 61  RFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKIDL 118
           RF+ +   Y+  A  II V D+ DQ ++   K  ++++        + +L+ GNK DL
Sbjct: 69  RFRTITSSYYRGAHGIIIVYDVTDQESFNNVKTWLQEIDRFGTAGVLKLLV-GNKNDL 125

>KLLA0F01232g complement(114430..115062) similar to sp|P36019
           Saccharomyces cerevisiae YNL093w YPT53 GTP-binding
           protein of the RAB family (RAS superfamily), start by
           similarity
          Length = 210

 Score = 42.7 bits (99), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 33/128 (25%), Positives = 61/128 (47%), Gaps = 14/128 (10%)

Query: 5   LNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMR-----MEQFTMGLNIVR-----IF 54
           + +V++G  + GK+++     +  F  ++ PT+G       ME       I R     I+
Sbjct: 10  VKLVLLGESSVGKSTIVTRFTTGEFHINS-PTIGAAFSTKAMEWVDSEDGIKRRVNFEIW 68

Query: 55  DLAGQYRFQHLWDRYFDRADLIIYVID---LADQTNWAECKEAVRKVIVDTNRDCIPMLI 111
           D AGQ R++ L   Y+   D+ + V D   LA +       + +   + D  +D + + +
Sbjct: 69  DTAGQERYRSLAPMYYRNTDVALIVFDVTQLASEKKAQSWIDELNNYLEDYKKDTVQLRV 128

Query: 112 LGNKIDLI 119
           +GNKIDL+
Sbjct: 129 VGNKIDLV 136

>AGL093W [4218] [Homologous to ScYLR229C (CDC42) - SH]
           complement(532002..532577) [576 bp, 191 aa]
          Length = 191

 Score = 42.4 bits (98), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 55/126 (43%), Gaps = 18/126 (14%)

Query: 3   KQLNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLG--------MRMEQFTMGLNIVRIF 54
           + L  V+VG    GKT L  +  +  F  D +PT+         +  E +T+GL     F
Sbjct: 2   QTLKCVVVGDGAVGKTCLLISYTTNQFPADYVPTVFDNYAVTVMIGDEPYTLGL-----F 56

Query: 55  DLAGQYRFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDC--IPMLIL 112
           D AGQ  +  L    +   D+ +    +    ++   KE   K   + +  C  +P LI+
Sbjct: 57  DTAGQEDYDRLRPLSYPSTDVFLVCFSVVSPPSFENVKE---KWFPEVHHHCPGVPCLIV 113

Query: 113 GNKIDL 118
           G +IDL
Sbjct: 114 GTQIDL 119

>YFL038C (YPT1) [1645] chr6 complement(55365..55985) GTP-binding
           protein required for vesicle transport from ER to Golgi
           and within the Golgi stack, member of the rab family in
           the ras superfamily of GTP-binding proteins [621 bp, 206
           aa]
          Length = 206

 Score = 42.4 bits (98), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 59/118 (50%), Gaps = 5/118 (4%)

Query: 5   LNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLN----IVRIFDLAGQY 60
             ++++G    GK+ L        +  D I T+G+  +  T+ L+     ++I+D AGQ 
Sbjct: 9   FKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGKTVKLQIWDTAGQE 68

Query: 61  RFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKIDL 118
           RF+ +   Y+  +  II V D+ DQ ++   K  ++++        + +L+ GNK DL
Sbjct: 69  RFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLKLLV-GNKCDL 125

>YKR014C (YPT52) [3269] chr11 complement(465010..465714) GTP-binding
           protein of the rab family (ras superfamily) involved in
           endocytosis and transport of proteins to the vacuole
           [705 bp, 234 aa]
          Length = 234

 Score = 42.4 bits (98), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 35/150 (23%), Positives = 68/150 (45%), Gaps = 16/150 (10%)

Query: 4   QLNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRM--EQFTMGLN----------IV 51
           Q  +V++G  + GK+S+    +   F++    T+G     +  T+  N            
Sbjct: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKF 62

Query: 52  RIFDLAGQYRFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLI 111
            I+D AGQ R++ L   Y+  A+  + V D+  + +  + +  V ++      D + + +
Sbjct: 63  EIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVIYL 122

Query: 112 LGNKIDLITTLDTPNNGRTRKPVKRSAGDQ 141
           LGNK+DL    +TP+   +  P     GD+
Sbjct: 123 LGNKVDLCQ--ETPSTETS--PDSNEGGDE 148

>CAGL0K12672g 1255541..1256161 highly similar to sp|P01123
           Saccharomyces cerevisiae YFL038c YPT1, start by
           similarity
          Length = 206

 Score = 42.4 bits (98), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 59/118 (50%), Gaps = 5/118 (4%)

Query: 5   LNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLN----IVRIFDLAGQY 60
             ++++G    GK+ L        +  D I T+G+  +  T+ L+     ++I+D AGQ 
Sbjct: 9   FKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGKTVKLQIWDTAGQE 68

Query: 61  RFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKIDL 118
           RF+ +   Y+  +  II V D+ DQ ++   K  ++++        + +L+ GNK DL
Sbjct: 69  RFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLKLLV-GNKCDL 125

>Scas_675.28
          Length = 216

 Score = 42.4 bits (98), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/125 (22%), Positives = 58/125 (46%), Gaps = 10/125 (8%)

Query: 4   QLNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLNI----------VRI 53
           Q  +V++G  + GK+S+    +   F++    T+G      T+ +              I
Sbjct: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKFEI 62

Query: 54  FDLAGQYRFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILG 113
           +D AGQ R++ L   Y+  A+  + V DL  + +  + +  V ++      + + + ++G
Sbjct: 63  WDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFLVG 122

Query: 114 NKIDL 118
           NK+DL
Sbjct: 123 NKLDL 127

>Kwal_23.3135
          Length = 191

 Score = 42.0 bits (97), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 55/126 (43%), Gaps = 18/126 (14%)

Query: 3   KQLNIVIVGLQNSGKTSLTRALLSKPFEQDTIP--------TLGMRMEQFTMGLNIVRIF 54
           + L  V+VG    GKT L  +  +  F  D +P        T+ +  E +T+GL     F
Sbjct: 2   QTLKCVVVGDGAVGKTCLLISYTTNQFPADYVPTVFDNYAVTVMIGDEPYTLGL-----F 56

Query: 55  DLAGQYRFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDC--IPMLIL 112
           D AGQ  +  L    +   D+ +    +    ++   KE   K   + +  C  +P LI+
Sbjct: 57  DTAGQEDYDRLRPLSYPSTDVFLVCFSVISPPSFENVKE---KWFPEVHHHCPGVPCLIV 113

Query: 113 GNKIDL 118
           G +IDL
Sbjct: 114 GTQIDL 119

>YGL210W (YPT32) [1786] chr7 (93795..94463) GTP-binding protein
           required in the secretory pathway at the stage of
           formation of trans-Golgi vesicles, member of the rab
           family in the ras superfamily [669 bp, 222 aa]
          Length = 222

 Score = 42.4 bits (98), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/118 (22%), Positives = 59/118 (50%), Gaps = 5/118 (4%)

Query: 5   LNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLN----IVRIFDLAGQY 60
             IV++G    GK++L     +  F  ++  T+G+     T+ +       +I+D AGQ 
Sbjct: 14  FKIVLIGDSGVGKSNLLSRFTTDEFNIESKSTIGVEFATRTIEVENKKIKAQIWDTAGQE 73

Query: 61  RFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKIDL 118
           R++ +   Y+  A   + V D++  +++  C   + ++  + + D + + ++GNK DL
Sbjct: 74  RYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLTELRENAD-DNVAVGLIGNKSDL 130

>CAGL0K09394g complement(929234..929899) highly similar to sp|P51996
           Saccharomyces cerevisiae YGL210w YPT32 or sp|P38555
           Saccharomyces cerevisiae YER031c YPT31, start by
           similarity
          Length = 221

 Score = 42.0 bits (97), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/118 (22%), Positives = 57/118 (48%), Gaps = 5/118 (4%)

Query: 5   LNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLN----IVRIFDLAGQY 60
             IV++G    GK++L     +  F  ++  T+G+     T+ +       +I+D AGQ 
Sbjct: 15  FKIVLIGDSGVGKSNLLSRFTTNEFNLESKSTIGVEFATRTIKVEDKKIKAQIWDTAGQE 74

Query: 61  RFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKIDL 118
           R++ +   Y+  A   + V D++    +  C   + ++  + + D + + ++GNK DL
Sbjct: 75  RYRAITSAYYRGAVGALIVYDISKSGTYENCNHWLTELKENAD-DNVAIGLIGNKSDL 131

>Kwal_14.2394
          Length = 207

 Score = 42.0 bits (97), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/124 (23%), Positives = 57/124 (45%), Gaps = 7/124 (5%)

Query: 4   QLNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLNI-------VRIFDL 56
           Q  +V++G  + GK+S+    +   F++    T+G      T+ L           I+D 
Sbjct: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHEDVTIKFEIWDT 62

Query: 57  AGQYRFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKI 116
           AGQ R++ L   Y+  A+  + V D+    +  + +  V ++        + + ++GNK+
Sbjct: 63  AGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVGNKL 122

Query: 117 DLIT 120
           DL T
Sbjct: 123 DLCT 126

>Scas_713.5
          Length = 211

 Score = 42.0 bits (97), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 59/118 (50%), Gaps = 5/118 (4%)

Query: 5   LNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLN----IVRIFDLAGQY 60
             ++++G    GK+ L        +  D I T+G+  +  T+ L+     ++I+D AGQ 
Sbjct: 9   FKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGKTVKLQIWDTAGQE 68

Query: 61  RFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKIDL 118
           RF+ +   Y+  +  II V D+ DQ ++   K  ++++        + +L+ GNK DL
Sbjct: 69  RFRTITSSYYRGSHGIIIVYDVTDQDSFNGVKMWLQEIDRYATSTVLKLLV-GNKCDL 125

>AER434C [2934] [Homologous to ScYGL210W (YPT32) - SH; ScYER031C
           (YPT31) - SH] (1466442..1467052,1467106..1467154) [660
           bp, 219 aa]
          Length = 219

 Score = 42.0 bits (97), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/118 (22%), Positives = 60/118 (50%), Gaps = 5/118 (4%)

Query: 5   LNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTM---GLNI-VRIFDLAGQY 60
             IV++G    GK++L     +  F  ++  T+G+     T+   G  +  +I+D AGQ 
Sbjct: 15  FKIVLIGDSGVGKSNLLSRFTTDEFNVNSKSTIGVEFATRTIEVEGKKVKAQIWDTAGQE 74

Query: 61  RFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKIDL 118
           R++ +   Y+  A   + V D++  +++  C   + ++  + + + + + ++GNK DL
Sbjct: 75  RYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLTELRENADEN-VAVGLIGNKSDL 131

>YLR229C (CDC42) [3629] chr12 complement(604214..604789) Rho-type
           GTPase involved in bud site assembly, cell polarity, and
           exocytosis, member of the rho family of the ras
           superfamily [576 bp, 191 aa]
          Length = 191

 Score = 41.6 bits (96), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 55/126 (43%), Gaps = 18/126 (14%)

Query: 3   KQLNIVIVGLQNSGKTSLTRALLSKPFEQDTIP--------TLGMRMEQFTMGLNIVRIF 54
           + L  V+VG    GKT L  +  +  F  D +P        T+ +  E +T+GL     F
Sbjct: 2   QTLKCVVVGDGAVGKTCLLISYTTNQFPADYVPTVFDNYAVTVMIGDEPYTLGL-----F 56

Query: 55  DLAGQYRFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDC--IPMLIL 112
           D AGQ  +  L    +   D+ +    +    ++   KE   K   + +  C  +P L++
Sbjct: 57  DTAGQEDYDRLRPLSYPSTDVFLVCFSVISPPSFENVKE---KWFPEVHHHCPGVPCLVV 113

Query: 113 GNKIDL 118
           G +IDL
Sbjct: 114 GTQIDL 119

>KLLA0A04213g complement(382243..382818) highly similar to sp|P19073
           Saccharomyces cerevisiae YLR229c CDC42 GTP-binding
           protein of RAS superfamily, start by similarity
          Length = 191

 Score = 41.2 bits (95), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 55/126 (43%), Gaps = 18/126 (14%)

Query: 3   KQLNIVIVGLQNSGKTSLTRALLSKPFEQDTIP--------TLGMRMEQFTMGLNIVRIF 54
           + L  V++G    GKT L  +  +  F  D +P        T+ +  E +T+GL     F
Sbjct: 2   QTLKCVVIGDGAVGKTCLLISYTTNQFPADYVPTVFDNYAVTVMIGDEPYTLGL-----F 56

Query: 55  DLAGQYRFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDC--IPMLIL 112
           D AGQ  +  L    +   D+ +    +    ++   KE   K   + +  C  +P LI+
Sbjct: 57  DTAGQEDYDRLRPLSYPSTDVFLVCFSVISPPSFENVKE---KWFPEVHHHCPGVPCLIV 113

Query: 113 GNKIDL 118
           G +IDL
Sbjct: 114 GTQIDL 119

>Kwal_14.1116
          Length = 204

 Score = 41.2 bits (95), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 59/118 (50%), Gaps = 5/118 (4%)

Query: 5   LNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLN----IVRIFDLAGQY 60
             ++++G    GK+ L        +  D I T+G+  +  T+ L+     ++I+D AGQ 
Sbjct: 9   FKLLLIGDSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGKTVKLQIWDTAGQE 68

Query: 61  RFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKIDL 118
           RF+ +   Y+  A  II V D+ D  ++ + K  ++++        + +++ GNK DL
Sbjct: 69  RFRTITSSYYRGAHGIIIVYDVTDHDSFNDVKMWLQEIDRYATAGVLKLMV-GNKSDL 125

>CAGL0F05269g complement(533759..534334) highly similar to sp|P19073
           Saccharomyces cerevisiae YLR229c CDC42, start by
           similarity
          Length = 191

 Score = 40.8 bits (94), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 55/126 (43%), Gaps = 18/126 (14%)

Query: 3   KQLNIVIVGLQNSGKTSLTRALLSKPFEQDTIP--------TLGMRMEQFTMGLNIVRIF 54
           + L  V+VG    GKT L  +  +  F  D +P        T+ +  E +T+GL     F
Sbjct: 2   QTLKCVVVGDGAVGKTCLLISYTTNQFPADYVPTVFDNYAVTVMIGDEPYTLGL-----F 56

Query: 55  DLAGQYRFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDC--IPMLIL 112
           D AGQ  +  L    +   D+ +    +    ++   KE   K   + +  C  +P L++
Sbjct: 57  DTAGQEDYDRLRPLSYPSTDVFLVCFSVISPPSFENVKE---KWFPEVHHHCPGVPCLVV 113

Query: 113 GNKIDL 118
           G ++DL
Sbjct: 114 GTQVDL 119

>YML064C (TEM1) [3905] chr13 complement(145139..145876) GTP-binding
           protein involved in termination of M-phase, member of
           the ras superfamily [738 bp, 245 aa]
          Length = 245

 Score = 41.2 bits (95), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 58/124 (46%), Gaps = 6/124 (4%)

Query: 4   QLNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLN----IVRIFDLAGQ 59
           ++ + +VG    GKTSL    +   ++++   TLG+   +  + +     I  I DL GQ
Sbjct: 20  EVQVGLVGDAQVGKTSLMVKYVQNIYDKEYTQTLGVNFLKRKVSIRSTDIIFSIMDLGGQ 79

Query: 60  YRFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKIDLI 119
             F ++       + +II++ DL      +  KE  R+     N   IP+L+ G K DL+
Sbjct: 80  REFINMLPIATVGSSVIIFLFDLTRPETLSSIKEWYRQA-YGLNDSAIPILV-GTKYDLL 137

Query: 120 TTLD 123
             LD
Sbjct: 138 IDLD 141

>YBR264C (YPT10) [444] chr2 complement(737727..738326) Member of the
           rab family in the ras superfamily of small GTP-binding
           proteins [600 bp, 199 aa]
          Length = 199

 Score = 40.8 bits (94), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/129 (25%), Positives = 62/129 (48%), Gaps = 12/129 (9%)

Query: 1   MSKQLNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLNI---------- 50
           M   + +V++G  + GKTS+   L S  F      T+G      T+ +            
Sbjct: 1   MEATIKVVLLGDSSVGKTSIVTRLKSGKFLAKHAATIGAAFITKTIEVPSNDSSTEKRIH 60

Query: 51  VRIFDLAGQYRFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPML 110
           + I+D AGQ R++ L   Y+  A++ + V +L D ++  +C +   + + D  +    ++
Sbjct: 61  MEIWDTAGQERYKSLVPMYYRDANIALIVFELGDVSSL-QCAKTWFQDLQDRAQG-TQVI 118

Query: 111 ILGNKIDLI 119
           I+GNK DL+
Sbjct: 119 IVGNKYDLV 127

>Scas_721.96
          Length = 191

 Score = 40.4 bits (93), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 54/126 (42%), Gaps = 18/126 (14%)

Query: 3   KQLNIVIVGLQNSGKTSLTRALLSKPFEQDTIP--------TLGMRMEQFTMGLNIVRIF 54
           K +  V +G    GKT L  +  +  F  D +P        T+ +  E +T+GL     F
Sbjct: 2   KTIKAVTIGDGAVGKTCLLISYTTNQFPADYVPTVFDNYAVTVMIGDEPYTLGL-----F 56

Query: 55  DLAGQYRFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDC--IPMLIL 112
           D AGQ  +  L    +   D+ +    +    ++   KE   K   + +  C  +P LI+
Sbjct: 57  DTAGQEDYDRLRPLSYPSTDVFLVCFSVISPPSFENVKE---KWFPEVHHHCPGVPCLIV 113

Query: 113 GNKIDL 118
           G +IDL
Sbjct: 114 GTQIDL 119

>CAGL0G07689g complement(729919..730566) highly similar to sp|P36018
           Saccharomyces cerevisiae YKR014c YPT52 GTP-binding
           protein, start by similarity
          Length = 215

 Score = 40.4 bits (93), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 27/124 (21%), Positives = 63/124 (50%), Gaps = 8/124 (6%)

Query: 4   QLNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGL-----NIV---RIFD 55
           Q  +V++G  + GK+S+    +   F++    T+G      T+ +     ++V    I+D
Sbjct: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWD 62

Query: 56  LAGQYRFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNK 115
            AGQ R++ L   Y+  A+  + V D+    + ++ +  V+++      + + + ++GNK
Sbjct: 63  TAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVGNK 122

Query: 116 IDLI 119
           +D++
Sbjct: 123 VDIV 126

>Sklu_2238.2 YKR014C, Contig c2238 2956-3579 reverse complement
          Length = 207

 Score = 40.4 bits (93), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 29/122 (23%), Positives = 60/122 (49%), Gaps = 7/122 (5%)

Query: 4   QLNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLN-----IVR--IFDL 56
           Q  +V++G  + GK+S+    +   F++    T+G      T+ L      +V+  I+D 
Sbjct: 3   QFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYNDTVVKFEIWDT 62

Query: 57  AGQYRFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKI 116
           AGQ R++ L   Y+  A+  + V D+    +  + +  V ++      + + + ++GNK+
Sbjct: 63  AGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVGNKL 122

Query: 117 DL 118
           DL
Sbjct: 123 DL 124

>AEL187C [2319] [Homologous to ScYBR264C (YPT10) - SH]
           (284984..285610) [627 bp, 208 aa]
          Length = 208

 Score = 40.0 bits (92), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 30/133 (22%), Positives = 62/133 (46%), Gaps = 19/133 (14%)

Query: 4   QLNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLN-------------- 49
           Q+ +V++G  + GK+S+     +  F ++   T+G      ++                 
Sbjct: 8   QVKLVLLGESSVGKSSIVTRFTTGEFRKNQ-ATIGAAFTTRSVQWEEDAGDGSDAKEVRS 66

Query: 50  -IVRIFDLAGQYRFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKV---IVDTNRD 105
               I+D AGQ R++ L   Y+   D+ + V D+ +Q ++   +  + ++   I +  R+
Sbjct: 67  VTFEIWDTAGQERYRSLAPMYYRNTDVALVVYDVTEQQSFQNARSWIDELNTYIGEAQRN 126

Query: 106 CIPMLILGNKIDL 118
            + + I+GNKIDL
Sbjct: 127 DVVVRIVGNKIDL 139

>ACL087C [962] [Homologous to ScYNL090W (RHO2) - SH]
           (191573..192136) [564 bp, 187 aa]
          Length = 187

 Score = 39.3 bits (90), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 31/121 (25%), Positives = 57/121 (47%), Gaps = 14/121 (11%)

Query: 6   NIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLNI------VRIFDLAGQ 59
            +VI+G    GKTSL        F ++ +PT+    E +     +      + ++D AGQ
Sbjct: 9   KLVIIGDGACGKTSLLHVFTLGKFPEEYLPTV---FENYVTDCRVDGIKVQLALWDTAGQ 65

Query: 60  YRFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDC--IPMLILGNKID 117
             ++ L    + +AD+I+    + D  + +  +E   K  V+  R C   P++++G K D
Sbjct: 66  EEYERLRPMSYSKADIILIGFAIDDPGSLSNARE---KWTVEALRYCPNAPIILVGLKKD 122

Query: 118 L 118
           L
Sbjct: 123 L 123

>Scas_628.21
          Length = 208

 Score = 39.7 bits (91), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 56/128 (43%), Gaps = 13/128 (10%)

Query: 4   QLNIVIVGLQNSGKTSLTRALLSKPFEQDTIPT--------LGMRMEQFTMGLNIVRIFD 55
           Q  I ++G +N GKT+LT   +   F +   PT        +  + + FT+      I D
Sbjct: 14  QRKIAVLGAKNVGKTTLTIRYVESRFLESYYPTVENHFTKLIDFKNQHFTL-----EIVD 68

Query: 56  LAGQYRFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNK 115
            AGQ     L  +       +I    + + + +        K++    RD IP++I+GNK
Sbjct: 69  TAGQDESSLLNLKSLAGVRGVILCYSVVNISTFDMIPVVWDKLLDQLERDDIPVIIVGNK 128

Query: 116 IDLITTLD 123
           IDL   LD
Sbjct: 129 IDLRNDLD 136

>Sklu_2366.3 , Contig c2366 5288-5944 reverse complement
          Length = 218

 Score = 38.9 bits (89), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/136 (23%), Positives = 63/136 (46%), Gaps = 20/136 (14%)

Query: 2   SKQLNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLNIV---------- 51
           + +L +V++G  + GK+S+     +  F +    T+G      T+ L  +          
Sbjct: 6   TSELKLVLLGESSVGKSSIVTRFTTGNFHRSN-ATIGAAFTTKTLSLESIVPETGETIDK 64

Query: 52  ----RIFDLAGQYRFQHLWDRYFDRADLIIYVIDLADQTNWAECK---EAVRKVIVDTNR 104
                I+D AGQ R++ L   Y+   D+ + V D+ ++ + A  +   + + + I +   
Sbjct: 65  KIKLEIWDTAGQERYRSLAPMYYRNTDVALIVFDVTNKDSIARAQSWIDELNRYINEGEH 124

Query: 105 D--CIPMLILGNKIDL 118
           +   I + I+GNKIDL
Sbjct: 125 EERGILIKIVGNKIDL 140

>Scas_703.41
          Length = 225

 Score = 38.5 bits (88), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 57/124 (45%), Gaps = 6/124 (4%)

Query: 5   LNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLN----IVRIFDLAGQY 60
           L I +VG    GKTSL    +   F+++   TLG+   +  + L+    +  + DL GQ 
Sbjct: 21  LQIGLVGDAQVGKTSLMVKYVQNIFDEEYTQTLGVNFLKRKVKLHSTDIVFSLMDLGGQK 80

Query: 61  RFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKIDLIT 120
            F ++       + +I+++ DL         K+  R+V    N   IP+L+ G K DL+ 
Sbjct: 81  EFINMLPIAAVGSSVIVFLFDLTRPETLNSIKDWYRQV-KGLNDIAIPILV-GTKYDLLI 138

Query: 121 TLDT 124
            L  
Sbjct: 139 NLSA 142

>ADL262W [1479] [Homologous to ScYOR101W (RAS1) - SH; ScYNL098C
           (RAS2) - SH] complement(243998..244012,244074..244871)
           [813 bp, 270 aa]
          Length = 270

 Score = 38.5 bits (88), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/105 (23%), Positives = 54/105 (51%), Gaps = 3/105 (2%)

Query: 17  KTSLTRALLSKPFEQDTIPTL--GMRMEQFTMG-LNIVRIFDLAGQYRFQHLWDRYFDRA 73
           K++LT  L+   F  +  PT+    R +    G ++I+ I D AGQ  +  + ++Y    
Sbjct: 23  KSALTIQLIQSHFVDEYDPTIEDSYRKQVVIDGQVSILDILDTAGQEEYSAMREQYMRTG 82

Query: 74  DLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKIDL 118
           +  + V  +  +T++ E     ++++   + + +P+ ++GNK DL
Sbjct: 83  EGFLLVYSVTSRTSFEELMTYYQQILRVKDVEYVPIFVVGNKSDL 127

>Kwal_14.2484
          Length = 203

 Score = 37.7 bits (86), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 34/150 (22%), Positives = 65/150 (43%), Gaps = 14/150 (9%)

Query: 2   SKQLNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLNI--------VRI 53
           S +L +V++G  + GK++L     +  F +    T+G       +              I
Sbjct: 7   SAELKLVLLGESSVGKSALVTRFTTGSFHKSN-ATIGAAFTTKVISWETETARKEVKFEI 65

Query: 54  FDLAGQYRFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKV---IVDTNRDCIPML 110
           +D AGQ R++ L   Y+   D+   V D+ +++   +    V+++   +       I + 
Sbjct: 66  WDTAGQERYRALTPMYYRNTDVAFVVFDVTEESTSLKADSWVQELKSYMEGEEAHNIVIK 125

Query: 111 ILGNKIDLITTLDTPNNGRTRKPVKRSAGD 140
           ++GNKIDL+  +     G T  PV    G+
Sbjct: 126 LIGNKIDLLDEVPPRKVGWT--PVSAKTGE 153

>CAGL0I09306g complement(897087..897707) similar to sp|P38146
           Saccharomyces cerevisiae YBR264c GTP-binding protein,
           hypothetical start
          Length = 206

 Score = 37.7 bits (86), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 30/131 (22%), Positives = 65/131 (49%), Gaps = 16/131 (12%)

Query: 3   KQLNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLNIVR---------- 52
           K L +V++G    GK+++     +  + ++   T+G      T  L  +R          
Sbjct: 9   KSLKVVLLGESAVGKSAIVTRFSTGKYLRNN-ATIGAAY--VTKDLEYIRDGDVYQVRLE 65

Query: 53  IFDLAGQYRFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKV---IVDTNRDCIPM 109
           I+D AGQ R++ L   Y+   D+ I V D+++  + +   + + ++   + +  R+ I +
Sbjct: 66  IWDTAGQERYRSLTPMYYRNTDVAIVVFDVSNLRSLSMAHKWIDELNTYVENKGRERINI 125

Query: 110 LILGNKIDLIT 120
           +++GNK+DL +
Sbjct: 126 VLVGNKMDLCS 136

>Kwal_26.8387
          Length = 292

 Score = 37.7 bits (86), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/105 (22%), Positives = 53/105 (50%), Gaps = 3/105 (2%)

Query: 17  KTSLTRALLSKPFEQDTIPTLGMRMEQFTM---GLNIVRIFDLAGQYRFQHLWDRYFDRA 73
           K++LT  L+   F  +  PT+     +  +    ++I+ I D AGQ  +  + ++Y    
Sbjct: 29  KSALTIQLIQSHFVDEYDPTIEDSYRKQVVIDDKVSILDILDTAGQEEYSAMREQYMRTG 88

Query: 74  DLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKIDL 118
           +  + V  +  +T++ E     ++++   + D +P+ ++GNK DL
Sbjct: 89  EGFLLVYSVTSRTSFDELMTYYQQILRVKDADYVPVFLVGNKSDL 133

>YGR152C (RSR1) [2106] chr7 complement(794677..795495) GTP-binding
           protein involved in bud site selection, member of the
           ras family in the ras superfamily [819 bp, 272 aa]
          Length = 272

 Score = 37.4 bits (85), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 29/119 (24%), Positives = 54/119 (45%), Gaps = 9/119 (7%)

Query: 7   IVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLNI------VRIFDLAGQY 60
           +V++G    GK+ LT   +   +     PT+    + +   + I      + I D AG  
Sbjct: 6   LVVLGAGGVGKSCLTVQFVQGVYLDTYDPTI---EDSYRKTIEIDNKVFDLEILDTAGIA 62

Query: 61  RFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKIDLI 119
           +F  + + Y       + V  + D+ +  E  E   +V+   + D +PM+++GNK DLI
Sbjct: 63  QFTAMRELYIKSGMGFLLVYSVTDRQSLEELMELREQVLRIKDSDRVPMVLIGNKADLI 121

>AFR464W [3656] [Homologous to ScYGR152C (RSR1) - SH]
           complement(1274158..1274952) [795 bp, 264 aa]
          Length = 264

 Score = 37.0 bits (84), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 28/118 (23%), Positives = 52/118 (44%), Gaps = 9/118 (7%)

Query: 7   IVIVGLQNSGKTSLTRALLSKPFEQDTIPTL------GMRMEQFTMGLNIVRIFDLAGQY 60
           +V++G    GK+ LT   +   +     PT+       M ++     L I    D AG  
Sbjct: 6   LVVLGAGGVGKSCLTVQFVQGEYLDTYDPTIEDSYRKSMEIDDKAFDLEI---LDTAGVA 62

Query: 61  RFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKIDL 118
           +F  + + Y       + V  + D+ + AE  E   +++   +   +PM+++GNK DL
Sbjct: 63  QFTAMRELYIKSGMGFLLVYSVTDRQSLAELMELREQILRIKDSKRVPMVLVGNKADL 120

>ACR257C [1304] [Homologous to ScYKR055W (RHO4) - SH]
           (808667..809446) [780 bp, 259 aa]
          Length = 259

 Score = 36.6 bits (83), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 31/128 (24%), Positives = 56/128 (43%), Gaps = 19/128 (14%)

Query: 4   QLNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLNIVR-------IFDL 56
           ++ IV+VG   +GKTSL  +     F +D +PT+    E +   +   R       ++D 
Sbjct: 52  RIKIVVVGDGATGKTSLLMSYTQGQFPEDYVPTI---FENYVTNIEGPRGKVIELALWDT 108

Query: 57  AGQYRFQHLWDRYFDRADLIIYVIDLADQTNWAECKE----AVRKVIVDTNRDCIPMLIL 112
           AGQ  +  L    +   D+++      ++T+    +E     VR           PM+++
Sbjct: 109 AGQEEYSRLRPLSYGDVDIVMVCYAADNRTSLTNAEELWFPEVRHFCPHA-----PMMLV 163

Query: 113 GNKIDLIT 120
           G K DL +
Sbjct: 164 GLKSDLYS 171

>KLLA0B05038g complement(457608..458279) similar to sp|P38987
           Saccharomyces cerevisiae YML064c TEM1 GTP-binding
           protein of the RAS superfamily, start by similarity
          Length = 223

 Score = 36.2 bits (82), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 55/124 (44%), Gaps = 6/124 (4%)

Query: 4   QLNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLN----IVRIFDLAGQ 59
           ++ + ++G    GKTSL    +   F+++   TLG+   +  + L     I  I DL GQ
Sbjct: 16  KVKVGLIGDAQVGKTSLMVKYVQNVFDEEYTQTLGVHYLERKVVLGSTDVIFSIMDLGGQ 75

Query: 60  YRFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKIDLI 119
             F ++     + A  I+++ DL         KE  R+     N   I +L+ G K DL 
Sbjct: 76  REFINMLPLVSEGAVAIVFLFDLTRPETLNSIKEWYRQA-RGFNDTAISILV-GTKYDLF 133

Query: 120 TTLD 123
             +D
Sbjct: 134 VDMD 137

>Sklu_1816.1 YNL090W, Contig c1816 115-681
          Length = 188

 Score = 35.8 bits (81), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 44/173 (25%), Positives = 75/173 (43%), Gaps = 32/173 (18%)

Query: 6   NIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLNI------VRIFDLAGQ 59
            +VI+G    GKTSL        F ++  PT+    E +     +      + ++D AGQ
Sbjct: 9   KLVIIGDGACGKTSLLYVFTLGKFPEEYHPTV---FENYVTDCRVDGIKVQLALWDTAGQ 65

Query: 60  YRFQHLWDRYFDRADLII--YVID-----LADQTNWAECKEAVRKVIVDTNRDCIPMLIL 112
             ++ L    + +A++I+  + ID     +  +T W E  EA+R           P++++
Sbjct: 66  EEYERLRPFSYSKANIILIGFAIDDPESLMNARTKWTE--EALRYCPT------APIVLV 117

Query: 113 GNKIDLITTLDTPNNGRTRKPVKRSAGDQ--NALEQWKYM-APLLRNYEYDDI 162
           G K DL  ++     G   + V R A +Q   A+   +YM    L     DDI
Sbjct: 118 GLKKDLRKSV-----GNGEEVVTREAAEQVARAIGAKRYMECSALTGEGVDDI 165

>CAGL0K08316g 838393..839364 some similarities with sp|Q00246
           Saccharomyces cerevisiae YKR055w RHO4 GTP-binding
           protein, hypothetical start
          Length = 323

 Score = 36.2 bits (82), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 41/87 (47%), Gaps = 12/87 (13%)

Query: 4   QLNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLNIVR-------IFDL 56
            L IV+VG    GKTSL  + + K F+ + IPT+    E +   +   +       ++D 
Sbjct: 83  HLKIVVVGDGAVGKTSLLISYVEKVFKHENIPTI---FENYVTNIQGPKGQIIELALWDT 139

Query: 57  AGQYRFQHLWDRYFDRAD--LIIYVID 81
           AGQ  +  L    +  AD  +I Y ID
Sbjct: 140 AGQEEYSRLRPLSYTGADVLMICYAID 166

>YNL098C (RAS2) [4493] chr14 complement(439602..440570) GTP-binding
           protein involved in regulation of cAMP pathway, homolog
           of mammalian proto-oncogene ras [969 bp, 322 aa]
          Length = 322

 Score = 36.2 bits (82), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 16/71 (22%), Positives = 39/71 (54%)

Query: 48  LNIVRIFDLAGQYRFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCI 107
           ++I+ I D AGQ  +  + ++Y    +  + V  +  +++  E     ++++   + D +
Sbjct: 57  VSILDILDTAGQEEYSAMREQYMRNGEGFLLVYSITSKSSLDELMTYYQQILRVKDTDYV 116

Query: 108 PMLILGNKIDL 118
           P++++GNK DL
Sbjct: 117 PIVVVGNKSDL 127

>CAGL0L11242g 1197075..1197839 highly similar to sp|P38987
           Saccharomyces cerevisiae YML064c TEM1 GTP-binding
           protein of the RAS superfamily, hypothetical start
          Length = 254

 Score = 35.8 bits (81), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 55/123 (44%), Gaps = 6/123 (4%)

Query: 5   LNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLN----IVRIFDLAGQY 60
           + + ++G    GKTSL    +   F+++   TLG+   +  + +     +  + DL GQ 
Sbjct: 29  IQVGLIGDAQVGKTSLMVKYVQNIFDEEYTQTLGVNFLKRKVSIRSTDIVFSLMDLGGQR 88

Query: 61  RFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKIDLIT 120
            F ++       + +II + DL         KE  R+ +   N   IP+L+ G K DL  
Sbjct: 89  EFINMLPIATLGSSVIILLFDLTRPETLNSIKEWYRQAL-GLNDSAIPILV-GTKYDLFI 146

Query: 121 TLD 123
            L+
Sbjct: 147 DLE 149

>YOR101W (RAS1) [4906] chr15 (515244..516173) GTP-binding protein
           involved in regulation of cAMP pathway, homolog of
           mammalian proto-oncogene ras [930 bp, 309 aa]
          Length = 309

 Score = 35.8 bits (81), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 17/71 (23%), Positives = 39/71 (54%)

Query: 48  LNIVRIFDLAGQYRFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCI 107
           ++I+ I D AGQ  +  + ++Y    +  + V  +  + ++ E     +++    + D I
Sbjct: 57  VSILDILDTAGQEEYSAMREQYMRTGEGFLLVYSVTSRNSFDELLSYYQQIQRVKDSDYI 116

Query: 108 PMLILGNKIDL 118
           P++++GNK+DL
Sbjct: 117 PVVVVGNKLDL 127

>Sklu_2007.2 YNL180C, Contig c2007 789-1574 reverse complement
          Length = 261

 Score = 35.4 bits (80), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 34/140 (24%), Positives = 57/140 (40%), Gaps = 27/140 (19%)

Query: 3   KQLNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTL--------------GMRMEQFTMGL 48
           + +  VIVG    GKTSL  +  +  F QD IPT+               +  EQ    L
Sbjct: 2   RSIKCVIVGDGAVGKTSLLISYTTNTFPQDYIPTVFDNYSTTIALADPSDLSAEQEVFKL 61

Query: 49  NIVRIFDLAGQYRFQHLWDRYFDRADLIIYVIDLADQTN--------WAECKEAVRKVIV 100
           N   ++D AGQ  +  L    + + D+ I    + + ++        + E +       +
Sbjct: 62  N---LWDTAGQEEYDRLRPLSYPQTDIFIICFSVNEPSSFENVIDKWFPEIRHNTNYENM 118

Query: 101 DTNRDC--IPMLILGNKIDL 118
           +    C   P+L++G K DL
Sbjct: 119 ELFSSCGKFPILLVGTKADL 138

>CAGL0E03113g complement(289164..290135) some similarities with
           sp|P13856 Saccharomyces cerevisiae YGR152c RSR1
           GTP-binding protein, start by similarity
          Length = 323

 Score = 35.8 bits (81), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 28/119 (23%), Positives = 54/119 (45%), Gaps = 9/119 (7%)

Query: 7   IVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLNI------VRIFDLAGQY 60
           +V++G    GK+SLT   +   +     PT+    + +   + I      + I D AG  
Sbjct: 6   LVVLGAGGVGKSSLTVQFVQGVYLDTYDPTI---EDSYRKTIEIDNKVFDLEILDTAGVA 62

Query: 61  RFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKIDLI 119
           +F  + + Y       + V  + D+ +  E  E   +V+   +   +PM+++GNK DL+
Sbjct: 63  QFTAMRELYIKAGMGFLLVYSVTDRDSLRELMELKEQVLRIKDSQRVPMVLVGNKADLV 121

>Kwal_33.14452
          Length = 260

 Score = 35.4 bits (80), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 59/138 (42%), Gaps = 25/138 (18%)

Query: 3   KQLNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTL------------GMRMEQFTMGLNI 50
           + +  VIVG    GKTSL  +  +  F QD IPT+            G   E     LN 
Sbjct: 2   RSVKCVIVGDGAVGKTSLLISYTTNTFPQDYIPTVFDNYTTTIALNDGDSAEPQVFRLN- 60

Query: 51  VRIFDLAGQYRFQHLWDRYFDRADLIIYVIDLADQTNWAECKEA-VRKVIVDTN------ 103
             ++D AGQ  +  L    + + D+ +    + +  ++   K+    ++  +TN      
Sbjct: 61  --LWDTAGQEEYDRLRPLSYPQTDIFLLCFSINEPNSFENVKDKWFPEIRHNTNYENLEL 118

Query: 104 -RDC--IPMLILGNKIDL 118
            R C   P+L++G K DL
Sbjct: 119 FRVCGKYPILLVGTKADL 136

>Scas_610.14
          Length = 462

 Score = 35.4 bits (80), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 33/67 (49%), Gaps = 12/67 (17%)

Query: 30  EQDTIPTLG--MRMEQFTMGL----------NIVRIFDLAGQYRFQHLWDRYFDRADLII 77
           E+D +PTL   +R  Q T G+          + + +FD+ GQ   +  W   FD   LII
Sbjct: 273 EKDYVPTLQDILRSRQKTTGIFDTHINLGSNSNLHLFDVGGQRSERKKWIHCFDNVTLII 332

Query: 78  YVIDLAD 84
           Y I L++
Sbjct: 333 YCISLSE 339

>KLLA0C12001g complement(1029092..1029871) similar to sp|P13856
           Saccharomyces cerevisiae YGR152c RSR1 GTP-binding
           protein, start by similarity
          Length = 259

 Score = 35.0 bits (79), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 28/118 (23%), Positives = 53/118 (44%), Gaps = 9/118 (7%)

Query: 7   IVIVGLQNSGKTSLTRALLSKPFEQDTIPTL------GMRMEQFTMGLNIVRIFDLAGQY 60
           +V++G    GK+ LT   +   +     PT+       M ++     L    I D AG  
Sbjct: 6   LVVLGAGGVGKSCLTVQFVQGVYLDSYDPTIEDSYRKTMEIDNKVFDL---EILDTAGVA 62

Query: 61  RFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKIDL 118
           +F  + + Y       + V  ++D+ +  E  E   +V+   + D +P++++GNK DL
Sbjct: 63  QFTAMRELYIKSGMGFLLVYSVSDRQSLNELLELREQVLRIKDSDRVPIVLVGNKADL 120

>Kwal_33.14015
          Length = 271

 Score = 35.0 bits (79), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 55/123 (44%), Gaps = 13/123 (10%)

Query: 4   QLNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLG----MRMEQFTMGLNIVRIFDLAGQ 59
            L IV+VG    GKT L  +     F ++ IPT+      +M+     +  + ++D AGQ
Sbjct: 65  HLKIVVVGDGAVGKTCLLISYTQGHFPEEYIPTVFENYVTKMKGPDNTVVELALWDTAGQ 124

Query: 60  YRFQHLWDRYFDRADLIIYVIDLADQTNWAECKE----AVRKVIVDTNRDCIPMLILGNK 115
             +  L    +   DL++    +  +T+    +E     VR    DT     P+L++G K
Sbjct: 125 EEYNRLRPLSYTDVDLLMVCYSVDSKTSLLNVQELWIPEVRHFCPDT-----PILLVGLK 179

Query: 116 IDL 118
            DL
Sbjct: 180 SDL 182

>Scas_697.46
          Length = 324

 Score = 35.0 bits (79), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 23/105 (21%), Positives = 51/105 (48%), Gaps = 3/105 (2%)

Query: 17  KTSLTRALLSKPFEQDTIPTLGMRMEQFTM---GLNIVRIFDLAGQYRFQHLWDRYFDRA 73
           K++LT  L+   F  +  PT+     +  +    + ++ + D AGQ  +  + ++Y    
Sbjct: 23  KSALTIQLIHSHFVDEYDPTIEDSYRKQVVIDDKVTVLDVLDTAGQEEYSAMREQYMRTG 82

Query: 74  DLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKIDL 118
           +  + V  +  + ++ E     +++    + D IP++I+GNK DL
Sbjct: 83  EGFLLVYSVTSKNSFEELLTYYQQIQRVKDSDYIPVVIVGNKSDL 127

>Scas_547.3
          Length = 223

 Score = 34.7 bits (78), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 60/128 (46%), Gaps = 12/128 (9%)

Query: 4   QLNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGL---NIV-RIFDLAGQ 59
           Q+ + +VG    GKTSL        F+++   TLG+ + +  + +   NIV  + DL GQ
Sbjct: 24  QIQVGLVGDAQVGKTSLMVKYAQNGFDEEYTQTLGVNLLKRKVRIKSSNIVFSLMDLGGQ 83

Query: 60  YRFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDT---NRDCIPMLILGNKI 116
             F ++       + +II++ DL       E  E+++   +     N D + +L+ G K 
Sbjct: 84  KEFINMLPIASVNSSVIIFLFDL----TRPESLESIKNWYMQAHGLNHDAVCILV-GTKY 138

Query: 117 DLITTLDT 124
           DL   L T
Sbjct: 139 DLFIDLPT 146

>KLLA0A05643g 528976..529632 similar to sp|Q00246 Saccharomyces
           cerevisiae YKR055w RHO4 GTP-binding protein of the rho
           family, hypothetical start
          Length = 218

 Score = 34.7 bits (78), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 55/122 (45%), Gaps = 11/122 (9%)

Query: 4   QLNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGL-----NIVR--IFDL 56
            L IV+VG    GKTSL  +     F +D +PT+    E +   L      IV   ++D 
Sbjct: 31  HLKIVVVGDGAVGKTSLLISYTQGKFPEDYVPTI---FENYVTNLEGPNGKIVELALWDT 87

Query: 57  AGQYRFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKI 116
           AGQ  +  L    +   D+++    +  + ++   +E     +     D +P++I+G K 
Sbjct: 88  AGQEEYSRLRPLSYTDVDVLMICYAINSKVSFYNIEEMWLPEVKHFCPD-VPIMIVGLKS 146

Query: 117 DL 118
           DL
Sbjct: 147 DL 148

>Kwal_55.21941
          Length = 209

 Score = 34.3 bits (77), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 40/154 (25%), Positives = 64/154 (41%), Gaps = 30/154 (19%)

Query: 7   IVIVGLQNSGKTSLTRALLSKPFEQDTIPTL-----------GMRMEQFTMGLNIVRIFD 55
           +VIVG    GKT L        F Q  +PT+           G R+E        + ++D
Sbjct: 15  LVIVGDGACGKTCLLIVFAKGKFPQVYVPTVFDNYVADVEVDGRRVE--------LALWD 66

Query: 56  LAGQYRFQHLWDRYFDRAD--LIIYVIDLADQTNWAECKEAVRKVIVDTNRDC--IPMLI 111
            AGQ  +  L    +  ++  LI + IDL D       +  + K I +    C  +P+++
Sbjct: 67  TAGQEDYDRLRPLSYPDSNVVLICFSIDLPDSL-----ENVMEKWISEVLHFCQGVPIIL 121

Query: 112 LGNKIDLITTLDTPNNGRT--RKPVKRSAGDQNA 143
           +G K+DL        N R    +PV + A  + A
Sbjct: 122 VGCKVDLRNDSQVIENLRANGHEPVSQGAAQEVA 155

>CAGL0B04521g complement(439732..440751) similar to sp|P01120
           Saccharomyces cerevisiae YNL098c RAS2 GTP-binding
           protein or sp|P01119 Saccharomyces cerevisiae YOR101w
           RAS1, hypothetical start
          Length = 339

 Score = 34.7 bits (78), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 18/73 (24%), Positives = 39/73 (53%)

Query: 48  LNIVRIFDLAGQYRFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCI 107
           + I+ I D AGQ  +  + ++Y    +  + V  +  +T++ E     +++    + + I
Sbjct: 55  VTILDILDTAGQEEYSAMREQYMRTGEGFLLVYSVTSRTSFEELITYYQQIQRVKDVEYI 114

Query: 108 PMLILGNKIDLIT 120
           P++++GNK DL T
Sbjct: 115 PVVVVGNKSDLET 127

>YKR055W (RHO4) [3306] chr11 (547858..548733) GTP-binding protein,
           member of the rho family in the ras superfamily [876 bp,
           291 aa]
          Length = 291

 Score = 34.3 bits (77), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 53/123 (43%), Gaps = 13/123 (10%)

Query: 4   QLNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLN----IVRIFDLAGQ 59
            L IV+VG    GKT L  + +   F  D IPT+         G N     + ++D AGQ
Sbjct: 72  HLKIVVVGDGAVGKTCLLISYVQGTFPTDYIPTIFENYVTNIEGPNGQIIELALWDTAGQ 131

Query: 60  YRFQHLWDRYFDRADLIIYVIDLADQTNWAECKE----AVRKVIVDTNRDCIPMLILGNK 115
             +  L    +  AD+++    +  +T+    ++     V+     T     P++++G K
Sbjct: 132 EEYSRLRPLSYTNADVLMVCYSVGSKTSLKNVEDLWFPEVKHFCPST-----PIMLVGLK 186

Query: 116 IDL 118
            DL
Sbjct: 187 SDL 189

>ADR402W [2142] [Homologous to ScYAL048C - SH]
           complement(1426900..1428885) [1986 bp, 661 aa]
          Length = 661

 Score = 34.7 bits (78), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 21/35 (60%)

Query: 3   KQLNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTL 37
           K  N  I+G  NSGK+SL  + L +PF +   PT+
Sbjct: 444 KVFNCYILGKPNSGKSSLLESFLGRPFSETYSPTI 478

>Kwal_14.2244
          Length = 244

 Score = 34.3 bits (77), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 27/118 (22%), Positives = 52/118 (44%), Gaps = 9/118 (7%)

Query: 7   IVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLNI------VRIFDLAGQY 60
           +V++G    GK+ LT   +   +     PT+    + +   + I      + I D AG  
Sbjct: 6   LVVLGAGGVGKSCLTVQFVQGVYLDTYDPTI---EDSYRKTMEIDNKVFDLEILDTAGVA 62

Query: 61  RFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKIDL 118
           +F  + + Y       + V  + D+ +  E  E   +V+   +   +PM+++GNK DL
Sbjct: 63  QFTAMRELYIKSGMGFLLVYSVTDRQSLEELIELREQVLRIKDNSRVPMVLVGNKADL 120

>Sklu_2151.3 YPR165W, Contig c2151 2495-3124 reverse complement
          Length = 209

 Score = 33.9 bits (76), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 39/155 (25%), Positives = 67/155 (43%), Gaps = 30/155 (19%)

Query: 6   NIVIVGLQNSGKTSLTRALLSKPFEQDTIPTL-----------GMRMEQFTMGLNIVRIF 54
            +VIVG    GKT L        F Q  +PT+           G R+E        + ++
Sbjct: 14  KLVIVGDGACGKTCLLIVFAKGKFPQVYVPTVFDNYVADVEVDGRRVE--------LALW 65

Query: 55  DLAGQYRFQHLWDRYFDRAD--LIIYVIDLADQTNWAECKEAVRKVIVDTNRDC--IPML 110
           D AGQ  +  L    +  ++  LI + IDL D       +  + K I +    C  +P++
Sbjct: 66  DTAGQEDYDRLRPLSYPDSNVVLICFSIDLPDSL-----ENVMEKWISEVLHFCQGVPII 120

Query: 111 ILGNKIDLITTLDTPNNGRT--RKPVKRSAGDQNA 143
           ++G K+DL        + RT  ++PV +++  + A
Sbjct: 121 LVGCKVDLRNDPQVVESLRTNGQEPVSQASAQEVA 155

>KLLA0C13816g 1183412..1183975 highly similar to sp|P06781
           Saccharomyces cerevisiae YNL090w RHO2 GTP-binding
           protein of the RHO subfamily of RAS-like proteins, start
           by similarity
          Length = 187

 Score = 33.1 bits (74), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 41/165 (24%), Positives = 70/165 (42%), Gaps = 42/165 (25%)

Query: 6   NIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLNI------VRIFDLAGQ 59
            +VI+G    GKTSL        F ++  PT+    E +     +      + ++D AGQ
Sbjct: 9   KLVIIGDGACGKTSLLYVFTLGQFPEEYHPTV---FENYVTDCRVDGIKVQLTLWDTAGQ 65

Query: 60  YRFQHLWDRYFDRADLII--YVID-----LADQTNWAE-----CKEAVRKVIVDTNRDCI 107
             ++ L    + +AD+I+  + ID     +  +  W+E     C EA             
Sbjct: 66  EEYERLRPFSYSKADIILIGFAIDDPESLVNARNKWSEEVLRYCPEA------------- 112

Query: 108 PMLILGNKIDLITTLDTPNNGRTRKPVKRSAGDQ--NALEQWKYM 150
           P++++G K D    L +P+N    + V R   +Q   A+   KYM
Sbjct: 113 PVVLVGLKKD----LRSPDN--EHQMVTREQAEQVARAIGAKKYM 151

>Kwal_47.19055
          Length = 179

 Score = 33.1 bits (74), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 21/105 (20%), Positives = 50/105 (47%), Gaps = 9/105 (8%)

Query: 21  TRALLSKPFEQDTIPTLGMRMEQFTMGLNIVRIFDLAGQYRFQHLWDRYFDRADLIIYVI 80
           +++ +   F   TI   G +++         +I+D AGQ R++ +   Y+  A   + V 
Sbjct: 3   SKSTIGVEFATRTIEVEGKKIK--------AQIWDTAGQERYRAITSAYYRGAVGALIVY 54

Query: 81  DLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKIDLITTLDTP 125
           D++  +++  C   + ++  + + + + + ++GNK DL      P
Sbjct: 55  DISKSSSYENCNHWLTELRENADEN-VAVGLIGNKSDLAHLRAVP 98

>KLLA0A11330g 982552..983124 similar to ca|CA6070|IPF4842 Candida
           albicans, start by similarity
          Length = 190

 Score = 33.1 bits (74), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 32/121 (26%), Positives = 61/121 (50%), Gaps = 10/121 (8%)

Query: 7   IVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMR-MEQFTM----GLNI---VRIFDLAG 58
           I+++G +N GKT+L   L    F +   PT+  + + +F +    G  +   + I D +G
Sbjct: 8   IIVLGSRNVGKTTLLVQLTESHFVESYYPTIENQFIHEFVLKKPNGTELKFNLDIVDTSG 67

Query: 59  QYRFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDT-NRDCIPMLILGNKID 117
           Q  F  +  +        I +  +A++ ++ E  E +R  ++D      +PM+++GNKID
Sbjct: 68  QDEFSMINAKSMLGVAGCILMYSVANRHSF-EIVELIRDKMLDMLGLLELPMVLVGNKID 126

Query: 118 L 118
           L
Sbjct: 127 L 127

>Scas_575.10
          Length = 271

 Score = 33.5 bits (75), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 32/66 (48%)

Query: 53  IFDLAGQYRFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLIL 112
           I D AG  +F  + + Y       + V  + D  +  E  E   +V+   + D +PM+++
Sbjct: 55  ILDTAGVAQFTAMRELYIKSGMGFLLVYSVTDPQSLDELMELREQVLRIKDTDRVPMVLV 114

Query: 113 GNKIDL 118
           GNK DL
Sbjct: 115 GNKADL 120

>CAGL0G05764g complement(552809..553681) similar to sp|P53879
           Saccharomyces cerevisiae YNL180c RHO5, start by
           similarity
          Length = 290

 Score = 33.5 bits (75), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 30/129 (23%), Positives = 52/129 (40%), Gaps = 16/129 (12%)

Query: 3   KQLNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLG----MRMEQFTMGLNIVRIF-DLA 57
           K L  V+VG    GKT+   +  +  F  + +PT+       ++    G      F D +
Sbjct: 2   KSLKCVLVGDSEVGKTAFLMSYTTGSFSPEYVPTVFDEYLTTIQDKETGYTFHTTFWDTS 61

Query: 58  GQYRFQHLWDRYFDRADLIIYVIDLAD-------QTNW-AECKEAVRKVIVDTNRDCIPM 109
           G  +  HL    + + D+ +      D       +  W  E K+ +RK     N   +P+
Sbjct: 62  GDKQHDHLRPLTYPQTDVFLACFPYNDIRSFRNVKDKWIPELKKYIRK---SDNSSTVPI 118

Query: 110 LILGNKIDL 118
           L++  K DL
Sbjct: 119 LLVATKCDL 127

>Scas_578.7
          Length = 187

 Score = 32.7 bits (73), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 54/131 (41%), Gaps = 34/131 (25%)

Query: 6   NIVIVGLQNSGKTSLTRALLSKPFEQDTIPTL------GMRMEQFTMGLNIVRIFDLAGQ 59
            +VI+G    GKTSL        F Q+  PT+        R++   + L    ++D AGQ
Sbjct: 9   KLVIIGDGACGKTSLLYVFTLGKFPQEYHPTVFENYVTDCRVDGIKVSLT---LWDTAGQ 65

Query: 60  YRFQHLWDRYFDRADLIIYVIDLAD-------QTNWAE-----CKEAVRKVIVDTNRDCI 107
             ++ L    + +AD+I+    + D       +  W E     C EA             
Sbjct: 66  EEYERLRPFSYSKADIILIGFAINDTESLDNARNKWTEEALRYCPEA------------- 112

Query: 108 PMLILGNKIDL 118
           P++++G K DL
Sbjct: 113 PIILVGLKKDL 123

>YNL090W (RHO2) [4501] chr14 (456565..457143) GTP-binding protein,
           member of the rho family in the ras superfamily [579 bp,
           192 aa]
          Length = 192

 Score = 32.7 bits (73), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 40/161 (24%), Positives = 69/161 (42%), Gaps = 29/161 (18%)

Query: 6   NIVIVGLQNSGKTSLTRALLSKPFEQDTIPTL------GMRMEQFTMGLNIVRIFDLAGQ 59
            +VI+G    GKTSL        F +   PT+        R++   + L +   +D AGQ
Sbjct: 9   KLVIIGDGACGKTSLLYVFTLGKFPEQYHPTVFENYVTDCRVDGIKVSLTL---WDTAGQ 65

Query: 60  YRFQHLWDRYFDRADLII--YVID-----LADQTNWAECKEAVRKVIVDTNRDC--IPML 110
             ++ L    + +AD+I+  + +D     +  +T WA+  EA+R         C   P++
Sbjct: 66  EEYERLRPFSYSKADIILIGFAVDNFESLINARTKWAD--EALRY--------CPDAPIV 115

Query: 111 ILGNKIDLITTLDTPNNGRTRK-PVKRSAGDQNALEQWKYM 150
           ++G K DL        N      P++ +     A+   KYM
Sbjct: 116 LVGLKKDLRQEAHFKENATDEMVPIEDAKQVARAIGAKKYM 156

>Scas_203.2
          Length = 251

 Score = 32.7 bits (73), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 30/126 (23%), Positives = 60/126 (47%), Gaps = 11/126 (8%)

Query: 4   QLNIVIVGLQNSGKTSL-TRALLSKPFEQDTIPTLGMRMEQFTMGL---NI----VRIFD 55
           +L  V++G  + G+TS+ TR    K  ++  +P     + +    +   NI    + I+D
Sbjct: 47  RLKFVLLGESSVGRTSIVTRFTTGKIPKKRMLPIGAAFLNKNIRWVDEDNIYEVDLEIWD 106

Query: 56  LAGQYRFQHLWDRYFDRADLIIYVIDLADQTNWAECK---EAVRKVIVDTNRDCIPMLIL 112
            AGQ R++ L   Y+   D+ + V D+     + + +   + +R  + +     I + ++
Sbjct: 107 TAGQERYRSLAPIYYRNTDVALIVFDVTSSNTFQKARSWVDELRSYLDNEQGKEIQLYLI 166

Query: 113 GNKIDL 118
           GNK DL
Sbjct: 167 GNKCDL 172

>Sklu_1136.1 YGL210W, Contig c1136 1284-1832
          Length = 182

 Score = 32.3 bits (72), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 20/98 (20%), Positives = 48/98 (48%), Gaps = 9/98 (9%)

Query: 21  TRALLSKPFEQDTIPTLGMRMEQFTMGLNIVRIFDLAGQYRFQHLWDRYFDRADLIIYVI 80
           +++ +   F   TI   G +++         +I+D AGQ R++ +   Y+  A   + V 
Sbjct: 3   SKSTIGVEFATRTIEVEGKKIK--------AQIWDTAGQERYRAITSAYYRGAVGALIVY 54

Query: 81  DLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKIDL 118
           D++   ++  C   + ++  + + + + + ++GNK DL
Sbjct: 55  DISKSNSYENCNHWLTELRENADEN-VAVGLIGNKSDL 91

>Scas_417.3
          Length = 291

 Score = 32.7 bits (73), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 33/146 (22%), Positives = 60/146 (41%), Gaps = 30/146 (20%)

Query: 3   KQLNIVIVGLQNSGKTSLTRALLSKPFEQDTIPT--------------------LGMRME 42
           +Q+  VIVG    GKTSL  +  +  F QD IPT                    L    E
Sbjct: 2   RQIKTVIVGDGAVGKTSLLISYTTNTFPQDYIPTVFDNYSTTISLRDPFLSRESLANENE 61

Query: 43  QFTMGLNIVRIFDLAGQYRFQHLWDRYFDRADLIIYVIDLADQTNWAEC-----KEAVRK 97
              + L  + ++D AGQ  +  L    + + D+ +    +A+ +++         E  + 
Sbjct: 62  NDHLELFKLNLWDTAGQEEYDRLRPLSYPQTDVFLICFSVAELSSFENVVDKWLPEIKQN 121

Query: 98  VIVDTNR-----DCIPMLILGNKIDL 118
             V+++        +P++++G K DL
Sbjct: 122 ANVESSELFLQFGKLPIMLIGTKADL 147

>YAL048C (YAL048C) [19] chr1 complement(52804..54792) Protein
           involved in the secretory pathway, has weak similarity
           to GTP-binding proteins of the RAS superfamily [1989 bp,
           662 aa]
          Length = 662

 Score = 32.7 bits (73), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 27/121 (22%), Positives = 52/121 (42%), Gaps = 8/121 (6%)

Query: 3   KQLNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRME----QFTMGLNIVRIFDLAG 58
           K  N  ++G    GK+SL  A L + F ++  PT+  R+     +   G     I    G
Sbjct: 447 KVFNCFVIGKPCCGKSSLLEAFLGRSFSEEYSPTIKPRIAVNSLELKGGKQYYLILQELG 506

Query: 59  QYRFQHLWDR-YFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKID 117
           +  +  L ++      D+I    D +D  +++     + K    T+   +P++ + +K D
Sbjct: 507 EQEYAILENKDKLKECDVICLTYDSSDPESFSYLVSLLDKF---THLQDLPLVFVASKAD 563

Query: 118 L 118
           L
Sbjct: 564 L 564

>CAGL0M12276g 1223585..1225534 highly similar to sp|P39722
           Saccharomyces cerevisiae YAL048c vacuolar aspartic
           protease, start by similarity
          Length = 649

 Score = 32.7 bits (73), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 23/39 (58%)

Query: 3   KQLNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRM 41
           K  N  +VG +NSGK+SL  + L + F +   PT+  R+
Sbjct: 437 KVFNCFVVGKRNSGKSSLLESFLGRLFSEAYSPTIRPRV 475

>Scas_539.1
          Length = 656

 Score = 32.7 bits (73), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 20/35 (57%)

Query: 3   KQLNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTL 37
           K  N  +VG  NSGK+SL  + L + F +   PT+
Sbjct: 441 KVFNCFVVGKPNSGKSSLLESFLGRVFAESYCPTI 475

>AFL002C [3191] [Homologous to ScYAL001C (TFC3) - SH]
           (432329..435720,435784..435847) [3456 bp, 1151 aa]
          Length = 1151

 Score = 32.7 bits (73), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 23/104 (22%), Positives = 48/104 (46%), Gaps = 12/104 (11%)

Query: 46  MGLNIVRIFDLAGQYRFQHLWDRY--------FDRADLIIYVIDLADQTNWAECKEA--- 94
           +G N+VR++D  G+ +F  L+  +         D+A  I        +++ ++  EA   
Sbjct: 378 LGFNLVRVYDFEGKKKFYRLFTEHNFRLFSGSTDQAPTITIPHIHGQKSSLSKLSEANFM 437

Query: 95  -VRKVIVDTNRDCIPMLILGNKIDLITTLDTPNNGRTRKPVKRS 137
            +   +  TN+D   +     ++D+  T  T   GR RK ++++
Sbjct: 438 PLNATLRFTNKDDQEVFFWHGELDIPATSTTTARGRKRKSLQQA 481

>Scas_556.7
          Length = 417

 Score = 32.3 bits (72), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 20/35 (57%)

Query: 3   KQLNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTL 37
           K  N  +VG  NSGK+SL  + L + F +   PT+
Sbjct: 202 KVFNCFVVGKPNSGKSSLLESFLGRVFAESYCPTI 236

>ABR183W [776] [Homologous to ScYPR165W (RHO1) - SH]
           complement(755914..756537) [624 bp, 207 aa]
          Length = 207

 Score = 32.0 bits (71), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 38/140 (27%), Positives = 60/140 (42%), Gaps = 35/140 (25%)

Query: 1   MSKQLN-------IVIVGLQNSGKTSLTRALLSKPFEQDTIPTL-----------GMRME 42
           MS+Q++       +VIVG    GKT L        F Q  +PT+           G R+E
Sbjct: 1   MSQQMHNPSIRRKLVIVGDGACGKTCLLIVFAKGKFPQVYVPTVFDNYVADVEVDGRRVE 60

Query: 43  QFTMGLNIVRIFDLAGQYRFQHLWDRYFDRAD--LIIYVIDLADQTNWAECKEAVRKVIV 100
                   + ++D AGQ  +  L    +  ++  LI Y IDL D       +  + K I 
Sbjct: 61  --------LALWDTAGQEDYDRLRPLSYPDSNVVLICYSIDLPDSL-----ENVMEKWIS 107

Query: 101 DTNRDC--IPMLILGNKIDL 118
           +    C  +P++++G K DL
Sbjct: 108 EVLYFCQGVPIILVGCKADL 127

>KLLA0B10626g 936497..937123 gi|22858698|gb|AAN05733.1 Kluyveromyces
           lactis RHO1, start by similarity
          Length = 208

 Score = 32.0 bits (71), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 54/128 (42%), Gaps = 28/128 (21%)

Query: 6   NIVIVGLQNSGKTSLTRALLSKPFEQDTIPTL-----------GMRMEQFTMGLNIVRIF 54
            +VIVG    GKT L        F Q  +PT+           G R+E        + ++
Sbjct: 14  KLVIVGDGACGKTCLLIVFAKGKFPQVYVPTVFDNYVADVEVDGRRVE--------LALW 65

Query: 55  DLAGQYRFQHLWDRYFDRAD--LIIYVIDLADQTNWAECKEAVRKVIVDTNRDC--IPML 110
           D AGQ  +  L    +  ++  LI Y IDL D       +  + K I +    C  +P++
Sbjct: 66  DTAGQEDYDRLRPLSYPDSNVVLICYSIDLPDSL-----ENVMEKWISEVLHFCQGVPII 120

Query: 111 ILGNKIDL 118
           ++G K DL
Sbjct: 121 LVGCKADL 128

>ABL139C [453] [Homologous to ScYNL180C (RHO5) - SH]
           (134875..135759) [885 bp, 294 aa]
          Length = 294

 Score = 32.0 bits (71), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 31/140 (22%), Positives = 59/140 (42%), Gaps = 27/140 (19%)

Query: 3   KQLNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTL--------------GMRMEQFTMGL 48
           + +  V++G    GKTSL  +  +  F QD IPT+                  EQ    L
Sbjct: 18  RSIKCVVIGDGAVGKTSLLISYTTNSFPQDYIPTVFDNYSTTIAVQDPASSTGEQQLFKL 77

Query: 49  NIVRIFDLAGQYRFQHLWDRYFDRADLIIYVIDLADQTNWAECKEA-VRKVIVDTNRDCI 107
           N   ++D AGQ  +  L    + + D+ +    + +  ++   ++    ++  +TN + +
Sbjct: 78  N---LWDTAGQEEYDRLRPLSYPQTDIFLICFSINEPVSFQNIRDKWFPEIKHNTNYENM 134

Query: 108 ---------PMLILGNKIDL 118
                    P+L++G K DL
Sbjct: 135 ELFLECGKYPILLVGTKADL 154

>Scas_444.4*
          Length = 289

 Score = 31.6 bits (70), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 53/124 (42%), Gaps = 15/124 (12%)

Query: 4   QLNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLN-------IVRIFDL 56
            + IVIVG +  GKT L  + + + F    IPT+    E +             + ++D 
Sbjct: 63  HVKIVIVGDEGVGKTCLLISYVQREFPTGDIPTV---FENYVTDFEGPDGEVVELALWDT 119

Query: 57  AGQYRFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDC--IPMLILGN 114
           A Q  +  L    +   D+++    +A+ T+    K   R  I +    C   P++++G 
Sbjct: 120 AAQEDYNRLRPLSYTDVDILLVCYSVANPTSLKNIK---RSWIPEVKHFCYKTPVILVGL 176

Query: 115 KIDL 118
           K DL
Sbjct: 177 KSDL 180

>CAGL0E03311g 305748..306767 highly similar to sp|P53290
           Saccharomyces cerevisiae YGR163w GTR2, start by
           similarity
          Length = 339

 Score = 31.2 bits (69), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 52/106 (49%), Gaps = 18/106 (16%)

Query: 7   IVIVGLQNSGKTSLTRALLSKPFEQDTI---PTLGMRMEQFTMGLNIVRIFDLAGQYRFQ 63
           ++++GL+  GK+S+ + +       DT+    T    ME F+  +++  + +L GQ  + 
Sbjct: 12  VLLMGLRRCGKSSICKVVFHNMQPLDTLYLESTSNPTMEHFSTLIDLA-VMELPGQLNY- 69

Query: 64  HLWDRYFDRADL------IIYVIDLADQ-----TNWAECKEAVRKV 98
             ++  +D A+L      ++YVID  D+     TN A   E   KV
Sbjct: 70  --FEPNYDSAELFKSVGALVYVIDSQDEYMNAVTNLAMIIEYAYKV 113

>ADR093W [1834] [Homologous to NOHBY] complement(876839..877423)
           [585 bp, 194 aa]
          Length = 194

 Score = 30.8 bits (68), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 28/114 (24%), Positives = 52/114 (45%), Gaps = 2/114 (1%)

Query: 5   LNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLNIVRIFDLAGQYRFQH 64
           ++I+++GL  SGKT+L R L        T+   G+ +E       ++  +D +       
Sbjct: 13  VSILLLGLAASGKTTLLRQLQLGNVSASTVD--GLPVETVAYRNVVLSSWDPSRAVDHAA 70

Query: 65  LWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKIDL 118
                 +R   +I+V+D AD+      +  +  ++ D      P+L+L NK DL
Sbjct: 71  FASSRHERCKALIFVVDAADRAGIDAARATLHTLLDDCALRARPLLLLANKTDL 124

>KLLA0F25916g 2406597..2407940 gi|12230105|sp|Q9Y7B7|GBA1_KLULA
           Kluyveromyces lactis Guanine nucleotide-binding protein
           alpha-1 subunit (GP1-alpha), start by similarity
          Length = 447

 Score = 31.2 bits (69), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 21/96 (21%), Positives = 43/96 (44%), Gaps = 10/96 (10%)

Query: 34  IPTLGMRMEQFTMGLNIVRIFDLAGQYRFQHLWDRYFDRADLIIYVIDLADQTNWAECKE 93
           I T G+    F +G +  +++D  GQ   +  W   F+    +++VI +++        E
Sbjct: 273 IKTTGITENSFKIGPSTFKVYDAGGQRSERRKWIHCFEGITAVVFVIAISEYDQMLFEDE 332

Query: 94  AVRK-----VIVDTNRDC-----IPMLILGNKIDLI 119
            V +     V++DT  +       P ++  NK+D+ 
Sbjct: 333 RVNRMHESIVLLDTLLNSRWFANTPFILFLNKVDIF 368

>YER020W (GPA2) [1445] chr5 (195167..196516) Guanine
           nucleotide-binding protein alpha subunit involved in
           regulation of the cAMP pathway [1350 bp, 449 aa]
          Length = 449

 Score = 31.2 bits (69), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 34/67 (50%), Gaps = 7/67 (10%)

Query: 27  KPFEQDTIPTLGMRMEQFT----MGLNI-VRIFDLAGQYRFQHLWDRYFDRADLIIYVID 81
           +P +QD + +  M    F     MG +I + I+D+ GQ   +  W   FD   L+I+ + 
Sbjct: 263 RPTQQDILRSRQMTSGIFDTVIDMGSDIKMHIYDVGGQRSERKKWIHCFDNVTLVIFCVS 322

Query: 82  LA--DQT 86
           L+  DQT
Sbjct: 323 LSEYDQT 329

>ABR158W [751] [Homologous to ScYER020W (GPA2) - SH]
           complement(699757..701004) [1248 bp, 415 aa]
          Length = 415

 Score = 30.8 bits (68), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 22/38 (57%), Gaps = 2/38 (5%)

Query: 51  VRIFDLAGQYRFQHLWDRYFDRADLIIYVIDLA--DQT 86
           + I+D+ GQ   +  W R FD   LII+ + L+  DQT
Sbjct: 259 LHIYDVGGQRSERKKWIRCFDNVTLIIFCVSLSEYDQT 296

>AAL093C [94] [Homologous to ScYPL164C (MLH3) - SH] (177137..179341)
           [2205 bp, 734 aa]
          Length = 734

 Score = 30.8 bits (68), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 30/65 (46%), Gaps = 6/65 (9%)

Query: 146 QWKYMAPLLRNYEYDDIPTYQLDESNLYVLRNIET---LSKELGLDLKNGVLH-LPESQI 201
           QW Y + L R  +     TY      LY+L NI     LSK  G  +K+  LH LP +  
Sbjct: 78  QWHYTSKLRRLEDLTATDTYGFRGEGLYMLSNISRVILLSKRAG--MKHAALHRLPATDN 135

Query: 202 YLDRD 206
            L RD
Sbjct: 136 ALPRD 140

>KLLA0A03465g complement(314573..316552) similar to sp|P39722
           Saccharomyces cerevisiae YAL048c vacuolar aspartic
           proteasse singleton, start by similarity
          Length = 659

 Score = 30.8 bits (68), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 21/35 (60%)

Query: 3   KQLNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTL 37
           K LN  ++G  NSGK+SL  + L + F +   PT+
Sbjct: 445 KVLNCYMLGKGNSGKSSLLESFLGRSFSEAYSPTI 479

>Sklu_2434.11 YAL048C, Contig c2434 25881-27614 reverse complement
          Length = 577

 Score = 30.8 bits (68), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 21/39 (53%)

Query: 3   KQLNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRM 41
           K  N  +VG  NSGK+SL  + L + F     PT+  R+
Sbjct: 358 KVFNCFVVGKPNSGKSSLLESFLGRSFTDVYSPTIRPRI 396

>KLLA0A04708g complement(420317..421372) similar to sp|P53290
           Saccharomyces cerevisiae YGR163w GTR2 singleton, start
           by similarity
          Length = 351

 Score = 30.4 bits (67), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 25/108 (23%), Positives = 50/108 (46%), Gaps = 12/108 (11%)

Query: 2   SKQLNIVIVGLQNSGKTSLTRALLSKPFEQDTI---PTLGMRMEQFTMGLNIVRIFDLAG 58
           + +  I+++GL+  GK+S+ + +       DT+    T     E F+  +++  + +L G
Sbjct: 8   ASKATILLMGLRRGGKSSICKVVFHNMQPLDTLYLESTTSPTQEHFSTLIDLA-VMELPG 66

Query: 59  QYRF---QHLWDRYFDRADLIIYVIDLADQ-----TNWAECKEAVRKV 98
           Q  +    +  ++ F     ++YVID  D+     TN A   E  + V
Sbjct: 67  QLNYFEPNYESEQLFKSVGALVYVIDSQDEYLNALTNLAMIIEYAKNV 114

>KLLA0D08327g 708240..709004 similar to sp|P53879 Saccharomyces
           cerevisiae YNL180c RHO5, start by similarity
          Length = 254

 Score = 30.0 bits (66), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 30/140 (21%), Positives = 58/140 (41%), Gaps = 27/140 (19%)

Query: 3   KQLNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLNI------------ 50
           + +  VIVG    GKTSL  +  +  F QD IPT+    + ++  + +            
Sbjct: 2   RSIKCVIVGDGAVGKTSLLISYTTNTFPQDYIPTV---FDNYSTTIALPDPYNPDSEPQI 58

Query: 51  --VRIFDLAGQYRFQHLWDRYFDRADLIIYVIDLADQTN--------WAECKEAVRKVIV 100
             + ++D AGQ  +  L    + + D+ +    + +  +        + E K +     +
Sbjct: 59  FKLNLWDTAGQEEYDRLRPLSYPQTDIFLICFSVNEPNSFENVYDKWFPEIKHSTNFENL 118

Query: 101 DTNRDC--IPMLILGNKIDL 118
           D       +P+L++G K DL
Sbjct: 119 DLYHQSGKLPILLVGTKADL 138

>Sklu_1655.1 YKR055W, Contig c1655 395-1258 reverse complement
          Length = 287

 Score = 29.6 bits (65), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 29/126 (23%), Positives = 53/126 (42%), Gaps = 19/126 (15%)

Query: 4   QLNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGLNIVR-------IFDL 56
            L IV+VG    GKT L  +     F  + +PT+    E +   +   R       ++D 
Sbjct: 77  HLKIVVVGDGAVGKTCLLISYTQGRFPTEYVPTI---FENYVSKVQGPRNKVIELALWDT 133

Query: 57  AGQYRFQHLWDRYFDRADLIIYVIDLADQTNWAECKE----AVRKVIVDTNRDCIPMLIL 112
           AGQ  +  L    +   D+++    +  +T++   +E     V+    D      P++++
Sbjct: 134 AGQEEYNRLRPLSYTDVDILMVCYSVDSKTSFYNVQELWFPEVKHFCPDA-----PVMLV 188

Query: 113 GNKIDL 118
           G K DL
Sbjct: 189 GLKSDL 194

>Kwal_55.19778
          Length = 446

 Score = 28.9 bits (63), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 2/38 (5%)

Query: 51  VRIFDLAGQYRFQHLWDRYFDRADLIIYVIDLA--DQT 86
           + I+D+ GQ   +  W   FD   LII+ + L+  DQT
Sbjct: 290 LHIYDVGGQRSERKKWIHCFDNVTLIIFCVSLSEFDQT 327

>CAGL0I08195g 797893..799239 similar to sp|P10823 Saccharomyces
           cerevisiae YER020w GPA2 guanine nucleotide-binding
           regulatory protein, start by similarity
          Length = 448

 Score = 28.9 bits (63), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 16/62 (25%), Positives = 29/62 (46%), Gaps = 5/62 (8%)

Query: 28  PFEQDTIPTLGMRMEQFTMGLNI-----VRIFDLAGQYRFQHLWDRYFDRADLIIYVIDL 82
           P EQD + +       F   +N+     + I+D+ GQ   +  W   FD   L+I+ + L
Sbjct: 263 PTEQDVLRSRQKTSGIFDTVVNMDNNFQMHIYDVGGQRSERKKWIHCFDNVTLVIFCVSL 322

Query: 83  AD 84
           ++
Sbjct: 323 SE 324

>YHR022C (YHR022C) [2309] chr8 complement(149567..150337) Protein
          of unknown function [771 bp, 256 aa]
          Length = 256

 Score = 28.9 bits (63), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 29/62 (46%), Gaps = 5/62 (8%)

Query: 3  KQLNIVIVGLQNSGKTSLTRALLSKPFE-----QDTIPTLGMRMEQFTMGLNIVRIFDLA 57
          K   I ++G  +SGKTSL R+ L   F+     +  +  L  +  QF   +   R F + 
Sbjct: 21 KSSKITVMGDDHSGKTSLVRSWLGSSFQISDANRYRVSDLYHKTIQFDTLVKYYRTFGVK 80

Query: 58 GQ 59
          GQ
Sbjct: 81 GQ 82

>AGL046C [4265] [Homologous to ScYGR163W (GTR2) - SH]
           (619357..620326,620377..620426) [1020 bp, 339 aa]
          Length = 339

 Score = 28.5 bits (62), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 26/109 (23%), Positives = 49/109 (44%), Gaps = 12/109 (11%)

Query: 1   MSKQLNIVIVGLQNSGKTSLTRALLSKPFEQDTI---PTLGMRMEQFTMGLNIVRIFDLA 57
           +  +  I+++GL+  GK+S+ + +       DT+    T     E F+  +++  + +L 
Sbjct: 4   LDSKATILLMGLRRGGKSSICKVVFHNMQPLDTLYLESTTNPTSEHFSTLIDL-GVMELP 62

Query: 58  GQYRF---QHLWDRYFDRADLIIYVIDLADQ-----TNWAECKEAVRKV 98
           GQ  +    +  +  F     ++YVID  D+     TN A   E   KV
Sbjct: 63  GQLNYFEPSYESENLFKSVGALVYVIDSQDEYLNALTNLAMIIEYAYKV 111

>Scas_689.14
          Length = 697

 Score = 28.5 bits (62), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 58/136 (42%), Gaps = 15/136 (11%)

Query: 85  QTNWAECKEAVRK--VIVDTNRDCIPMLILGNKIDLIT-TLDTPNNGRTRKPVKRSAGDQ 141
           Q NW E +  + K  V + TN   +   I   ++D+   T +T  N  T KP + +A   
Sbjct: 177 QRNWKERENELNKKLVTLQTNNKLLEDKI-SKQVDIEEPTENTKPNADTNKPSQDAASST 235

Query: 142 NALEQWKYMAPLLRNYEYDDIPTYQLDESNLYVLRNIETLSKELGLDLKNGVLHLPESQI 201
           N+ +     + L++  E       QL+E N       ETL+ EL    K       ES +
Sbjct: 236 NSTKSAAEFSLLVQELESAQSRILQLEERN-------ETLNGELS---KATSTEEKESVL 285

Query: 202 YLDRDLAVFTISCKNG 217
           Y  +DL +  +  +N 
Sbjct: 286 YT-KDLKINELESENA 300

>KLLA0F18392g 1693928..1695694 highly similar to sp|P15180
           Saccharomyces cerevisiae YDR037w KRS1 lysyl-tRNA
           synthetase, cytosolic, start by similarity
          Length = 588

 Score = 28.1 bits (61), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 18/35 (51%)

Query: 83  ADQTNWAECKEAVRKVIVDTNRDCIPMLILGNKID 117
            DQ + AE  E ++KV+ D   DC P L     +D
Sbjct: 417 GDQLHTAETGEFLKKVLKDNKMDCAPPLTNARMLD 451

>Kwal_23.3426
          Length = 726

 Score = 27.7 bits (60), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 38/66 (57%), Gaps = 2/66 (3%)

Query: 144 LEQWKYMAPLLRNYE-YDDIPTYQLDESNL-YVLRNIETLSKELGLDLKNGVLHLPESQI 201
           ++Q+K +  L   +E +D + T  L+E++L ++L   + LS ++    K  +  L ES++
Sbjct: 584 IQQYKKLVDLFSQFEKWDQLTTTPLNEASLPHLLNKFKNLSNDVYKFTKFFLTKLSESEL 643

Query: 202 YLDRDL 207
             DRD+
Sbjct: 644 IADRDI 649

>ADL360C [1380] [Homologous to ScYML128C (MSC1) - SH] (72250..74187)
           [1938 bp, 645 aa]
          Length = 645

 Score = 27.7 bits (60), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 31/65 (47%), Gaps = 10/65 (15%)

Query: 57  AGQYRFQHLWDR---YFDRADLIIYVIDLADQTNWAECK-------EAVRKVIVDTNRDC 106
           AGQ   + LWD    YF++AD +I    L D  NW + +         V+  ++ T +D 
Sbjct: 432 AGQESAESLWDSIKGYFNKADDVINDTFLLDVENWPKRRLKHFLEARGVKYSLLSTRKDL 491

Query: 107 IPMLI 111
           +  +I
Sbjct: 492 LKSVI 496

>YMR129W (POM152) [4086] chr13 (527803..531816) Nuclear pore membrane
            glycoprotein, a type II integral membrane protein with
            N-terminal region on pore side and C-terminal region in
            the cisternae [4014 bp, 1337 aa]
          Length = 1337

 Score = 27.7 bits (60), Expect = 9.1,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 37/78 (47%), Gaps = 5/78 (6%)

Query: 99   IVDTNRDCIPMLILG--NKIDLITTLDTPNNGRTRKPVKRSAGDQNALEQWKYMAPLLRN 156
            +VD N  C+  LI G  N+I L++  D P         +   GD  A  Q   +AP +  
Sbjct: 1121 VVDAN-GCVNSLISGPRNQI-LVSITDAPKIHILDPSTEYCVGDYVAY-QLNGVAPFMIK 1177

Query: 157  YEYDDIPTYQLDESNLYV 174
            YE++ IP    + S+ +V
Sbjct: 1178 YEFNGIPLKSKERSSQFV 1195

>Kwal_26.6810
          Length = 664

 Score = 27.7 bits (60), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 22/38 (57%), Gaps = 3/38 (7%)

Query: 3  KQLNIVIVGLQNSGKTSLTRALLSKPF---EQDTIPTL 37
          +Q+ IV+ G    GKTSL  ALL   F    QD++P +
Sbjct: 4  EQIKIVVCGDDGVGKTSLIAALLKDQFILNLQDSLPPV 41

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.139    0.416 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,649,310
Number of extensions: 333960
Number of successful extensions: 1364
Number of sequences better than 10.0: 202
Number of HSP's gapped: 1218
Number of HSP's successfully gapped: 202
Length of query: 228
Length of database: 16,596,109
Length adjustment: 98
Effective length of query: 130
Effective length of database: 13,203,545
Effective search space: 1716460850
Effective search space used: 1716460850
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 60 (27.7 bits)