Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_47.1821929329015500.0
Sklu_2334.128628312201e-171
YJR096W28227811371e-158
CAGL0C04543g28728410971e-152
Scas_691.528428010611e-146
KLLA0F03256g28527910561e-146
Kwal_47.188932892666764e-88
ABL209C3102776514e-84
Kwal_33.132763022846089e-78
CAGL0I01100g3102874245e-50
YOR120W (GCY1)3122864176e-49
Sklu_1828.23122844099e-48
KLLA0B14707g3102874035e-47
Scas_714.73222954046e-47
Sklu_1971.33292973978e-46
KLLA0D10109g3092713941e-45
CAGL0I01122g3262853821e-43
CAGL0A02816g3102833802e-43
Kwal_47.180843092773758e-43
Kwal_55.215363292943769e-43
YDR368W (YPR1)3122923704e-42
Scas_676.43132833681e-41
Sklu_2408.83222913541e-39
ACL107C3543003525e-39
YHR104W (GRE3)3272893481e-38
Scas_688.123263233427e-38
Sklu_1571.23223053358e-37
KLLA0E21714g3293243332e-36
Kwal_56.226113212953201e-34
AER401W3133043112e-33
Kwal_55.214263082873103e-33
YBR149W (ARA1)3443103062e-32
Scas_319.11951962944e-32
Scas_518.43382942773e-28
Kwal_33.13274108982604e-28
KLLA0F02728g3302962746e-28
Sklu_2324.33152872712e-27
Kwal_47.192783142932501e-24
KLLA0F05775g3092942449e-24
CAGL0J09394g3112862377e-23
YDL124W3122832184e-20
Scas_704.93092802113e-19
Sklu_2438.123122852019e-18
KLLA0B05291g127701206e-08
Sklu_2405.13423421213e-07
Sklu_2082.33383411204e-07
Scas_568.73433121152e-06
Scas_664.53433111142e-06
Scas_687.33443131099e-06
Scas_550.23443141044e-05
CAGL0E05214g346308992e-04
Scas_524.1280222973e-04
CAGL0E05192g345306973e-04
Kwal_26.8377338127973e-04
CAGL0E05236g344294955e-04
Scas_719.39345308910.002
Scas_705.10348220880.004
YPR127W345214880.005
KLLA0F19360g344310870.006
Scas_633.21344311860.008
YJR155W (AAD10)28874850.009
ABR094W359137830.020
YFL057C (AAD16)15271780.038
Scas_709.28323125790.046
YDL243C (AAD4)32958770.10
YNL331C (AAD14)37658740.21
KLLA0B09658g34280740.24
CAGL0L00715g114452730.34
CAGL0F06061g336128710.45
YOL044W (PEX15)38324710.56
KLLA0F01254g148680710.70
KLLA0F26851g328131671.5
CAGL0M04235g78331672.1
YKL171W92848662.9
YCR107W (AAD3)36358626.3
Sklu_2274.6339122626.7
YOL165C (AAD15)14359607.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_47.18219
         (290 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_47.18219                                                         601   0.0  
Sklu_2334.1 YJR096W, Contig c2334 2610-3470 reverse complement        474   e-171
YJR096W (YJR096W) [2988] chr10 (611112..611960) NADPH-specific a...   442   e-158
CAGL0C04543g 434137..435000 highly similar to sp|P47137 Saccharo...   427   e-152
Scas_691.5                                                            413   e-146
KLLA0F03256g 306731..307588 similar to sp|P47137 Saccharomyces c...   411   e-146
Kwal_47.18893                                                         265   4e-88
ABL209C [383] [Homologous to ScYJR096W - SH] (11410..12342) [933...   255   4e-84
Kwal_33.13276                                                         238   9e-78
CAGL0I01100g complement(91693..92625) highly similar to sp|P1406...   167   5e-50
YOR120W (GCY1) [4923] chr15 (551114..552052) Aldo-keto reductase...   165   6e-49
Sklu_1828.2 YDR368W, Contig c1828 3683-4621 reverse complement        162   9e-48
KLLA0B14707g complement(1291951..1292883) similar to sp|P14065 S...   159   5e-47
Scas_714.7                                                            160   6e-47
Sklu_1971.3 YHR104W, Contig c1971 5146-6135                           157   8e-46
KLLA0D10109g 854495..855424 similar to sp|P14065 Saccharomyces c...   156   1e-45
CAGL0I01122g 93934..94914 highly similar to sp|P38715 Saccharomy...   151   1e-43
CAGL0A02816g 292159..293091 highly similar to tr|Q12458 Saccharo...   150   2e-43
Kwal_47.18084                                                         149   8e-43
Kwal_55.21536                                                         149   9e-43
YDR368W (YPR1) [1194] chr4 (1213892..1214830) 2-methylbutyraldeh...   147   4e-42
Scas_676.4                                                            146   1e-41
Sklu_2408.8 , Contig c2408 19753-20721 reverse complement             140   1e-39
ACL107C [942] [Homologous to ScYHR104W (GRE3) - SH] (152564..153...   140   5e-39
YHR104W (GRE3) [2392] chr8 (323411..324394) Aldo/keto reductase ...   138   1e-38
Scas_688.12                                                           136   7e-38
Sklu_1571.2 YBR149W, Contig c1571 1437-2405                           133   8e-37
KLLA0E21714g complement(1929294..1930283) gi|1351442|sp|P49378|X...   132   2e-36
Kwal_56.22611                                                         127   1e-34
AER401W [2901] [Homologous to ScYDR368W (YPR1) - SH; ScYOR120W (...   124   2e-33
Kwal_55.21426                                                         124   3e-33
YBR149W (ARA1) [334] chr2 (539943..540977) Subunit of NADP+-depe...   122   2e-32
Scas_319.1                                                            117   4e-32
Scas_518.4                                                            111   3e-28
Kwal_33.13274                                                         104   4e-28
KLLA0F02728g 249240..250232 similar to sp|P38115 Saccharomyces c...   110   6e-28
Sklu_2324.3 , Contig c2324 5024-5971 reverse complement               108   2e-27
Kwal_47.19278                                                         100   1e-24
KLLA0F05775g 560270..561199 similar to sgd|S0002282 Saccharomyce...    99   9e-24
CAGL0J09394g 923715..924650 similar to tr|Q07551 Saccharomyces c...    96   7e-23
YDL124W (YDL124W) [746] chr4 (240259..241197) NAD(P)H-dependent ...    89   4e-20
Scas_704.9                                                             86   3e-19
Sklu_2438.12 YDL124W, Contig c2438 25491-26429 reverse complement      82   9e-18
KLLA0B05291g 478251..478634 some similarities with sp|Q12458 Sac...    51   6e-08
Sklu_2405.1 YPL088W, Contig c2405 371-1399 reverse complement          51   3e-07
Sklu_2082.3 , Contig c2082 6775-7791                                   51   4e-07
Scas_568.7                                                             49   2e-06
Scas_664.5                                                             49   2e-06
Scas_687.3                                                             47   9e-06
Scas_550.2                                                             45   4e-05
CAGL0E05214g complement(508038..509078) highly similar to tr|Q02...    43   2e-04
Scas_524.1                                                             42   3e-04
CAGL0E05192g complement(506594..507631) highly similar to tr|Q02...    42   3e-04
Kwal_26.8377                                                           42   3e-04
CAGL0E05236g complement(509478..510512) highly similar to tr|Q02...    41   5e-04
Scas_719.39                                                            40   0.002
Scas_705.10                                                            39   0.004
YPR127W (YPR127W) [5546] chr16 (790077..791114) Protein with sim...    39   0.005
KLLA0F19360g 1792778..1793812 similar to sgd|S0006009 Saccharomy...    38   0.006
Scas_633.21                                                            38   0.008
YJR155W (AAD10) [3046] chr10 (727320..728186) Putative aryl alco...    37   0.009
ABR094W [685] [Homologous to ScYMR041C - SH] complement(555931.....    37   0.020
YFL057C (AAD16) [1627] chr6 complement(14305..14763) Predicted a...    35   0.038
Scas_709.28                                                            35   0.046
YDL243C (AAD4) [634] chr4 complement(17577..18566) Putative aryl...    34   0.10 
YNL331C (AAD14) [4284] chr14 complement(16118..17248) Putative a...    33   0.21 
KLLA0B09658g complement(837873..838901) similar to sgd|S0006331 ...    33   0.24 
CAGL0L00715g 86810..90244 highly similar to sp|P40527 Saccharomy...    33   0.34 
CAGL0F06061g complement(604063..605073) similar to sp|Q04212 Sac...    32   0.45 
YOL044W (PEX15) [4774] chr15 (247148..248299) Peroxisomal integr...    32   0.56 
KLLA0F01254g 115485..119945 weakly similar to sp|P29539 Saccharo...    32   0.70 
KLLA0F26851g complement(2478465..2479451) similar to sp|Q04212 S...    30   1.5  
CAGL0M04235g complement(464973..467324) similar to tr|Q12440 Sac...    30   2.1  
YKL171W (YKL171W) [3100] chr11 (127480..130266) Serine/threonine...    30   2.9  
YCR107W (AAD3) [628] chr3 (313886..314977) Putative aryl alcohol...    28   6.3  
Sklu_2274.6 YMR041C, Contig c2274 7634-8653                            28   6.7  
YOL165C (AAD15) [4660] chr15 complement(1647..2078) Putative ary...    28   7.6  

>Kwal_47.18219
          Length = 293

 Score =  601 bits (1550), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/290 (100%), Positives = 290/290 (100%)

Query: 1   MPSKARIMSKTTVPKAYKLSSGYILPSIGLGTYDIPRAETSEVVYQALKSGYRHLDTAVL 60
           MPSKARIMSKTTVPKAYKLSSGYILPSIGLGTYDIPRAETSEVVYQALKSGYRHLDTAVL
Sbjct: 1   MPSKARIMSKTTVPKAYKLSSGYILPSIGLGTYDIPRAETSEVVYQALKSGYRHLDTAVL 60

Query: 61  YGNEHEVGQGIQKWLEEDPEHNKRQDVFYTTKLWNSQNGYSNAKRAIKECMEKVSPLGYI 120
           YGNEHEVGQGIQKWLEEDPEHNKRQDVFYTTKLWNSQNGYSNAKRAIKECMEKVSPLGYI
Sbjct: 61  YGNEHEVGQGIQKWLEEDPEHNKRQDVFYTTKLWNSQNGYSNAKRAIKECMEKVSPLGYI 120

Query: 121 DLLLIHSPLSGTRRRLETYKAMQEAVDEGIVRSIGVSNYGKHHIDELLTWKELKHKPVVN 180
           DLLLIHSPLSGTRRRLETYKAMQEAVDEGIVRSIGVSNYGKHHIDELLTWKELKHKPVVN
Sbjct: 121 DLLLIHSPLSGTRRRLETYKAMQEAVDEGIVRSIGVSNYGKHHIDELLTWKELKHKPVVN 180

Query: 181 QIEISPWIMRQDLADYCKSKGLVVEAFSPLTHGYKLKHPDVLLVAKETGTDAGRVLIRWS 240
           QIEISPWIMRQDLADYCKSKGLVVEAFSPLTHGYKLKHPDVLLVAKETGTDAGRVLIRWS
Sbjct: 181 QIEISPWIMRQDLADYCKSKGLVVEAFSPLTHGYKLKHPDVLLVAKETGTDAGRVLIRWS 240

Query: 241 LQHGYVPLPKSRSVERLKGNVKAYDFELSPEQVSFLDQPQAYEPTDWECT 290
           LQHGYVPLPKSRSVERLKGNVKAYDFELSPEQVSFLDQPQAYEPTDWECT
Sbjct: 241 LQHGYVPLPKSRSVERLKGNVKAYDFELSPEQVSFLDQPQAYEPTDWECT 290

>Sklu_2334.1 YJR096W, Contig c2334 2610-3470 reverse complement
          Length = 286

 Score =  474 bits (1220), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 218/283 (77%), Positives = 251/283 (88%)

Query: 8   MSKTTVPKAYKLSSGYILPSIGLGTYDIPRAETSEVVYQALKSGYRHLDTAVLYGNEHEV 67
           M+   +PKAYKLSSGY LPSIGLGTYD+P   TSE+VY+ALK GYRHLDTAVLYGNE EV
Sbjct: 1   MNTKAIPKAYKLSSGYTLPSIGLGTYDLPSNATSEIVYEALKCGYRHLDTAVLYGNEREV 60

Query: 68  GQGIQKWLEEDPEHNKRQDVFYTTKLWNSQNGYSNAKRAIKECMEKVSPLGYIDLLLIHS 127
           G+GI KWL+E+P  NKR+DVFY TKLWNSQNGY+NAKRAI+EC EKV  LGYIDLLLIHS
Sbjct: 61  GEGILKWLKENPSSNKREDVFYATKLWNSQNGYNNAKRAIQECFEKVEGLGYIDLLLIHS 120

Query: 128 PLSGTRRRLETYKAMQEAVDEGIVRSIGVSNYGKHHIDELLTWKELKHKPVVNQIEISPW 187
           PLSG+R+RLETYKAMQEAVD+GIVRSIGVSNYG HHIDELL W ELK+KP VNQIEISPW
Sbjct: 121 PLSGSRKRLETYKAMQEAVDKGIVRSIGVSNYGVHHIDELLNWNELKYKPFVNQIEISPW 180

Query: 188 IMRQDLADYCKSKGLVVEAFSPLTHGYKLKHPDVLLVAKETGTDAGRVLIRWSLQHGYVP 247
           +MRQ+LADYCKS+GL+VEA++PLTHGYK+ HP+VL VAKE G ++G+VLIRWSLQHGYVP
Sbjct: 181 LMRQELADYCKSRGLIVEAYAPLTHGYKINHPNVLRVAKEAGCNSGQVLIRWSLQHGYVP 240

Query: 248 LPKSRSVERLKGNVKAYDFELSPEQVSFLDQPQAYEPTDWECT 290
           LPK++SV+RL  N+  Y+ EL+ EQ+ FLDQP AYEPTDWECT
Sbjct: 241 LPKTKSVKRLPSNLDVYNIELTQEQMDFLDQPDAYEPTDWECT 283

>YJR096W (YJR096W) [2988] chr10 (611112..611960) NADPH-specific
           aldo/keto reductase, may play a general role in reducing
           pentose sugars [849 bp, 282 aa]
          Length = 282

 Score =  442 bits (1137), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 203/278 (73%), Positives = 243/278 (87%)

Query: 13  VPKAYKLSSGYILPSIGLGTYDIPRAETSEVVYQALKSGYRHLDTAVLYGNEHEVGQGIQ 72
           VPK YKLS+G+ +PSI LGTYDIPR++T+E+VY+ +K GYRH DTAVLYGNE EVG GI 
Sbjct: 2   VPKFYKLSNGFKIPSIALGTYDIPRSQTAEIVYEGVKCGYRHFDTAVLYGNEKEVGDGII 61

Query: 73  KWLEEDPEHNKRQDVFYTTKLWNSQNGYSNAKRAIKECMEKVSPLGYIDLLLIHSPLSGT 132
           KWL EDP ++KR+++FYTTKLWNSQNGY  AK AI++C+ +VS L YIDLLLIHSPL G+
Sbjct: 62  KWLNEDPGNHKREEIFYTTKLWNSQNGYKRAKAAIRQCLNEVSGLQYIDLLLIHSPLEGS 121

Query: 133 RRRLETYKAMQEAVDEGIVRSIGVSNYGKHHIDELLTWKELKHKPVVNQIEISPWIMRQD 192
           + RLET++AMQEAVDEG+V+SIGVSNYGK HIDELL W ELKHKPVVNQIEISPWIMRQ+
Sbjct: 122 KLRLETWRAMQEAVDEGLVKSIGVSNYGKKHIDELLNWPELKHKPVVNQIEISPWIMRQE 181

Query: 193 LADYCKSKGLVVEAFSPLTHGYKLKHPDVLLVAKETGTDAGRVLIRWSLQHGYVPLPKSR 252
           LADYCKSKGLVVEAF+PL HGYK+ +PD+L V KE   + G+VLIRWSLQHGY+PLPK++
Sbjct: 182 LADYCKSKGLVVEAFAPLCHGYKMTNPDLLKVCKEVDRNPGQVLIRWSLQHGYLPLPKTK 241

Query: 253 SVERLKGNVKAYDFELSPEQVSFLDQPQAYEPTDWECT 290
           +V+RL+GN+ AY+FELS EQ+ FLD P AYEPTDWECT
Sbjct: 242 TVKRLEGNLAAYNFELSDEQMKFLDHPDAYEPTDWECT 279

>CAGL0C04543g 434137..435000 highly similar to sp|P47137
           Saccharomyces cerevisiae YJR096w, hypothetical start
          Length = 287

 Score =  427 bits (1097), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 199/284 (70%), Positives = 239/284 (84%), Gaps = 1/284 (0%)

Query: 8   MSKTT-VPKAYKLSSGYILPSIGLGTYDIPRAETSEVVYQALKSGYRHLDTAVLYGNEHE 66
           MS T  VPK Y+L  G  +PS+ LGTYDIP + T++VV +ALK GYRH DTAVLYGNE E
Sbjct: 1   MSVTVDVPKYYELQDGRKIPSLALGTYDIPNSVTAKVVTEALKCGYRHFDTAVLYGNERE 60

Query: 67  VGQGIQKWLEEDPEHNKRQDVFYTTKLWNSQNGYSNAKRAIKECMEKVSPLGYIDLLLIH 126
           VGQGI  W+ ED  HNKR+DVFYTTKLWNSQNGY+ AKRAIKECM+KVS LGYID+LLIH
Sbjct: 61  VGQGIVNWINEDKAHNKREDVFYTTKLWNSQNGYNEAKRAIKECMQKVSGLGYIDMLLIH 120

Query: 127 SPLSGTRRRLETYKAMQEAVDEGIVRSIGVSNYGKHHIDELLTWKELKHKPVVNQIEISP 186
           SPLSG RRRLET+KAMQEAVDEGIV+SIGVSNYGKHHI+ELL W ELK+KPVVNQIEISP
Sbjct: 121 SPLSGQRRRLETWKAMQEAVDEGIVKSIGVSNYGKHHIEELLGWDELKYKPVVNQIEISP 180

Query: 187 WIMRQDLADYCKSKGLVVEAFSPLTHGYKLKHPDVLLVAKETGTDAGRVLIRWSLQHGYV 246
           W+MRQ+LADYCKS  LVVEA++P+ HGYK+  P +  ++KETG + G++LIRWSLQHGY+
Sbjct: 181 WVMRQELADYCKSVNLVVEAYAPMAHGYKMNDPGLREISKETGMNPGQLLIRWSLQHGYL 240

Query: 247 PLPKSRSVERLKGNVKAYDFELSPEQVSFLDQPQAYEPTDWECT 290
           PLPK+++V RL  N+  Y+ +L+ +QV  +D P+AY+PTDWECT
Sbjct: 241 PLPKTKTVARLASNLDVYNHKLTLDQVKRMDHPEAYDPTDWECT 284

>Scas_691.5
          Length = 284

 Score =  413 bits (1061), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 185/280 (66%), Positives = 236/280 (84%)

Query: 11  TTVPKAYKLSSGYILPSIGLGTYDIPRAETSEVVYQALKSGYRHLDTAVLYGNEHEVGQG 70
           T+VPK Y  ++G  +PSI LGTYDIP++ T+++VY+ALK+GYRH DTAVLYGNEH+VG+G
Sbjct: 2   TSVPKYYTFNNGNQIPSIALGTYDIPQSITAKIVYEALKAGYRHFDTAVLYGNEHQVGEG 61

Query: 71  IQKWLEEDPEHNKRQDVFYTTKLWNSQNGYSNAKRAIKECMEKVSPLGYIDLLLIHSPLS 130
           I +W++EDP+ NKR DVFYTTKLWNSQNGY  A+ AIKEC+ KV  L YID+LLIHSPL 
Sbjct: 62  ILQWIQEDPQQNKRSDVFYTTKLWNSQNGYHQAQTAIKECLAKVHGLQYIDMLLIHSPLE 121

Query: 131 GTRRRLETYKAMQEAVDEGIVRSIGVSNYGKHHIDELLTWKELKHKPVVNQIEISPWIMR 190
           G  +RLET++AMQEAV+ G+V++IGVSNYG+ H++ELL W+ L  KPVVNQIEISPW+MR
Sbjct: 122 GRTKRLETWRAMQEAVESGLVKNIGVSNYGRQHVEELLQWERLTIKPVVNQIEISPWVMR 181

Query: 191 QDLADYCKSKGLVVEAFSPLTHGYKLKHPDVLLVAKETGTDAGRVLIRWSLQHGYVPLPK 250
            +LADYCKS GLVVEAF+PLTHGYKL   D++ V+KE G    +VLIRWSLQHGY+PLPK
Sbjct: 182 SELADYCKSVGLVVEAFAPLTHGYKLHDADLVRVSKEVGRSTVQVLIRWSLQHGYLPLPK 241

Query: 251 SRSVERLKGNVKAYDFELSPEQVSFLDQPQAYEPTDWECT 290
           +++V+RL+ N++AY+F+L+ EQ+  +D P AYEPTDWECT
Sbjct: 242 TKTVKRLEENLEAYNFQLTTEQMQLIDHPDAYEPTDWECT 281

>KLLA0F03256g 306731..307588 similar to sp|P47137 Saccharomyces
           cerevisiae YJR096w, start by similarity
          Length = 285

 Score =  411 bits (1056), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 189/279 (67%), Positives = 233/279 (83%)

Query: 12  TVPKAYKLSSGYILPSIGLGTYDIPRAETSEVVYQALKSGYRHLDTAVLYGNEHEVGQGI 71
           +VPK+YKLSSGY +PS+GLGTY++P  +T+ +V+QAL+ GYRH DTAVLYGNE+EVGQGI
Sbjct: 4   SVPKSYKLSSGYTIPSVGLGTYELPPNKTAYLVHQALEVGYRHFDTAVLYGNEYEVGQGI 63

Query: 72  QKWLEEDPEHNKRQDVFYTTKLWNSQNGYSNAKRAIKECMEKVSPLGYIDLLLIHSPLSG 131
           +KWL E+P  NKR DVFYTTKLW+SQ+GY  AK+AI  C+++V  LGYIDLLLIHSPL G
Sbjct: 64  KKWLNENPAENKRGDVFYTTKLWDSQHGYEKAKKAIDHCLQEVEDLGYIDLLLIHSPLGG 123

Query: 132 TRRRLETYKAMQEAVDEGIVRSIGVSNYGKHHIDELLTWKELKHKPVVNQIEISPWIMRQ 191
            + RLETY+AMQEAVD G VRSIGVSNYG  HI+ELL W++LK+KPVVNQIEISPW MRQ
Sbjct: 124 KKLRLETYEAMQEAVDAGKVRSIGVSNYGFQHIEELLNWEKLKYKPVVNQIEISPWCMRQ 183

Query: 192 DLADYCKSKGLVVEAFSPLTHGYKLKHPDVLLVAKETGTDAGRVLIRWSLQHGYVPLPKS 251
           +LAD+CK KG++VEA++PLTHG KLK PD++ VA E G D G+ LIRWSLQ GY+PLPK+
Sbjct: 184 ELADFCKKKGILVEAYAPLTHGTKLKDPDLVKVANEVGCDVGQALIRWSLQKGYIPLPKT 243

Query: 252 RSVERLKGNVKAYDFELSPEQVSFLDQPQAYEPTDWECT 290
           +SV RL  N+  + FE + +Q+  LD+P AYEPTDWECT
Sbjct: 244 QSVSRLASNLDVFSFEWTTDQMDQLDKPYAYEPTDWECT 282

>Kwal_47.18893
          Length = 289

 Score =  265 bits (676), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 128/266 (48%), Positives = 182/266 (68%), Gaps = 3/266 (1%)

Query: 19  LSSGYILPSIGLGTYDIPRAETSEVVYQALKSGYRHLDTAVLYGNEHEVGQGIQKWLEED 78
           L++G  +P + LG Y+ P+ ET   V+ ALKSGYRH+D A LYGNE EVG GI K+L+E 
Sbjct: 11  LTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIAKFLKET 70

Query: 79  PEHNKRQDVFYTTKLWNSQNGYSNAKRAIKECMEKVSPLGYIDLLLIHSPLSGTRRRLET 138
           P +  R ++FYTTK+    +GY  AK++I + +E V  + YIDLLLIH+P++ T  RL T
Sbjct: 71  P-NVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPIAATEERLGT 129

Query: 139 YKAMQEAVDEGIVRSIGVSNYGKHHIDELLTWKELKHKPVVNQIEISPWIMRQDLADYCK 198
           +KA+QEA  EG VR+IGVSNY   H++EL  W+ LK +P+VNQ E++PW+ R++L +YC+
Sbjct: 130 WKALQEAYAEGKVRAIGVSNYSIKHLEELYNWEGLKVEPMVNQFELNPWLTRKELCEYCE 189

Query: 199 SKGLVVEAFSPLTHGYKLKHPDVLLVAKET--GTDAGRVLIRWSLQHGYVPLPKSRSVER 256
            KG+V+EAFSPLT G K   P +  + K +       ++LIRWSLQ G++PLPKS + +R
Sbjct: 190 KKGMVLEAFSPLTRGQKFSDPQLQELIKTSYPNQTPAQILIRWSLQMGFIPLPKSSNSKR 249

Query: 257 LKGNVKAYDFELSPEQVSFLDQPQAY 282
              N++A DFE+S + +  L     Y
Sbjct: 250 QISNLQALDFEISDKDMKALTHDDTY 275

>ABL209C [383] [Homologous to ScYJR096W - SH] (11410..12342) [933
           bp, 310 aa]
          Length = 310

 Score =  255 bits (651), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 124/277 (44%), Positives = 179/277 (64%), Gaps = 2/277 (0%)

Query: 6   RIMSKTTVPKAYKLSSGYILPSIGLGTYDIPRAETSEVVYQALKSGYRHLDTAVLYGNEH 65
           R+M K       +LS G  +PS+GLG Y +      ++VY+AL+ GYR  D+A  Y NE 
Sbjct: 3   RVMQKEDC-HFRRLSDGTQIPSVGLGVYQVSEQTVQDLVYEALEVGYRLFDSAQAYHNED 61

Query: 66  EVGQGIQKWLEEDPEHNKRQDVFYTTKLWNSQNGYSNAKRAIKECMEKVSPLGYIDLLLI 125
            V +GI  WL+  P   +R+DV++TTK+    +GY   K+++++ +    PLGYIDL+L+
Sbjct: 62  GVARGIAAWLKHAP-GRRREDVYFTTKINTQNHGYEATKKSLEKSLHAAGPLGYIDLVLV 120

Query: 126 HSPLSGTRRRLETYKAMQEAVDEGIVRSIGVSNYGKHHIDELLTWKELKHKPVVNQIEIS 185
           H+P+S   RRL T++A++EAV EG VRSIGVSNYG+ H+ ELL W+ LK +PVVNQ+EI+
Sbjct: 121 HAPMSDRTRRLGTWQALEEAVVEGQVRSIGVSNYGQQHLSELLGWEGLKIRPVVNQVEIN 180

Query: 186 PWIMRQDLADYCKSKGLVVEAFSPLTHGYKLKHPDVLLVAKETGTDAGRVLIRWSLQHGY 245
           PW+ RQ+L  YC+   + V+AFSPL  G +L  P +  VA +      ++L+RWS+Q G+
Sbjct: 181 PWLCRQELVQYCRENNIAVQAFSPLMRGKRLDDPILQKVAHQYDKGVAQILVRWSIQMGF 240

Query: 246 VPLPKSRSVERLKGNVKAYDFELSPEQVSFLDQPQAY 282
           + LPK+   ERL  N   +DFELS E +S L     Y
Sbjct: 241 IVLPKAAKKERLAPNFDIWDFELSAETMSELTHSDDY 277

>Kwal_33.13276
          Length = 302

 Score =  238 bits (608), Expect = 9e-78,   Method: Compositional matrix adjust.
 Identities = 121/284 (42%), Positives = 188/284 (66%), Gaps = 17/284 (5%)

Query: 17  YKLSSGYILPSIGLGTYDIPRAETSEVVYQALKSGYRHLDTAVLYGNEHEVGQGIQKWLE 76
           YKL++G  +P IG G Y+IP+ +T+++VY ALK GYRH+DTAVLY N+ E  QG++K+L+
Sbjct: 13  YKLNNGQQIPVIGFGVYEIPKEDTADLVYSALKDGYRHIDTAVLYKNQKEAAQGVRKYLD 72

Query: 77  EDPEHNKRQDVFYTTKLWNSQNGYSNAKRAIKECMEKVSP-LGYIDLLLIHSPLSGTRRR 135
           E  E   R+++++TTKLW+SQ G    ++A++E    V   +GY+DLLL+HSP  G +RR
Sbjct: 73  ETGE--ARENIWFTTKLWDSQFGREETEKALQEVAADVKEYIGYVDLLLLHSPRGGAKRR 130

Query: 136 LETYKAMQEAVDEG-----IVRSIGVSNYGKHHIDELLTWKELKHKPVVNQIEISPWIMR 190
           LET+  +++AV E       ++SIGVSN+G  H++ELL  K  K KPV++Q+E+ PW+ R
Sbjct: 131 LETWAILEQAVQEPGSKALEIKSIGVSNFGVDHLEELL--KVAKVKPVLDQLELHPWLPR 188

Query: 191 QDLADYCKSKGLVVEAFSPLTHGYKLKHPDVLLVAKETGTDAGRVLIRWSLQHGYVPLPK 250
            +L  Y K K +  EA+SPLT GY+L+ P++L +  +TG +   +L+RWS   G+V L K
Sbjct: 189 VELRKYLKEKDIFAEAYSPLTQGYRLQDPELLALEAKTGINKAVILLRWSFLQGFVVLVK 248

Query: 251 SRSVERLKGNV-------KAYDFELSPEQVSFLDQPQAYEPTDW 287
           S + ER++ N+        ++  E+  +    LD+P+A +   W
Sbjct: 249 SSNPERIRQNLAVLPSENDSWKVEIDEQLWKTLDKPEAKDVATW 292

>CAGL0I01100g complement(91693..92625) highly similar to sp|P14065
           Saccharomyces cerevisiae YOR120w GCY1 or sp|Q12458
           Saccharomyces cerevisiae YDR368w YPR1, start by
           similarity
          Length = 310

 Score =  167 bits (424), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 106/287 (36%), Positives = 162/287 (56%), Gaps = 40/287 (13%)

Query: 18  KLSSGYILPSIGLGTYDIPRAETSEVVYQALKSGYRHLDTAVLYGNEHEVGQGIQKWLEE 77
           KL++G  +P IGLGT+     E      +ALK+GYRH+DTA +Y NE E+G+ I+     
Sbjct: 12  KLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEEIGRAIRD---- 67

Query: 78  DPEHNKRQDVFYTTKLWNSQNGYSNAKRAIKECMEKVSPLGYIDLLLIHSPLS------- 130
              +  R ++F TTKLW +Q  + N   A+ + ++++  L Y+DL L+H P++       
Sbjct: 68  --SNIPRNELFVTTKLWGTQ--HRNPTEALDQSLKRLG-LDYVDLYLMHWPVALKTDLIK 122

Query: 131 ------------GTR-------RRLETYKAMQEAVDEGIVRSIGVSNYGKHHIDELLTWK 171
                       G+R         ++T++ MQE   E   R+IGVSN+  +++ ELL  K
Sbjct: 123 DGNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKEK-ARAIGVSNFSINNLKELLNSK 181

Query: 172 ELKHKPVVNQIEISPWIMRQDLADYCKSKGLVVEAFSPL--THGYKLKHPDVLLVAKETG 229
             K  P  NQIEI P + + +L ++CK KG+V+EA+SPL  T    LK  ++  +AK+ G
Sbjct: 182 GNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIAKKNG 241

Query: 230 TDAGRVLIRWSLQHGYVPLPKSRSVERLKGNVKAYDFELSPEQVSFL 276
            +AG+++I W  Q GYV LPKS   ER+ GN +   F+LS E  + L
Sbjct: 242 VNAGQLVISWHAQRGYVVLPKSVKPERIHGNQET--FKLSDEDFATL 286

>YOR120W (GCY1) [4923] chr15 (551114..552052) Aldo-keto reductase,
           induced by galactose, has strong similarity to
           crystallin protein of vertebrate eye lens [939 bp, 312
           aa]
          Length = 312

 Score =  165 bits (417), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 102/286 (35%), Positives = 157/286 (54%), Gaps = 42/286 (14%)

Query: 15  KAYKLSSGYILPSIGLGTYDIPRAETSEVVYQALKSGYRHLDTAVLYGNEHEVGQGIQKW 74
           K   L++G  +P IGLGT+     +  + V  ALK GYRH+DTA +Y NE +VGQ I+  
Sbjct: 10  KILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNEDQVGQAIKD- 68

Query: 75  LEEDPEHNKRQDVFYTTKLWNSQNGYSNAKRAIKECMEKVSPLGYIDLLLIHSPL----- 129
                    R+++F TTKLW +Q  +   + A+ + ++++  L Y+DL L+H P      
Sbjct: 69  -----SGVPREEIFVTTKLWCTQ--HHEPEVALDQSLKRLG-LDYVDLYLMHWPARLDPA 120

Query: 130 --------------SGTR-------RRLETYKAMQEAVDEGIVRSIGVSNYGKHHIDELL 168
                          G+R         ++T++ MQE    G  +++GVSN+  +++ +LL
Sbjct: 121 YIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDLL 180

Query: 169 TWKELKHKPVVNQIEISPWIMRQDLADYCKSKGLVVEAFSPL--THGYKLKHPDVLLVAK 226
             +  K  P  NQ+EI P + + +L ++CKSKG+VVEA+SPL  T    LK P +L +AK
Sbjct: 181 ASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIAK 240

Query: 227 ETGTDAGRVLIRWSLQHGYVPLPKSRSVERLKGNVKAY-----DFE 267
           +     G V+I W +Q GYV LPKS + +R+K N K +     DFE
Sbjct: 241 KNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTEDFE 286

>Sklu_1828.2 YDR368W, Contig c1828 3683-4621 reverse complement
          Length = 312

 Score =  162 bits (409), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 100/284 (35%), Positives = 159/284 (55%), Gaps = 39/284 (13%)

Query: 18  KLSSGYILPSIGLGTYDIPRAETSEVVYQALKSGYRHLDTAVLYGNEHEVGQGIQKWLEE 77
           KL++G I+P +GLGT+     E    V  A+K GYRH+D+A +YGNE  VG+ I+     
Sbjct: 13  KLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEEPVGKAIRD---- 68

Query: 78  DPEHNKRQDVFYTTKLWNSQNGYSNAKRAIKECMEKVSPLGYIDLLLIHSPLSGTRRRLE 137
                 R ++F TTKLW +Q    N ++A+   ++++  L Y+DL LIH P++     ++
Sbjct: 69  --SGVPRNELFVTTKLWGTQQ--RNPEKALDASLKRLG-LDYVDLYLIHWPIAFKTDNIK 123

Query: 138 --------------------------TYKAMQEAVDEGIVRSIGVSNYGKHHIDELLTWK 171
                                     T++ +QE    G  +++GVSN+  +++ ELL   
Sbjct: 124 DDDYLTVPTGKDGKADVDVKDWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKELLASP 183

Query: 172 ELKHKPVVNQIEISPWIMRQDLADYCKSKGLVVEAFSPL-THGYK-LKHPDVLLVAKETG 229
             K  P  NQ+E+ P + + +L ++ KSKG+V+EA+SPL ++G   LK P ++ VAK+ G
Sbjct: 184 GNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVIIEVAKKYG 243

Query: 230 TDAGRVLIRWSLQHGYVPLPKSRSVERLKGNVKAYDFELSPEQV 273
            +  +VLI W +Q GYV LPKS + +R++ N K +D  LS E V
Sbjct: 244 VEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFD--LSKEDV 285

>KLLA0B14707g complement(1291951..1292883) similar to sp|P14065
           Saccharomyces cerevisiae YOR120w GCY1 galactose-induced
           protein of aldo/keto reductase family, start by
           similarity
          Length = 310

 Score =  159 bits (403), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 97/287 (33%), Positives = 151/287 (52%), Gaps = 37/287 (12%)

Query: 8   MSKTTVPKAYKLSSGYILPSIGLGTYDIPRAETSEVVYQALKSGYRHLDTAVLYGNEHEV 67
           MS +    + KL++G  +P +GLGT+  P  +    V  AL++GYRH+DTA +YGNE  V
Sbjct: 1   MSTSNESPSLKLNTGASIPVVGLGTWKSPEEDAYNAVVSALQNGYRHIDTAAIYGNEEAV 60

Query: 68  GQGIQKWLEEDPEHNKRQDVFYTTKLWNSQNGYSNAKRAIKECMEKVSPLGYIDLLLIH- 126
           G+GI+           R+++F TTKLW +Q    + + A+   ++++  L Y+DL LIH 
Sbjct: 61  GKGIRD------SGVPREEIFVTTKLWGTQQ--RDPEAALDLSLQRLG-LDYVDLYLIHW 111

Query: 127 -SPLSGTR------------------------RRLETYKAMQEAVDEGIVRSIGVSNYGK 161
             PL+ +                           ++T++ MQ     G  ++IGVSN+  
Sbjct: 112 PVPLNASSITDGNYLTFPRTADGKIDIDIEEWNFIKTWEKMQHLPKSGKTKAIGVSNFSI 171

Query: 162 HHIDELLTWKELKHKPVVNQIEISPWIMRQDLADYCKSKGLVVEAFSPL--THGYKLKHP 219
            +I+ LL        P  NQIEI P + + +L DYCKSKG+++EA+SPL  +    L  P
Sbjct: 172 KNIEALLAANPDFIVPAANQIEIHPQLPQTELIDYCKSKGILIEAYSPLGSSSSTILTDP 231

Query: 220 DVLLVAKETGTDAGRVLIRWSLQHGYVPLPKSRSVERLKGNVKAYDF 266
            +  +A +   +   +LI W    GYV LPKS + +R+K N+K  D 
Sbjct: 232 TIEGIASKYNAEPANILISWGASRGYVVLPKSVNPQRIKTNLKLLDL 278

>Scas_714.7
          Length = 322

 Score =  160 bits (404), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 96/295 (32%), Positives = 166/295 (56%), Gaps = 40/295 (13%)

Query: 8   MSKTTVPKAYKLSSGYILPSIGLGTY-DIPRAETSEVVYQALKSGYRHLDTAVLYGNEHE 66
           MS +     +KL++G  + ++GLGT+      E  E V  ALK+GYRH+DTA +YGNE +
Sbjct: 12  MSASNSTTTFKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQ 71

Query: 67  VGQGIQKWLEEDPEHNKRQDVFYTTKLWNSQNGYSNAKRAIKECMEKVSPLGYIDLLLIH 126
           VG+ I      +     R+++F TTKLW++Q  + +    + + ++++  L Y+DL L+H
Sbjct: 72  VGKAI------NDSGVPREEIFVTTKLWSTQ--HHDPAAGLNDSLKRLG-LDYVDLYLMH 122

Query: 127 SPLSGTRRRLE--------------------------TYKAMQEAVDEGIVRSIGVSNYG 160
            P++   R ++                          T++ MQE    G  R++GVSN+ 
Sbjct: 123 WPVTLNPRSIKDGNFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFS 182

Query: 161 KHHIDELLTWKELKHKPVVNQIEISPWIMRQDLADYCKSKGLVVEAFSPL--THGYKLKH 218
            +++ ++L+    K  P VNQ+EI P + +++L ++C SKG+++EA+SPL  T+   L  
Sbjct: 183 INNLKKVLSSPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTE 242

Query: 219 PDVLLVAKETGTDAGRVLIRWSLQHGYVPLPKSRSVERLKGNVKAYDFELSPEQV 273
           P ++ +AK+ G    +++I W +Q GY+ LPKS   ER++ N K    +LS E++
Sbjct: 243 PVLINLAKKHGVQTAQIVISWHVQRGYIVLPKSVHAERIQANFKT--LKLSDEEM 295

>Sklu_1971.3 YHR104W, Contig c1971 5146-6135
          Length = 329

 Score =  157 bits (397), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 100/297 (33%), Positives = 153/297 (51%), Gaps = 47/297 (15%)

Query: 11  TTVPKAYKLSSGYILPSIGLGTYDIPRAETSEVVYQALKSGYRHLDTAVLYGNEHEVGQG 70
           + + K   L++G  +P IGLG + IP    +  VY+A+K GYR  D A  YGNE EVGQG
Sbjct: 2   SALSKTVTLNNGLEMPLIGLGCWKIPNDVCASQVYEAIKLGYRLFDGAQDYGNEKEVGQG 61

Query: 71  IQKWLEEDPEHNKRQDVFYTTKLWNSQNGYSNAKRAIKECMEKVSPLGYIDLLLIHSPL- 129
           I+K + E     KR+D+F  +KLWNS +   N K A+K+ ++ +  L Y+DL  IH PL 
Sbjct: 62  IKKAIAEGIV--KREDLFVVSKLWNSFHHPDNVKLALKKTLDDIG-LDYLDLFYIHFPLA 118

Query: 130 ---------------SGTRRR------------LETYKAMQEAVDEGIVRSIGVSNYGKH 162
                          +G                ++TY+A+++ VDEG+++SIG+SN+   
Sbjct: 119 FKFVPFEEKYPPGFYTGAEDEKNGVISQEDVPLIDTYRALEKCVDEGLIKSIGISNFNGS 178

Query: 163 HIDELLTWKELKHKPVVNQIEISPWIMRQDLADYCKSKGLVVEAFSPL------------ 210
            + +LL  +  + KPV  QIE  P++ +++L  YCK+ G+ V A+S              
Sbjct: 179 LVQDLL--RGARIKPVALQIEHHPYLTQENLVKYCKNVGIQVVAYSSFGPQSFIELDSEL 236

Query: 211 --THGYKLKHPDVLLVAKETGTDAGRVLIRWSLQHGYVPLPKSRSVERLKGNVKAYD 265
             T     ++  V L+A        +VL+RW+ Q G   +PKS   ERL  N+   D
Sbjct: 237 AKTTPTLFRNDTVKLIANNHKVSTSQVLLRWATQRGVAVIPKSSKKERLLENLTIND 293

>KLLA0D10109g 854495..855424 similar to sp|P14065 Saccharomyces
           cerevisiae YOR120w GCY1 galactose-induced protein of
           aldo/keto reductase family, start by similarity
          Length = 309

 Score =  156 bits (394), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 94/271 (34%), Positives = 140/271 (51%), Gaps = 35/271 (12%)

Query: 16  AYKLSSGYILPSIGLGTYDIPRAETSEVVYQALKSGYRHLDTAVLYGNEHEVGQGIQKWL 75
           + KL++G  +P +G GT+    A+    V  ALK+GYRH+D A +YGNE  VG+GI+   
Sbjct: 10  SLKLNTGASIPQLGFGTWPSSHADAYTAVITALKTGYRHIDAAAMYGNEAAVGKGIRD-- 67

Query: 76  EEDPEHNKRQDVFYTTKLWNSQNGYSNAKRAIKECMEKVSPLGYIDLLLIH-----SPLS 130
                   R+++F TTKLWN+Q    +   A+ E +E++  L Y+DL LIH      P+ 
Sbjct: 68  ----SGIPREEIFVTTKLWNTQQ--RDPASALDESLERLG-LDYVDLFLIHWPVPLKPVG 120

Query: 131 GTRRRLE-------------------TYKAMQEAVDEGIVRSIGVSNYGKHHIDELLTWK 171
           G    L+                   T++ MQ     G  R++GVSN+   ++++LL   
Sbjct: 121 GPENLLKYPTPGIKPQIDTEDWSFIKTWELMQTLPKTGKTRAVGVSNFSIKNLEDLLNSS 180

Query: 172 ELKHKPVVNQIEISPWIMRQDLADYCKSKGLVVEAFSPL--THGYKLKHPDVLLVAKETG 229
                P VNQ EI P + + +L +YCKSKG+VVEA+ PL  +    L  P +  +A +  
Sbjct: 181 PDVLVPAVNQFEIHPQLPQTELINYCKSKGIVVEAYCPLGSSSSAMLSDPTIAEIADKYH 240

Query: 230 TDAGRVLIRWSLQHGYVPLPKSRSVERLKGN 260
                VLI W +  GY  LPKS +  R+  N
Sbjct: 241 VKPANVLINWGISRGYCVLPKSFTPARIASN 271

>CAGL0I01122g 93934..94914 highly similar to sp|P38715 Saccharomyces
           cerevisiae YHR104w GRE3 aldose reductase, start by
           similarity
          Length = 326

 Score =  151 bits (382), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 95/285 (33%), Positives = 147/285 (51%), Gaps = 47/285 (16%)

Query: 19  LSSGYILPSIGLGTYDIPRAETSEVVYQALKSGYRHLDTAVLYGNEHEVGQGIQKWLEED 78
           L++G  +P +GLG + IP    ++ VY A+K GYR  D A  YGNE EVGQGI+K ++E 
Sbjct: 7   LNNGLKMPLVGLGCWKIPNDVCAQQVYDAIKIGYRLFDGAEDYGNEKEVGQGIRKAIDEG 66

Query: 79  PEHNKRQDVFYTTKLWNSQNGYSNAKRAIKECMEKVSPLGYIDLLLIHSPLSGTRRRLE- 137
               KR+DVF  +KLWNS +   + K A+K  +  +  L Y+DL  IH P++      E 
Sbjct: 67  VV--KREDVFVVSKLWNSFHHPDHVKMALKRTLSDMG-LDYLDLFYIHFPIAFKYVPFEE 123

Query: 138 ---------------------------TYKAMQEAVDEGIVRSIGVSNYGKHHIDELLTW 170
                                      TY+A+++ V+EG+++SIG+SN+    + +LL  
Sbjct: 124 KYPPGFYTGKEDEKNGHITEAHVPIIDTYRALEQCVEEGLIKSIGISNFSGSLVQDLL-- 181

Query: 171 KELKHKPVVNQIEISPWIMRQDLADYCKSKGLVVEAFSP--------LTHGYKLKHPDVL 222
           ++ K KPV  Q+E  P++ ++ L +YCK  G+ V A+S         L H      P++ 
Sbjct: 182 RQCKIKPVALQVEHHPYLTQEHLVEYCKDNGIQVVAYSSFGPQSYIELNHPLAKNTPNLF 241

Query: 223 ------LVAKETGTDAGRVLIRWSLQHGYVPLPKSRSVERLKGNV 261
                  +A        +VL+RW+ Q G   +PKS   ERL+ N+
Sbjct: 242 HHDTIKQIANNHNVATSQVLLRWATQRGIAIIPKSSKKERLQDNL 286

>CAGL0A02816g 292159..293091 highly similar to tr|Q12458
           Saccharomyces cerevisiae YDR368w YPR1, hypothetical
           start
          Length = 310

 Score =  150 bits (380), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 90/283 (31%), Positives = 151/283 (53%), Gaps = 37/283 (13%)

Query: 8   MSKTTVPKAYKLSSGYILPSIGLGTYDIPRAETSEVVYQALKSGYRHLDTAVLYGNEHEV 67
           MS        KL++G  +P +GLGT+     +  + V  ALK GYRH+D A +YGNE +V
Sbjct: 1   MSLKNSTATLKLNTGAEIPVVGLGTWRSAANDGYDSVLAALKLGYRHIDAAAIYGNEDQV 60

Query: 68  GQGIQKWLEEDPEHNKRQDVFYTTKLWNSQNGYSNAKRAIKECMEKVSPLGYIDLLLIHS 127
           G+ I+           RQ++F TTKLW ++  + N  +A+   ++++  L Y+DL L+H 
Sbjct: 61  GRAIKD------SGVPRQEIFITTKLWGTE--HRNPAKALDSSLKRLG-LDYVDLYLMHW 111

Query: 128 PLS----GTRRR----------------------LETYKAMQEAVDEGIVRSIGVSNYGK 161
           P++    G+  +                      ++T++ MQE    G  ++IGVSN+  
Sbjct: 112 PVALKAHGSEEKDLLNIPKKPDGKTDIDIEDWDFIKTWELMQELPKTGKTKAIGVSNFSI 171

Query: 162 HHIDELLTWKELKHKPVVNQIEISPWIMRQDLADYCKSKGLVVEAFSPLTHGYK--LKHP 219
           +++  L    +    P  NQ+EI P   + +L +YCKS+ +++EA+SP        LK P
Sbjct: 172 NNLKALKNSPKFNTVPAANQVEIHPLFPQTELIEYCKSENILIEAYSPFGSADAPVLKEP 231

Query: 220 DVLLVAKETGTDAGRVLIRWSLQHGYVPLPKSRSVERLKGNVK 262
           ++  +A++      +++I WS+Q GYV LPKS   ER++ N+K
Sbjct: 232 ELHKLAEKYNISTAQLIISWSVQRGYVVLPKSVHAERIEANLK 274

>Kwal_47.18084
          Length = 309

 Score =  149 bits (375), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 91/277 (32%), Positives = 144/277 (51%), Gaps = 36/277 (12%)

Query: 18  KLSSGYILPSIGLGTYDIPRAETSEVVYQALKSGYRHLDTAVLYGNEHEVGQGIQKWLEE 77
           KL++G  +P +G GT+     E    V  A+K GYRH+D+A +YGNE  VG+ I+     
Sbjct: 12  KLNTGATIPLLGFGTWRSTEEEGYNAVLSAIKDGYRHIDSAAVYGNEAAVGRAIRD---- 67

Query: 78  DPEHNKRQDVFYTTKLWNSQNGYSNAKRAIKECMEKVSPLGYIDLLLIHSPLSGTRRR-- 135
                 R+++F TTKLWN+Q       +A+ + ++++  L Y+DL LIH PL     R  
Sbjct: 68  --SGVPREELFVTTKLWNTQQ--REPAKALDQSLQRLG-LDYVDLYLIHWPLPIKTDRIT 122

Query: 136 -----------------------LETYKAMQEAVDEGIVRSIGVSNYGKHHIDELLTWKE 172
                                  ++T++ MQE    G  R++GVSN     +++LL  K 
Sbjct: 123 DGNLFSIPTKEDGKPDVDTEWDYIKTWQLMQELPSTGKTRAVGVSNVSVSQLEKLLADKG 182

Query: 173 LKHKPVVNQIEISPWIMRQDLADYCKSKGLVVEAFSPL-THGYKL-KHPDVLLVAKETGT 230
            K  P V Q+E  P + +  L D+C    +++EA+SPL + G  L   P +  +AK+   
Sbjct: 183 NKVVPAVCQVETHPLLPQNKLLDFCTKHDILLEAYSPLGSQGSPLIDEPVIKEIAKKYNA 242

Query: 231 DAGRVLIRWSLQHGYVPLPKSRSVERLKGNVKAYDFE 267
           D  +++I W ++ GYV LPKS +  R+K N++  D E
Sbjct: 243 DPAQIIISWDIKRGYVVLPKSVTPSRIKSNLQTLDLE 279

>Kwal_55.21536
          Length = 329

 Score =  149 bits (376), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 97/294 (32%), Positives = 147/294 (50%), Gaps = 47/294 (15%)

Query: 11  TTVPKAYKLSSGYILPSIGLGTYDIPRAETSEVVYQALKSGYRHLDTAVLYGNEHEVGQG 70
           T   +  KL++G  +P +GLG + IP    +  VY+A+K GYR  D A  YGNE EVGQG
Sbjct: 2   TYTSETVKLNNGLQMPLVGLGCWKIPNEVCASQVYEAIKLGYRLFDGAQDYGNEKEVGQG 61

Query: 71  IQKWLEEDPEHNKRQDVFYTTKLWNSQNGYSNAKRAIKECMEKVSPLGYIDLLLIHSPLS 130
           I K ++E     KR+D+F  +KLWNS +   N K+A+K  +E +  L Y+DL  IH PL+
Sbjct: 62  IHKAIDEGI--VKREDLFVVSKLWNSYHDPKNVKKALKRTLEDME-LEYLDLFYIHFPLA 118

Query: 131 GTRRRLE----------------------------TYKAMQEAVDEGIVRSIGVSNYGKH 162
                 E                            TY+A++E V EG+++SIG+SN+   
Sbjct: 119 FKYVPFEEKYPPGFYTGAEDAKKGVISLEQVPIIDTYRALEECVKEGLIKSIGISNFRGI 178

Query: 163 HIDELLTWKELKHKPVVNQIEISPWIMRQDLADYCKSKGLVVEAFSPL------------ 210
            I +LL    +  KPV  QIE  P++ ++ L +YC  + + V A+S              
Sbjct: 179 LIHDLLAGATI--KPVCLQIEHHPYLTQEKLIEYCAQEQIQVVAYSSFGPQSFLELDSEL 236

Query: 211 --THGYKLKHPDVLLVAKETGTDAGRVLIRWSLQHGYVPLPKSRSVERLKGNVK 262
             +     +H  +  +A   G  + +VL+RW+ Q     +PKS   ERL  N++
Sbjct: 237 AKSTPTLFEHEGIQKIATNHGVSSSQVLLRWATQRRIAIIPKSSKKERLLDNLQ 290

>YDR368W (YPR1) [1194] chr4 (1213892..1214830) 2-methylbutyraldehyde
           reductase induced by osmotic and oxidative stress,
           member of the aldo/keto reductase family, plays a role
           in arabinose catabolism and may play a general role in
           reducing pentose sugars [939 bp, 312 aa]
          Length = 312

 Score =  147 bits (370), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 95/292 (32%), Positives = 152/292 (52%), Gaps = 42/292 (14%)

Query: 1   MPSKARIMSKTTVPKAYKLSSGYILPSIGLGTYDIPRAETSEVVYQALKSGYRHLDTAVL 60
           MP+  +  S T      KL++G  +P +G GT+          V  ALK+GYRH+D A +
Sbjct: 1   MPATLKNSSAT-----LKLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAI 55

Query: 61  YGNEHEVGQGIQKWLEEDPEHNKRQDVFYTTKLWNSQNGYSNAKRAIKECMEKVSPLGYI 120
           Y NE EVG+ I+           R+++F TTKLW ++    + + A+ + ++++  L Y+
Sbjct: 56  YLNEEEVGRAIKD------SGVPREEIFITTKLWGTEQ--RDPEAALNKSLKRLG-LDYV 106

Query: 121 DLLLIHSPLSGTRRR--------------------------LETYKAMQEAVDEGIVRSI 154
           DL L+H P+     R                          ++T++ MQE    G  +++
Sbjct: 107 DLYLMHWPVPLKTDRVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAV 166

Query: 155 GVSNYGKHHIDELLTWKELKHKPVVNQIEISPWIMRQDLADYCKSKGLVVEAFSPL--TH 212
           GVSN+  ++I ELL     K  P  NQIEI P + + +L  +CK KG+VVEA+SP    +
Sbjct: 167 GVSNFSINNIKELLESPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSAN 226

Query: 213 GYKLKHPDVLLVAKETGTDAGRVLIRWSLQHGYVPLPKSRSVERLKGNVKAY 264
              LK   ++ +AK+ G +  +++I WS+Q GYV L KS + ER+  N K +
Sbjct: 227 APLLKEQAIIDMAKKHGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIF 278

>Scas_676.4
          Length = 313

 Score =  146 bits (368), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 93/283 (32%), Positives = 152/283 (53%), Gaps = 41/283 (14%)

Query: 18  KLSSGYILPSIGLGTY-DIPRAETSEVVYQALKSGYRHLDTAVLYGNEHEVGQGIQKWLE 76
           KL++G  +P I LGT+  +   +  + V  ALK+GYRH+DTA +YGNE +VG+ I+    
Sbjct: 13  KLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNEDQVGKAIRD--- 69

Query: 77  EDPEHNKRQDVFYTTKLWNSQNGYSNAKRAIKECMEKVS-----------PLGY------ 119
                  R+++F T+KLWN+Q    N   A+K+ + ++            P+ +      
Sbjct: 70  ---SGIPREEIFVTSKLWNTQQ--HNPAGALKDTLSRLGLDYLDLYLMHWPVTFNTRNVK 124

Query: 120 -IDLLLIHSPLSG-------TRRRLETYKAMQEAVDEGIVRSIGVSNYGKHHIDELLTWK 171
             D ++I    +G       T   ++T++ MQE    G+ +++GVSN+  +++ ELLT  
Sbjct: 125 GTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKELLTSP 184

Query: 172 ELKHKPVVNQIEISPWIMRQDLADYCKSKGLVVEAFSPL--THGYKLKHPDVLLVAKETG 229
             K  P  NQIEI P +   DL  +C+ KG+++EA+SPL   +   LK P ++ ++K+  
Sbjct: 185 GNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKIIEISKKLD 244

Query: 230 TDAGRVLIRWSLQHGYVPLPKSRSVERLKGNVKAY-----DFE 267
               +++I W +Q GYV L KS   ER+  N K +     DFE
Sbjct: 245 VPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFTLSKEDFE 287

>Sklu_2408.8 , Contig c2408 19753-20721 reverse complement
          Length = 322

 Score =  140 bits (354), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 97/291 (33%), Positives = 164/291 (56%), Gaps = 46/291 (15%)

Query: 12  TVPKA----YKLSSGYILPSIGLGTYDIPR--AETSEVVYQALKSGYRHLDTAVLYGNEH 65
           T P+A    + L++G  +PS+GLGT + P    +T + V  A+K+GYR +DTA +YG+E 
Sbjct: 2   THPRATEIYFNLNTGAKIPSLGLGTVNPPEKMPQTKDAVKHAVKNGYRLIDTAWMYGSEP 61

Query: 66  EVGQGIQKWLEEDPEHNKRQDVFYTTKLWNSQNGYSNAKRAIKECMEKVSPLGYIDLLLI 125
            +G+ +Q+  EE     KR+D+F TTK+W     Y+  +++++E ++++  L Y+DLLL 
Sbjct: 62  YIGEALQELFEEGVV--KREDLFITTKVWPCH--YNTVEQSLQESLKQLK-LDYVDLLLQ 116

Query: 126 HSPLSGTRRRLETYKAMQEAVD----------------------------EGIVRSIGVS 157
           H PL   ++  E  K     VD                             G VR+IGVS
Sbjct: 117 HWPLCFVKQYDEHGKLKSHPVDPKSGDIVLDEKGDYLTTWKQLEKVYKDGSGRVRNIGVS 176

Query: 158 NYGKHHIDELLTWKELKHKPVVNQIEISPWIMRQDLADYCKSKGLVVEAFSPL--THGYK 215
           NY   +++ LL  KE +  PV+NQ+E+ P + +++L++YC S G+++E+FSPL  +    
Sbjct: 177 NYPVEYLERLL--KETEVVPVLNQVELHPLLPQEELSEYCNSHGILMESFSPLGSSGTPH 234

Query: 216 LKHPDVLLVAKETGTDAGRVLIRWSLQHGYVPLPKSRSVERLKGNVKAYDF 266
           L+HP V  ++K+   + G VL+ + ++ G V +P+S +  R+   +K  DF
Sbjct: 235 LEHPLVKELSKKYDCEPGSVLLNYHVRKGNVVVPRSLNHGRI---IKNADF 282

>ACL107C [942] [Homologous to ScYHR104W (GRE3) - SH]
           (152564..153628) [1065 bp, 354 aa]
          Length = 354

 Score =  140 bits (352), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 94/300 (31%), Positives = 152/300 (50%), Gaps = 51/300 (17%)

Query: 5   ARIMSKTTVPKAYKLSSGYILPSIGLGTYDIPRAETSEVVYQALKSGYRHLDTAVLYGNE 64
           A +M+  T+    KL++G  +P +GLG + IP    +E VY+A+K GYR LD A  Y NE
Sbjct: 25  AMVMNVRTI----KLNNGADMPLVGLGCWKIPNEVAAEQVYEAIKLGYRLLDGAEDYANE 80

Query: 65  HEVGQGIQKWLEEDPEHNKRQDVFYTTKLWNSQNGYSNAKRAIKECMEKVSPLGYIDLLL 124
            EVGQGI++ ++E     +R+++F  +KLWN+ +   +  +A++  +  +  L Y+DL  
Sbjct: 81  REVGQGIRRAIDEG--LVRREELFVVSKLWNNYHRPEDVGKALQRTLSDLG-LDYLDLFY 137

Query: 125 IHSPL----------------SGTRRR------------LETYKAMQEAVDEGIVRSIGV 156
           IH PL                +G                +ETY+A+++ VDEG +R+IG+
Sbjct: 138 IHFPLAFKFVPLEERYPAGLYTGAADEQAGRLAQEPVPLIETYRALEQLVDEGRIRAIGL 197

Query: 157 SNYGKHHIDELLTWKELKHKPVVNQIEISPWIMRQDLADYCKSKGLVVEAFSPL------ 210
           SN+    + +LL  +  + +P   QIE  P++ ++ L  Y KS+GL V  +S L      
Sbjct: 198 SNFQGCLVQDLL--RGCRIRPAALQIEHHPYLTQERLVQYAKSEGLAVVGYSSLGPQSFL 255

Query: 211 --------THGYKLKHPDVLLVAKETGTDAGRVLIRWSLQHGYVPLPKSRSVERLKGNVK 262
                        L+H  V  +A+        VL+RW+ Q     +PKS   ERL  N++
Sbjct: 256 ELGNTAAQNAAPLLQHEVVCRIAERHTATPAEVLLRWATQRDIAVIPKSSRKERLATNLR 315

>YHR104W (GRE3) [2392] chr8 (323411..324394) Aldo/keto reductase
           with NADPH specificity, induced by osmotic stress, plays
           roles in methylglyoxal and arabinose catabolism and may
           play a general role in reducing pentose sugars [984 bp,
           327 aa]
          Length = 327

 Score =  138 bits (348), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 93/289 (32%), Positives = 147/289 (50%), Gaps = 52/289 (17%)

Query: 19  LSSGYILPSIGLGTYDIPRAETSEVVYQALKSGYRHLDTAVLYGNEHEVGQGIQKWLEED 78
           L++G  +P +GLG + I +   +  +Y+A+K GYR  D A  YGNE EVG+GI+K + E 
Sbjct: 7   LNNGLKMPLVGLGCWKIDKKVCANQIYEAIKLGYRLFDGACDYGNEKEVGEGIRKAISEG 66

Query: 79  PEHNKRQDVFYTTKLWNSQNGYSNAKRAIKECMEKVSPLGYIDLLLIHSPLSGTRRRLE- 137
                R+D+F  +KLWN+ +   + K A+K+ +  +  L Y+DL  IH P++      E 
Sbjct: 67  LV--SRKDIFVVSKLWNNFHHPDHVKLALKKTLSDMG-LDYLDLYYIHFPIAFKYVPFEE 123

Query: 138 ---------------------------TYKAMQEAVDEGIVRSIGVSNYGKHHIDELLTW 170
                                      TY+A++E VDEG+++SIGVSN+    I +LL  
Sbjct: 124 KYPPGFYTGADDEKKGHITEAHVPIIDTYRALEECVDEGLIKSIGVSNFQGSLIQDLL-- 181

Query: 171 KELKHKPVVNQIEISPWIMRQDLADYCKSKGLVVEAFSPLTHGYKLKHPDVLLVAKET-- 228
           +  + KPV  QIE  P++ ++ L ++CK   + V A+S       ++    L +AK T  
Sbjct: 182 RGCRIKPVALQIEHHPYLTQEHLVEFCKLHDIQVVAYSSFGPQSFIEMD--LQLAKTTPT 239

Query: 229 ---------------GTDAGRVLIRWSLQHGYVPLPKSRSVERLKGNVK 262
                          G+   +VL+RW+ Q G   +PKS   ERL GN++
Sbjct: 240 LFENDVIKKVSQNHPGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLE 288

>Scas_688.12
          Length = 326

 Score =  136 bits (342), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 97/323 (30%), Positives = 162/323 (50%), Gaps = 52/323 (16%)

Query: 13  VPKAYKLSSGYILPSIGLGTYDIPRAETSEVVYQALKSGYRHLDTAVLYGNEHEVGQGIQ 72
           +PK   L++G  +P +GLG + IP    ++ VY+A+K+GYR  D A  Y NE EVG+G++
Sbjct: 1   MPKLLTLNNGMKMPQVGLGCWKIPNDICADQVYEAIKAGYRLFDGATDYANEVEVGKGLK 60

Query: 73  KWLEEDPEHNKRQDVFYTTKLWNSQNGYSNAKRAIKECMEKVSPLGYIDLLLIHSPLS-- 130
           + +++     KRQD+F  +KLWN+ +   + K  +K  ++ +  L Y+DL  IH P++  
Sbjct: 61  RAMDDGIV--KRQDLFVVSKLWNNFHHPDHVKLNLKRNLKDLG-LDYLDLYYIHFPIAFK 117

Query: 131 ---------------------GTRRR-----LETYKAMQEAVDEGIVRSIGVSNYGKHHI 164
                                G         L+TY+A++E   EG+++SIG+SN+    +
Sbjct: 118 FVPMEERYPPQMYTGKADEAKGILTEENVPLLDTYRALEECQREGLIKSIGISNFNGGLV 177

Query: 165 DELLTWKELKHKPVVNQIEISPWIMRQDLADYCKSKGLVV---EAFSPLTH---GYKL-- 216
            ++L    +  KPV  QIE  P++ ++ L +YCK   + V    +F P +    G  L  
Sbjct: 178 ADILRGCSI--KPVALQIEHHPYLTQEKLLEYCKIHDVQVVGYSSFGPQSFADCGMDLAK 235

Query: 217 ------KHPDVLLVAKETGTDAGRVLIRWSLQHGYVPLPKSRSVERLKGNVKAYD----F 266
                  HP +  +A++       VL+RW+ Q G   +PKS   +RL  N+   D     
Sbjct: 236 NTPPLFDHPVIKKIAEKHNVSTAEVLLRWATQRGVAIIPKSSHKKRLLSNLNIDDNVTLT 295

Query: 267 ELSPEQVSFLDQPQAY-EPTDWE 288
           E   + +S L+Q   + +P DW 
Sbjct: 296 EEDLKSISGLNQNLRFNDPWDWN 318

>Sklu_1571.2 YBR149W, Contig c1571 1437-2405
          Length = 322

 Score =  133 bits (335), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 95/305 (31%), Positives = 169/305 (55%), Gaps = 51/305 (16%)

Query: 14  PKA----YKLSSGYILPSIGLGTYDIPR---AETSEVVYQALKSGYRHLDTAVLYGNEHE 66
           PKA    + L++G  +P++GLGT + P+    +T E V  A+K+G+R +DTA  YG E  
Sbjct: 4   PKATEIYFNLNNGTRIPAVGLGTAN-PKDKWPQTKEAVKAAVKAGFRQIDTAWAYGTEEY 62

Query: 67  VGQGIQKWLEEDPEHNKRQDVFYTTKLWNSQNGYSNAKRAIKECMEKVSPLGYIDLLLIH 126
           +G+ +Q+   E     KR+D+F TTK+W   N +  A++++ E ++++  L Y+DLLL H
Sbjct: 63  IGEALQELFAEGVV--KREDLFITTKVW--PNYWDQAEKSLNESLKRLQ-LDYVDLLLQH 117

Query: 127 SPLSGTRRR---------------------------LETYKAMQE---AVDEGIVRSIGV 156
            P    +++                           LETYK ++    A ++  VR+IGV
Sbjct: 118 WPFCFVKKQDPEGSGQLVNHPQHEDGSPFYDTAGDWLETYKQIEAIYLAENDTRVRAIGV 177

Query: 157 SNYGKHHIDELLTWKELKHKPVVNQIEISPWIMRQDLADYCKSKGLVVEAFSPL-THGY- 214
           SNY   +++ L  +KE K  P +NQ+E+ P + +++L DYC   G+++ ++SPL ++G  
Sbjct: 178 SNYPIEYLERL--FKECKTVPAINQVELHPRLPQRELCDYCNKHGILMTSYSPLGSNGAP 235

Query: 215 KLKHPDVLLVAKETGTDAGRVLIRWSLQHGYVPLPKSRSVERLKGNVKAYDF-ELSPEQV 273
            L+ P V  +A +   +   VL+ + ++ G + +P+S ++ER+    K   F  L+ E++
Sbjct: 236 NLRIPLVQELASKYNANGNDVLVSYHIRQGTIVIPRSLNLERIS---KGLGFVPLTKEEL 292

Query: 274 SFLDQ 278
             L+Q
Sbjct: 293 DKLNQ 297

>KLLA0E21714g complement(1929294..1930283)
           gi|1351442|sp|P49378|XYL1_KLULA Kluyveromyces lactis
           NAD(P)H-dependent xylose reductase, start by similarity
          Length = 329

 Score =  132 bits (333), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 95/324 (29%), Positives = 163/324 (50%), Gaps = 52/324 (16%)

Query: 11  TTVPKAYKLSSGYILPSIGLGTYDIPRAETSEVVYQALKSGYRHLDTAVLYGNEHEVGQG 70
           T + +   L++G  +P +GLG + +P    ++ +Y+A+K GYR  D A  Y NE EVGQG
Sbjct: 2   TYLAETVTLNNGEKMPLVGLGCWKMPNDVCADQIYEAIKIGYRLFDGAQDYANEKEVGQG 61

Query: 71  IQKWLEEDPEHNKRQDVFYTTKLWNSQNGYSNAKRAIKECMEKVSPLGYIDLLLIHSPL- 129
           + + ++E     KR+D+   +KLWNS +   N  RA++  +  +  L Y+D+  IH PL 
Sbjct: 62  VNRAIKEG--LVKREDLVVVSKLWNSFHHPDNVPRALERTLSDLQ-LDYVDIFYIHFPLA 118

Query: 130 ---------------SGTRRR------------LETYKAMQEAVDEGIVRSIGVSNYGKH 162
                          +G                L+T++A+++ VD+G ++S+G+SN+   
Sbjct: 119 FKPVPFDEKYPPGFYTGKEDEAKGHIEEEQVPLLDTWRALEKLVDQGKIKSLGISNFSGA 178

Query: 163 HIDELLTWKELKHKPVVNQIEISPWIMRQDLADYCKSKGLVVEAFS-------------- 208
            I +LL  +  + KPV  QIE  P++ ++ L  Y K+ G+ V A+S              
Sbjct: 179 LIQDLL--RGARIKPVALQIEHHPYLTQERLIKYVKNAGIQVVAYSSFGPVSFLELENKK 236

Query: 209 PLTHGYKLKHPDVLLVAKETGTDAGRVLIRWSLQHGYVPLPKSRSVERLKGNVKAYD-FE 267
            L      +H  +  +A +      +VL+RW+ Q+G   +PKS   ERL  N++  D   
Sbjct: 237 ALNTPTLFEHDTIKSIASKHKVTPQQVLLRWATQNGIAIIPKSSKKERLLDNLRINDALT 296

Query: 268 LSPE---QVSFLDQPQAY-EPTDW 287
           L+ +   Q+S L+Q   + +P +W
Sbjct: 297 LTDDELKQISGLNQNIRFNDPWEW 320

>Kwal_56.22611
          Length = 321

 Score =  127 bits (320), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 92/295 (31%), Positives = 154/295 (52%), Gaps = 42/295 (14%)

Query: 17  YKLSSGYILPSIGLGTYDIPR--AETSEVVYQALKSGYRHLDTAVLYGNEHEVGQGIQKW 74
           + L++G  +P++GLGT ++     +T + V  A+KSGYRH+DTA  Y  E  +G+ +++ 
Sbjct: 11  FTLNNGVKMPALGLGTANVIEQIPQTKQAVKAAIKSGYRHIDTAWAYRCEDRIGEALKEL 70

Query: 75  LEEDPEHNKRQDVFYTTKLWNSQNGYSNAKRAIKECMEKVSPLGYIDLLLIHSPLSGTRR 134
            EE     KR+D+F TTK+W +   +  A  +I   +E +  + Y+DL+L H PL   R 
Sbjct: 71  FEEGVI--KREDIFITTKVWPT--NWDRADESISRSLENLG-VDYVDLVLQHWPLCFNRL 125

Query: 135 R---------------------------LETYKAMQEAV--DEGIVRSIGVSNYGKHHID 165
           +                           L+T+K++++     +   RSIGVSNY   +++
Sbjct: 126 QDPEGIDGICRNPTHEDGSPHYNEKGDYLQTFKSLEKMYLSKDPRFRSIGVSNYPVEYLE 185

Query: 166 ELLTWKELKHKPVVNQIEISPWIMRQDLADYCKSKGLVVEAFSPL--THGYKLKHPDVLL 223
            LL  KE K  P VNQ+E+ P + + +L D+C    + +EAFSP   T    +K+  V  
Sbjct: 186 RLL--KECKVVPAVNQVEMHPHLPQMELRDFCTKHNIRLEAFSPFGATGSPMVKNELVQK 243

Query: 224 VAKETGTDAGRVLIRWSLQHGYVPLPKSRSVERLKGNVKAYDFELSPEQVSFLDQ 278
           VA++       VLI + L+ G V +P+S + + +  NV+     LS E +  L++
Sbjct: 244 VAQKYSCTPNDVLIAYHLRQGVVTVPRSVNPKNIASNVQF--VPLSKEDIDELNK 296

>AER401W [2901] [Homologous to ScYDR368W (YPR1) - SH; ScYOR120W
           (GCY1) - SH] complement(1406905..1407846) [942 bp, 313
           aa]
          Length = 313

 Score =  124 bits (311), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 95/304 (31%), Positives = 154/304 (50%), Gaps = 41/304 (13%)

Query: 1   MPSKARIMSKTTVPKAYKLSSGYILPSIGLGTYDIPRAETSEVVYQALKSGYRHLDTAVL 60
           M +KA + + T       L++G  +P  GLGT+     + S  V  ALK GY+H+DTA  
Sbjct: 1   MSTKATLKAST---DTVTLNTGAKIPLFGLGTWQSTDDDASSAVAAALKHGYKHIDTASF 57

Query: 61  YGNEHEVGQGIQKWLEEDPEHNKRQDVFYTTKLWNSQNGYSNAKRAIKECMEKVSPLGYI 120
           Y NE  VG+ +++          R+++F TTK+WN Q    +   A+   ++K+    Y+
Sbjct: 58  YKNEELVGKAVKE------SGIPREELFITTKVWNDQQ--RDPAGALDLSLKKLG-TEYV 108

Query: 121 DLLLIHSPL-------------------SGTRRR------LETYKAMQEAVDEGIVRSIG 155
           DLLL+H P+                    G   R      ++T+  MQ+ +  G V++IG
Sbjct: 109 DLLLMHWPVPFKEPENSTLDAYKVPRGPDGKVTRDEEWDFVKTWHLMQKLLGTGKVKAIG 168

Query: 156 VSNYGKHHIDELLTWKELKHKPVVNQIEISPWIMRQDLADYCKSKGLVVEAFSPL--THG 213
           VSN+  ++++ELL  +     P VNQ+E+   + + +L +YC+ KG+VVEA+SPL  +  
Sbjct: 169 VSNFSINNLEELLNAEGTTVVPAVNQVELHIRLPQLELVEYCQKKGIVVEAYSPLGSSSA 228

Query: 214 YKLKHPDVLLVAKETGTDAGRVLIRWSLQHGYVPLPKSRSVERLKGNVKAYDFELSPEQV 273
             LK   V  VA++ G     VL+ +    G V LPKS    R+  N +   F++  E +
Sbjct: 229 PLLKDATVNKVAEKYGVTPAHVLLNYVANRGIVVLPKSVKESRIISNFEY--FKMDEEDI 286

Query: 274 SFLD 277
             L+
Sbjct: 287 KLLN 290

>Kwal_55.21426
          Length = 308

 Score =  124 bits (310), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 78/287 (27%), Positives = 150/287 (52%), Gaps = 39/287 (13%)

Query: 7   IMSKTTVPKAYKLSSGYILPSIGLGTYDIPRAETSEVVYQALKSGYRHLDTAVLYGNEHE 66
           I+ K T      L++G  +P +GLGT+ + +    + +  ALK+GYRH+D+A +  NE  
Sbjct: 4   ILKKCTA--TATLNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQV 61

Query: 67  VGQGIQKWLEEDPEHNKRQDVFYTTKLWNSQNGYSNAKRAIKECMEKVSPLGYIDLLLIH 126
           +G+ I+          +R ++F TTKLW++Q  + +   A+ + ++++  L Y+DL ++H
Sbjct: 62  IGKAIRD------SGVRRDELFVTTKLWSTQ--HRDPSAALDQSLKRLG-LEYVDLYMMH 112

Query: 127 SPLSGTRRRLE-------------------------TYKAMQEAVDEGIVRSIGVSNYGK 161
            PL+    +++                         T++ MQ+   E   R+IGV+N+  
Sbjct: 113 WPLAFRVDQIKAKNFMLIPRNSEGKPYVDTDWDYVKTWELMQKLPTEK-TRAIGVANFSV 171

Query: 162 HHIDELLTWKELKHKPVVNQIEISPWIMRQDLADYCKSKGLVVEAFSPL--THGYKLKHP 219
             +  LL     K  P  +Q+E  P++   ++  +C+ KG+++EA+SPL    G  +  P
Sbjct: 172 PQLTSLLKSPNNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEP 231

Query: 220 DVLLVAKETGTDAGRVLIRWSLQHGYVPLPKSRSVERLKGNVKAYDF 266
            +  ++K+   +  ++LI W L+ G   LPKS++  R++ N++ +D 
Sbjct: 232 VIREISKKLHVEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFDL 278

>YBR149W (ARA1) [334] chr2 (539943..540977) Subunit of
           NADP+-dependent D-arabinose dehydrogenase [1035 bp, 344
           aa]
          Length = 344

 Score =  122 bits (306), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 94/310 (30%), Positives = 160/310 (51%), Gaps = 53/310 (17%)

Query: 17  YKLSSGYILPSIGLGTYDIPR---AETSEVVYQALKSGYRHLDTAVLYGNEHEVGQGIQK 73
           + L++G  +P++GLGT + P    AET + V  A+K+GYRH+DTA  Y  E  VG+ I++
Sbjct: 25  FSLNNGVRIPALGLGTAN-PHEKLAETKQAVKAAIKAGYRHIDTAWAYETEPFVGEAIKE 83

Query: 74  WLEEDPEHNKRQDVFYTTKLWNSQNGYSNAKRAIKECMEKVSPLGYIDLLLIHSPLSGTR 133
            LE+     KR+D+F TTK+W     +    R++ E ++ +  L Y+DLLL H PL   +
Sbjct: 84  LLEDG--SIKREDLFITTKVWPVL--WDEVDRSLNESLKALG-LEYVDLLLQHWPLCFEK 138

Query: 134 RR---------------------------LETYKAMQEAV---DEGIVRSIGVSNYGKHH 163
            +                           LETYK +++     ++  VR+IGVSN+   +
Sbjct: 139 IKDPKGISGLVKTPVDDSGKTMYAADGDYLETYKQLEKIYLDPNDHRVRAIGVSNFSIEY 198

Query: 164 IDELLTWKELKHKPVVNQIEISPWIMRQDLADYCKSKGLVVEAFSPL-THGY-KLKHPDV 221
           ++ L+  KE + KP VNQ+E  P + + +L  +C    +++ A+SPL +HG   LK P V
Sbjct: 199 LERLI--KECRVKPTVNQVETHPHLPQMELRKFCFMHDILLTAYSPLGSHGAPNLKIPLV 256

Query: 222 LLVAKETGTDAGRVLIRWSLQHGYVPLPKSRSVERLKGNVKAYDFELSPEQ--------- 272
             +A++       +LI + ++ G + +P+S +  R+  +++         Q         
Sbjct: 257 KKLAEKYNVTGNDLLISYHIRQGTIVIPRSLNPVRISSSIEFASLTKDELQELNDFGEKY 316

Query: 273 -VSFLDQPQA 281
            V F+D+P A
Sbjct: 317 PVRFIDEPFA 326

>Scas_319.1
          Length = 195

 Score =  117 bits (294), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 70/196 (35%), Positives = 107/196 (54%), Gaps = 31/196 (15%)

Query: 7   IMSKTTVPKAYKLSSGYILPSIGLGTYDIPRAETSEVVYQALKSGYRHLDTAVLYGNEHE 66
           I+S + + K   L++G  +P IGLG + IP    +  VY+A+K GYR  D A  YGNE E
Sbjct: 2   IVSMSALSKTVTLNNGLEMPLIGLGCWKIPNDVCASQVYEAIKLGYRLFDGAQDYGNEKE 61

Query: 67  VGQGIQKWLEEDPEHNKRQDVFYTTKLWNSQNGYSNAKRAIKECMEKVSPLGYIDLLLIH 126
           VGQGI+K + E     KR+D+F  +KLWNS +   N K A+K+ ++ +  L Y+DL  IH
Sbjct: 62  VGQGIKKAIAEGIV--KREDLFVVSKLWNSFHHPDNVKLALKKTLDDIG-LDYLDLFYIH 118

Query: 127 SPL----------------SGTRRR------------LETYKAMQEAVDEGIVRSIGVSN 158
            PL                +G                ++TY+A+++ VDEG+++SIG+SN
Sbjct: 119 FPLAFKFVPFEEKYPPGFYTGAEDEKNGVISQEDVPLIDTYRALEKCVDEGLIKSIGISN 178

Query: 159 YGKHHIDELLTWKELK 174
           +    + +LL    +K
Sbjct: 179 FNGSLVQDLLRGARIK 194

>Scas_518.4
          Length = 338

 Score =  111 bits (277), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 86/294 (29%), Positives = 152/294 (51%), Gaps = 43/294 (14%)

Query: 17  YKLSSGYILPSIGLGTYDIPRA---ETSEVVYQALKSGYRHLDTAVLYGNEHEVGQGIQK 73
           + L++G  +P+IGLGT   P+    ET + V  A+++GYR +DTA  Y  E  +G+ +++
Sbjct: 11  FNLNNGGRIPAIGLGTAS-PKGRYPETKKAVKAAIRAGYRQIDTAWYYKTEPYIGEALKE 69

Query: 74  WLEEDPEHNKRQDVFYTTKLWNSQNGYSNAKRAIKECMEKVSPLGYIDLLLIHSPL---- 129
              +     KR+D+F TTK+W     + +   +I E ++ +  + Y+D++L H PL    
Sbjct: 70  LFRDG--EIKREDLFITTKVWPCY--WDDPSTSINESLKSLG-IDYVDMVLQHWPLCYKK 124

Query: 130 ----SGT-----------------RRRLETYKAMQEAV---DEGIVRSIGVSNYGKHHID 165
               +GT                    + TY+ M++      +  VR+IGVSNY   +++
Sbjct: 125 TYDENGTIIGKPLDKDGKVIFAEGADWITTYQLMEKIYLDPKDTRVRAIGVSNYPIEYLE 184

Query: 166 ELLTWKELKHKPVVNQIEISPWIMRQDLADYCKSKGLVVEAFSPLTHGY--KLKHPDVLL 223
            ++  KE K  PV+NQ+E+ P + + +L D+C   G+++ A+SPL  G     K P V  
Sbjct: 185 RVI--KECKVTPVINQVELHPHLPQLELNDFCHKNGILLTAYSPLGSGGAPNTKIPLVQE 242

Query: 224 VAKETGTDAGRVLIRWSLQHGYVPLPKSRSVERLKGNVKAYDFELSPEQVSFLD 277
            AK+       +L  + ++ G V +P+S + ER+  N+  Y   L+  ++  LD
Sbjct: 243 YAKKHEVAPADILTSYHVRKGNVVIPRSLNPERVASNI--YFAPLTKNEMKSLD 294

>Kwal_33.13274
          Length = 108

 Score =  104 bits (260), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 48/98 (48%), Positives = 71/98 (72%), Gaps = 2/98 (2%)

Query: 17  YKLSSGYILPSIGLGTYDIPRAETSEVVYQALKSGYRHLDTAVLYGNEHEVGQGIQKWLE 76
           YKL++G  +P IG G Y+IP+ +T++ VY ALK GYRH+DTAVLY N+ E  QG++K+L+
Sbjct: 13  YKLNNGQQIPVIGFGVYEIPKEDTADRVYSALKDGYRHIDTAVLYRNQKEAAQGVRKYLD 72

Query: 77  EDPEHNKRQDVFYTTKLWNSQNGYSNAKRAIKECMEKV 114
           E  E   R+++++TTKLW+SQ G    K+A++E    V
Sbjct: 73  ETGE--ARENIWFTTKLWDSQFGREETKKALQEVAADV 108

>KLLA0F02728g 249240..250232 similar to sp|P38115 Saccharomyces
           cerevisiae YBR149w ARA1 D-arabinose dehydrogenase, large
           subunit, start by similarity
          Length = 330

 Score =  110 bits (274), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 81/296 (27%), Positives = 152/296 (51%), Gaps = 43/296 (14%)

Query: 17  YKLSSGYILPSIGLGTYDIPR--AETSEVVYQALKSGYRHLDTAVLYGNEHEVGQGIQKW 74
           +  ++G  +P+ GLGT       AET + V  A+K+GYRH+DTA  YG E  VG+ +Q+ 
Sbjct: 11  FTFNNGNKVPAFGLGTAAQHERVAETKQAVKAAIKAGYRHIDTAWAYGVEEYVGEALQEL 70

Query: 75  LEEDPEHNKRQDVFYTTKLWNSQNGYSNAKRAIKECMEKVSPLGYIDLLLIHSPLSGTRR 134
            EE     KR+D+  T+K+W++   +++  +++ E + ++  + Y+DL L H PL   + 
Sbjct: 71  FEE--RVVKREDLHITSKVWHTM--WNDVDKSLNESLARLK-VDYVDLFLQHWPLCTQKV 125

Query: 135 R---------------------------LETYKAMQEAV---DEGIVRSIGVSNYGKHHI 164
                                       +ETYK +++     ++  VR+IGVSN+   ++
Sbjct: 126 PDPHGVDKIAKEPVDDQGNPLYDEKGDWIETYKQIEKIYLDKNDKRVRAIGVSNFPIEYL 185

Query: 165 DELLTWKELKHKPVVNQIEISPWIMRQDLADYCKSKGLVVEAFSPL--THGYKLKHPDVL 222
             +L  KE +  P  NQ+E+ P + +++L ++C    ++V A+SPL       L+ P + 
Sbjct: 186 KRVL--KECRTVPACNQVELHPHLPQRELCEFCSEHKILVTAYSPLGGNGAPLLELPILK 243

Query: 223 LVAKETGTDAGRVLIRWSLQHGYVPLPKSRSVERLKGNVKAYDFELSPEQVSFLDQ 278
            + ++       +L  + L+ G + +P+S +  R+  N++     LS E V+ L++
Sbjct: 244 GLCEKYNASPNDILTSYHLRQGTIVIPRSLNSTRIASNLEF--VPLSEEDVNKLNE 297

>Sklu_2324.3 , Contig c2324 5024-5971 reverse complement
          Length = 315

 Score =  108 bits (271), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 88/287 (30%), Positives = 142/287 (49%), Gaps = 29/287 (10%)

Query: 8   MSKTTVPKAYKLSSGYILPSIGLGT---YDIPRAE----------TSEVVYQALKSGYRH 54
           M  T +P      SG +LPSIG G+   + I ++            ++ V  A++ G+ H
Sbjct: 1   MDMTNIPGITLKGSGDLLPSIGFGSGTKWRIAKSSGKTKGVYIDALADQVTNAIQCGFNH 60

Query: 55  LDTAVLYGNEHEVGQGIQKWLEEDPEHNKRQDVFYTTKLWNSQNGYSNAKRAIKECMEKV 114
           +DTA  Y    EVG GI     + P         YT   W  + G S    ++   ++++
Sbjct: 61  IDTAEAYKTYKEVGTGISN--AQVPRETLWITDKYTPWSWEWRKG-SGPLESLTLSLKEM 117

Query: 115 SPLGYIDLLLIHSPLSGTRRR----LETYKAMQEAVDEGIVRSIGVSNYGKHHIDELLTW 170
           + L Y+DL +IH P   T+       E +  M+E     + R+IGVSN+    ++ + ++
Sbjct: 118 N-LDYVDLYMIHVPNITTKTAGIDLKEAWLQMEEIYTRKMARNIGVSNFDVESLEYIKSF 176

Query: 171 KELKHKPVVNQIEISPWIMRQD--LADYCKSKGLVVEAFSPLTHGYKLKHP--DVLL--V 224
              K++PVVNQIE S ++ +Q   +  YC+   +VVE +SPL    K K    D +L  +
Sbjct: 177 A--KYQPVVNQIEFSAYMQQQSPGILKYCRENNIVVEGYSPLVPLTKGKPGPLDEILPGI 234

Query: 225 AKETGTDAGRVLIRWSLQHGYVPLPKSRSVERLKGNVKAYDFELSPE 271
           A + G    +VL+RW  Q+G V +  +   ERL  ++  +DFELS E
Sbjct: 235 AAKYGKSQLQVLLRWVTQNGIVVITTTGKKERLNESLNIFDFELSKE 281

>Kwal_47.19278
          Length = 314

 Score =  100 bits (250), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 84/293 (28%), Positives = 144/293 (49%), Gaps = 47/293 (16%)

Query: 11  TTVPKAYKLSSGYILPSIGLGT---YDIPRA----------ETSEVVYQALKSGYRHLDT 57
           + +P      SG  +P IG G+   + I +A          E ++ V  A+ +G+ H+D 
Sbjct: 3   SKIPTLRLKGSGDEIPIIGFGSGTKWRIAKASGEKKDQFITELADQVTSAINAGFNHIDA 62

Query: 58  AVLYGNEHEVGQGIQK--------WLEEDPEHNKRQDVFYTTKLWNSQNGYSNAKRAIKE 109
           A  Y    EVG+G++         W+ +           YT   W+ + G +    ++  
Sbjct: 63  AEAYKTHPEVGRGVKNSGVPRDKLWITDK----------YTPWSWDWRKG-TGPLESLSL 111

Query: 110 CMEKVSPLGYIDLLLIHSPL-----SGTRRRLETYKAMQEAVDEGIVRSIGVSNYGKHHI 164
            +EK+  + Y+DL L+H P      +G   + E ++ M+E  D G+ ++IGVSN+    +
Sbjct: 112 SLEKMQ-MSYVDLYLLHVPFITVQTAGIDLK-EAWRQMEEIYDRGLAKNIGVSNFDVESL 169

Query: 165 DELLTWKELKHKPVVNQIEISPWIMRQD--LADYCKSKGLVVEAFSPLTHGYKLKHP--D 220
           + +   K  K+ PVVNQIE + ++ +Q   +  YCK   +VVE +SPL    K +    D
Sbjct: 170 EYIT--KIGKYLPVVNQIEFNAYLQQQSPGIIAYCKDHDIVVEGYSPLVPLTKGRPGPLD 227

Query: 221 VLL--VAKETGTDAGRVLIRWSLQHGYVPLPKSRSVERLKGNVKAYDFELSPE 271
            LL  +A++      ++L+RW  Q+G V +  S    R+K +V  +DFEL+ E
Sbjct: 228 KLLPALAEKYHKSELQILLRWVTQNGVVVITTSAQQARVKESVNIFDFELTAE 280

>KLLA0F05775g 560270..561199 similar to sgd|S0002282 Saccharomyces
           cerevisiae YDL124w, start by similarity
          Length = 309

 Score = 98.6 bits (244), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 78/294 (26%), Positives = 142/294 (48%), Gaps = 38/294 (12%)

Query: 12  TVPKAYKLSSGYILPSI---GLGTYDIPRAETSEVVYQALKS----------GYRHLDTA 58
           T  K + LS+G  +P++   G GT      ET     Q L            G  H+D A
Sbjct: 2   TTQKFFTLSNGNKIPAVAIVGTGTAWYKSEETDATFSQPLVDIVKKTLDTVPGVVHIDAA 61

Query: 59  VLYGNEHEVGQGIQKWLEEDPEHNKRQDVFYTTKLWNSQNGYSNAKRAIKECMEKVSPLG 118
            +Y    E+G  ++           R ++F T K    +    N K A++  ++K+  + 
Sbjct: 62  EIYRTYPELGAALKD------TKKPRDEIFITDKYSTLKQLSENPKVALETSLKKLG-VD 114

Query: 119 YIDLLLIHSPL-SGTRRRLE-TYKAMQEAVDEGIVRSIGVSNYGKHHIDELLTWKELKHK 176
           Y+DL L+HSP+   ++  +E  +K ++E    G  ++IGVSN+    +++LL   E+K  
Sbjct: 115 YVDLYLLHSPIIKESKLDVEANWKYLEELYKSGKAKNIGVSNFAVKDLEKLLAVAEVK-- 172

Query: 177 PVVNQIEISPWIMRQD--LADYCKSKGLVVEAFSPLTHGYKLKHPD----------VLLV 224
           P VNQIE SP++  Q   + ++ +  G+++EA+SPL  G   + P+          +  +
Sbjct: 173 PQVNQIEFSPFLQNQTPGIVEFSQKNGILLEAYSPL--GPLQRRPEDADKLPFYQYIAEL 230

Query: 225 AKETGTDAGRVLIRWSLQHGYVPLPKSRSVERLKGNVKAYDFELSPEQVSFLDQ 278
           +K+      ++L+ W  + G +P+  S  +ER++     + F L+ E+V  + Q
Sbjct: 231 SKKYNKSEAQILLSWVYERGILPVTTSSKIERIQQAQDIFSFSLANEEVQKITQ 284

>CAGL0J09394g 923715..924650 similar to tr|Q07551 Saccharomyces
           cerevisiae YDL124w, start by similarity
          Length = 311

 Score = 95.9 bits (237), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 80/286 (27%), Positives = 131/286 (45%), Gaps = 39/286 (13%)

Query: 17  YKLSSGYILPSI---GLGTYDIPRAETSEVVYQALKS---------GYRHLDTAVLYGNE 64
           +KL++G+ +P +   G GT      ET E   Q L           G  HLD A  Y   
Sbjct: 7   FKLNNGHEMPGVAIVGTGTKWHKVNETDENFSQTLVDQLKYALSLPGVVHLDAAEFYMTY 66

Query: 65  HEVGQGIQKWLEEDPEHNKRQDVFYTTKLWNSQNGYSNAKRAIKECMEKVSPLGYIDLLL 124
            EVG+ + +          R ++F T K W       N    ++  ++++  L Y+DL L
Sbjct: 67  REVGRALAE------TSKPRDEIFITDKYWTLSKVTENPIVGLETGLKRLG-LEYVDLYL 119

Query: 125 IHSPLSGTRRR----LETYKAMQEAVDEGIVRSIGVSNYGKHHIDELLTWKELKHKPVVN 180
           +HSP            E +  M+E    G  ++IGVSN+ K  ++ +L  K  K KP VN
Sbjct: 120 LHSPFISKETNGFSLEEAWGMMEELYHSGKAKNIGVSNFAKEDLERVL--KVCKVKPQVN 177

Query: 181 QIEISPWIMRQD--LADYCKSKGLVVEAFSPLTHGYKLKHPD----------VLLVAKET 228
           QIE + ++  Q   + ++CK   + + A+SPL  G   K P           +  +A+  
Sbjct: 178 QIEFNAFLQNQTPGIYNFCKQNDIQLAAYSPL--GPLQKKPADGNSQPFYSYINKLAQHY 235

Query: 229 GTDAGRVLIRWSLQHGYVPLPKSRSVERLKGNVKAYDFELSPEQVS 274
               G+VL+RW  + G V +  S   ER+K   + ++F+L  ++V+
Sbjct: 236 NKTPGQVLLRWVTKRGVVAVTTSEKKERIKQAQEIFEFDLKDDEVT 281

>YDL124W (YDL124W) [746] chr4 (240259..241197) NAD(P)H-dependent
           reductase, has similarity to putative aldose reductases
           [939 bp, 312 aa]
          Length = 312

 Score = 88.6 bits (218), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 77/283 (27%), Positives = 130/283 (45%), Gaps = 35/283 (12%)

Query: 17  YKLSSGYILPSI---GLGTYDIPRAETS---------EVVYQALKSGYRHLDTAVLYGNE 64
           + L++G  +P+I   G GT      ET          ++VY     G  H+D A +Y   
Sbjct: 8   FTLNNGNKIPAIAIIGTGTRWYKNEETDATFSNSLVEQIVYALKLPGIIHIDAAEIYRTY 67

Query: 65  HEVGQGIQKWLEEDPEHNKRQDVFYTTKLWNSQNGYSNAKRAIKECMEKVSPLGYIDLLL 124
            EVG+ +   L E P    R  +F T K ++ Q   S++     +   K     Y+DL L
Sbjct: 68  PEVGKALS--LTEKP----RNAIFLTDK-YSPQIKMSDSPADGLDLALKKMGTDYVDLYL 120

Query: 125 IHSPLSGTRRR----LETYKAMQEAVDEGIVRSIGVSNYGKHHIDELLTWKELKHKPVVN 180
           +HSP            E +K M++    G  ++IGVSN+    +  +L   E+K  P VN
Sbjct: 121 LHSPFVSKEVNGLSLEEAWKDMEQLYKSGKAKNIGVSNFAVEDLQRILKVAEVK--PQVN 178

Query: 181 QIEISPWIMRQD--LADYCKSKGLVVEAFSPLTHGYKLKHPD--------VLLVAKETGT 230
           QIE SP++  Q   +  +C+   ++VEA+SPL    K    D        V  ++++   
Sbjct: 179 QIEFSPFLQNQTPGIYKFCQEHDILVEAYSPLGPLQKKTAQDDSQPFFEYVKELSEKYIK 238

Query: 231 DAGRVLIRWSLQHGYVPLPKSRSVERLKGNVKAYDFELSPEQV 273
              ++++RW  + G +P+  S   +R+      + F+L+ E+V
Sbjct: 239 SEAQIILRWVTKRGVLPVTTSSKPQRISDAQNLFSFDLTAEEV 281

>Scas_704.9
          Length = 309

 Score = 85.9 bits (211), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 71/280 (25%), Positives = 127/280 (45%), Gaps = 32/280 (11%)

Query: 17  YKLSSGYILPSI---GLGTYDIPRAETSEVVYQALKS---------GYRHLDTAVLYGNE 64
           + L++G  +P+I   G GT      ET     Q L           G  H+D A +Y   
Sbjct: 8   FTLNNGNKIPAIAVIGTGTRWFKTEETDATFSQQLVDELKVALTLPGIVHIDAAEIYRTY 67

Query: 65  HEVGQGIQKWLEEDPEHNKRQDVFYTTKLWNSQNGYSNAKRAIKECMEKVSPLGYIDLLL 124
            EV   ++       E N+ +D  + T  +++Q   S+   A      K   L Y+DL L
Sbjct: 68  PEVAAALR-------ESNRPRDEIFITDKYSTQLKLSDDPIAGLNISLKTLGLDYVDLYL 120

Query: 125 IHSPLSGTRRRLE-TYKAMQEAVDEGIVRSIGVSNYGKHHIDELLTWKELKHKPVVNQIE 183
           +HSP       LE  +K M++    G  ++IGVSN+    ++++L    +K  P +NQIE
Sbjct: 121 LHSPFIKNGSTLEECWKQMEKLYKSGKAKNIGVSNFRVEDLEKILKIATIK--PQINQIE 178

Query: 184 ISPWIMRQD--LADYCKSKGLVVEAFSPLTHGYKLKH-PD-------VLLVAKETGTDAG 233
            +  +  Q   +  +CK   + +EA++PL    +++  P+       +  ++K+      
Sbjct: 179 FNAALQNQSPGIVKFCKENNIQLEAYTPLGPFQRIQDTPEAKPFYDYIAELSKKYNKTEA 238

Query: 234 RVLIRWSLQHGYVPLPKSRSVERLKGNVKAYDFELSPEQV 273
           ++L+RW  + G +P+  S   +RL      + F+L   +V
Sbjct: 239 QILLRWVTKRGILPVTTSSKPQRLHDAQNLFSFDLESSEV 278

>Sklu_2438.12 YDL124W, Contig c2438 25491-26429 reverse complement
          Length = 312

 Score = 82.0 bits (201), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 75/285 (26%), Positives = 132/285 (46%), Gaps = 39/285 (13%)

Query: 17  YKLSSGYILPS---IGLGTYDIPRAETS---------EVVYQALKSGYRHLDTAVLYGNE 64
           + L++G  +P+   IG GT      E +         +V Y     G  H+D A +Y   
Sbjct: 8   FTLNNGNKIPAVAVIGTGTKWFKTEENASKFSDELVDQVKYALTLPGVVHIDAAEIYRTY 67

Query: 65  HEVGQGIQKWLEEDPEHNKRQDVFYTTKLWNSQNGYSNAKRAIKECMEKVSPLGYIDLLL 124
            E+G+ +++   + P +       Y+T L  S N     +  +KE       + YIDL L
Sbjct: 68  PELGKALRE--TKKPRNEIWITDKYSTSLKLSDNPIVGFENGLKEL-----GVDYIDLYL 120

Query: 125 IHSPLSGTRRR----LETYKAMQEAVDEGIVRSIGVSNYGKHHIDELLTWKELKHKPVVN 180
           +HSP     R      + +K ++E    G  ++IGVSN+ K  ++ +L   E+  KP VN
Sbjct: 121 LHSPFITEGRNGFTLEQAWKYLEELYKSGKAKNIGVSNFAKEDLERILKIAEI--KPQVN 178

Query: 181 QIEISPWIMRQD--LADYCKSKGLVVEAFSPLTHGYKLKHPD----------VLLVAKET 228
           QIE S ++  Q   + ++ K   +++EA+SPL  G   + P+          +  +A++ 
Sbjct: 179 QIEYSAFLQNQTPGIYNFAKENDILLEAYSPL--GPLQRRPEEADSLPFYKYINELAEKY 236

Query: 229 GTDAGRVLIRWSLQHGYVPLPKSRSVERLKGNVKAYDFELSPEQV 273
           G    +VL+RW  + G +P+  S    R+      + F+L+  +V
Sbjct: 237 GKSEAQVLLRWVSKRGVLPVTTSSKPHRVHDAQHIFTFDLTSTEV 281

>KLLA0B05291g 478251..478634 some similarities with sp|Q12458
           Saccharomyces cerevisiae YDR368w YPR1, hypothetical
           start
          Length = 127

 Score = 50.8 bits (120), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 42/70 (60%), Gaps = 9/70 (12%)

Query: 60  LYGNEHEVGQGIQKWLEEDPEHNKRQDVFYTTKLWNSQNGYSNAKRAIKECMEKVSPLGY 119
           +YGNE  VG+GI+           R+++F TTKLWN+Q    +   A+ E +E++  L Y
Sbjct: 1   MYGNETAVGKGIRD------SGIPREEIFVTTKLWNTQQ--RDPASALNESLERLG-LDY 51

Query: 120 IDLLLIHSPL 129
           +DL LIH P+
Sbjct: 52  VDLFLIHWPV 61

>Sklu_2405.1 YPL088W, Contig c2405 371-1399 reverse complement
          Length = 342

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 87/342 (25%), Positives = 139/342 (40%), Gaps = 75/342 (21%)

Query: 12  TVPKAYKL-SSGYILPSIGLGTYDIPRA-------ETSEVVYQALK----SGYRHLDTAV 59
           T+PK  +L SSG  +  I +G              +  E +++ LK    +G R  DTA 
Sbjct: 2   TLPKPVRLGSSGLKISPIIVGCMSYGSKAWAPWVLDNEEEIFKVLKHCYDNGLRTFDTAD 61

Query: 60  LYGN---EHEVGQGIQKW----------------LEE--DPEHNKRQDVFYTTKLWNSQN 98
            Y N   E  VG+ ++++                ++E  D  H+K  D      + N Q 
Sbjct: 62  FYSNGLSERLVGKFLKRYNINRETVVILTKVFFPVDETLDLSHSKGMDEATQLTVAN-QR 120

Query: 99  GYSNAKRAIKECMEKVSPLG-YIDLLLIHSPLSGTRRRLETYKAMQEAVDEGIVRSIGVS 157
           G S  K  +    + V  LG YID+L IH   + T    ET KA+ + V +G  R IG S
Sbjct: 121 GLSR-KHILDGVAKSVERLGTYIDVLQIHRFDTETPVN-ETMKALNDVVSKGYARYIGAS 178

Query: 158 NYGKHHIDELLTWKELKHK--PVVNQIEISPWIMRQD---LADYCKSKGLVVEAFSPLTH 212
           +       EL    E KH     ++       + R+D   L  + K   + +  +SP   
Sbjct: 179 SMLATQFAELQFVAE-KHDWFKFISSQSCYNLLYREDERELIPFAKRHHIGLIPWSPNAR 237

Query: 213 G----------------YKLK---------HPDVLL-----VAKETGTDAGRVLIRWSLQ 242
           G                + LK         H + ++     +A++ G     V I W L 
Sbjct: 238 GVLTRPLGTQTLRHSTDFGLKRISAFDLQPHEEEIVRRVGEIAEKRGVTMAVVSIAWVLS 297

Query: 243 HGYVPLPKSRSVERLKGNVKAYDFELSPEQVSFLDQPQAYEP 284
            G  P+    S ER+   +KA +F+L+ E+ ++L++P  Y P
Sbjct: 298 KGCYPIVGLSSTERVDETIKAVEFKLTEEEATYLEEP--YRP 337

>Sklu_2082.3 , Contig c2082 6775-7791
          Length = 338

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 87/341 (25%), Positives = 134/341 (39%), Gaps = 74/341 (21%)

Query: 12  TVPKAYKLS-SGYILPSI--GLGTYDIPR-----AETSEVVYQALK----SGYRHLDTAV 59
           T+PK   L  SG  + SI  G  +Y   +      E  E +++ LK    +G R  DTA 
Sbjct: 2   TLPKQVNLGPSGLKISSIIVGCTSYGSKKWTPWVIEDKEEIFKILKHCYDNGLRTFDTAD 61

Query: 60  LYGN---EHEVGQGIQKW--------------LEEDPEHNKRQDVFY----TTKLWNSQN 98
           +Y N   E  +G+ ++++                 D          Y     T L  +  
Sbjct: 62  VYSNGLSERLLGEFLKRYKINRETVVILSKVRFPVDESLELPLSTIYGTDEVTALTLANQ 121

Query: 99  GYSNAKRAIKECMEKVSPLG-YIDLLLIH-----SPLSGTRRRLETYKAMQEAVDEGIVR 152
           G  + K  +    + V  LG YID+L IH     +P+       ET KA+ + V++G  R
Sbjct: 122 GGLSRKHIMDGVAKSVERLGTYIDVLQIHRFDHETPME------ETMKALNDVVEKGYTR 175

Query: 153 SIGVSNYGKHHIDELL------TW-KELKHKPVVNQI------EISPWIMRQDLADYC-- 197
            IG S+       EL       +W K +  +   N +      E+ P+  R  +      
Sbjct: 176 YIGASSMLATEFAELQFVAEKHSWFKFISSQSCYNLLYREDERELIPFAKRHRIGLIPWS 235

Query: 198 -KSKGLVVEAFSPLTHGYKLKH------PD-------VLLVAKETGTDAGRVLIRWSLQH 243
             S+GL+       T  Y+         PD       V  VAK+  T    V   W L  
Sbjct: 236 PNSRGLLTRPLGLTTARYEADSRLHNIAPDEQEIIRRVEEVAKKRDTTMAIVSTAWVLSK 295

Query: 244 GYVPLPKSRSVERLKGNVKAYDFELSPEQVSFLDQPQAYEP 284
           G  P+    S ER+   +KA DFEL+ E+  +L++P   +P
Sbjct: 296 GCYPIVGLSSTERVDEALKAIDFELTEEESKYLEEPYKPKP 336

>Scas_568.7
          Length = 343

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 73/312 (23%), Positives = 120/312 (38%), Gaps = 76/312 (24%)

Query: 39  ETSEVVYQALK----SGYRHLDTAVLYGN---EHEVGQGIQKWLEEDPEHNKRQDVFYTT 91
           E  E +++ LK    +G R  DTA +Y N   E  +G+ ++++      + KR+ V   +
Sbjct: 37  EDKEEIFKILKHCYDNGLRTFDTADVYSNGTSERILGEFLKRF------NIKRETVVIMS 90

Query: 92  KLW------------------------NSQNGYSNAKRAIKECMEKVSPLG-YIDLLLIH 126
           K++                        + Q G  N K  +      V  LG YID+L IH
Sbjct: 91  KIFFPVDESLDLHQGSKVDQEYIDLQLSFQQGL-NRKHIMAGVANSVERLGTYIDILQIH 149

Query: 127 SPLSGTRRRLETYKAMQEAVDEGIVRSIGVSNYGKHHIDEL-LTWKELKHKPVVNQIEIS 185
             L       E  +++ + V  G VR IG S+       EL    K+      +N     
Sbjct: 150 R-LDKEASMEEIMRSLNDVVVSGQVRYIGASSMLATEFAELQFIAKQNGWFQFINVQSYY 208

Query: 186 PWIMRQD---LADYCKSKGLVVEAFSPLTHGY------------------------KLKH 218
             + R+D   L  +CK  G+ +  +SP   G                         KL  
Sbjct: 209 NVLNREDENELIPFCKKHGVGLTVWSPNARGVLTRPADKTGTRMLSDPTFIKMGLDKLDE 268

Query: 219 PD------VLLVAKETGTDAGRVLIRWSLQHGYVPLPKSRSVERLKGNVKAYDFELSPEQ 272
            D      V  +AK+ G     V + W L  G   +    S+ER+   ++A D + + E+
Sbjct: 269 SDKEIIGVVEAIAKKKGISMAMVSMAWILNKGANAIAGLNSIERVDEAIRAIDVKFTVEE 328

Query: 273 VSFLDQPQAYEP 284
           +  L++P  Y+P
Sbjct: 329 LELLEKP--YKP 338

>Scas_664.5
          Length = 343

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 76/311 (24%), Positives = 118/311 (37%), Gaps = 74/311 (23%)

Query: 37  RAETSEVVYQALKSGYRHLDTAVLYGN---EHEVGQGIQKWLEEDPEHNKRQDVFYTTKL 93
           + E  +++      G R  DTA +Y N   E  VG+ ++K+      + KR+ V   TK+
Sbjct: 39  KDEIFKILKHCYDRGLRTFDTADVYSNGISERLVGEFLKKY------NIKRETVVIMTKI 92

Query: 94  W------------------------NSQNGYSNAKRAIKECMEKVSPLG-YIDLLLIHSP 128
           +                          Q G S  K  I      V  LG YID+L IH  
Sbjct: 93  FFPVDESLDLHHGSNVNQEAMELQLTLQRGLSR-KHIIDGVANSVERLGTYIDVLQIHR- 150

Query: 129 LSGTRRRLETYKAMQEAVDEGIVRSIGVSNYGKHHIDEL--LTWKELKHKPVVNQIEISP 186
           L       E  +++ + V  G VR IG S+       EL  +  K    K +  Q     
Sbjct: 151 LDEETSMEEIMRSLNDVVMSGQVRYIGASSMLATEFAELQFIAEKNGWFKFISAQ-SYYN 209

Query: 187 WIMRQD---LADYCKSKGLVVEAFSPLTHGY-----------KLKHPD------------ 220
            I R+D   L  +CK  G+ +  +SP   G             L  P             
Sbjct: 210 LINREDERELIPFCKKHGVGLIPWSPNARGVLTRPVEKNTERMLTDPTFNRMRLNELGDD 269

Query: 221 -------VLLVAKETGTDAGRVLIRWSLQHGYVPLPKSRSVERLKGNVKAYDFELSPEQV 273
                  + +VA+        + + W+L  G  P+    SVER+   VKA +F L+ +++
Sbjct: 270 EKEIVRRIQMVAERRSVTMAIISMAWTLHKGCNPIVGLNSVERVDEAVKAIEFTLTEDEI 329

Query: 274 SFLDQPQAYEP 284
             L++P  Y+P
Sbjct: 330 KLLEEP--YKP 338

>Scas_687.3
          Length = 344

 Score = 46.6 bits (109), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 73/313 (23%), Positives = 121/313 (38%), Gaps = 78/313 (24%)

Query: 42  EVVYQALK----SGYRHLDTAVLYGN---EHEVGQGIQKWLEEDPEHNKRQDVFYTTKLW 94
           E V++ LK     G R  DTA +Y N   E  +G+ ++K+      + KR+ V   TK +
Sbjct: 41  EKVFEILKHCYDRGLRTFDTADVYSNGISERLLGEFLKKF------NIKRETVVILTKTF 94

Query: 95  ------------------------NSQNGYSNAKRAIKECMEKVSPLG-YIDLLLIHSPL 129
                                    +Q G S  K  ++     V  LG YID+L IH   
Sbjct: 95  FPVDESLSLALGEMSFSESDTLDLTNQRGLSR-KHILQSVKNSVERLGTYIDVLQIHR-F 152

Query: 130 SGTRRRLETYKAMQEAVDEGIVRSIGVSNYGKHHIDELLTWKELKHK--PVVNQIEISPW 187
             T    ET KA+ + V+ G VR IG S+       E+ +  + KH     VN       
Sbjct: 153 DPTTPIKETMKALNDVVESGDVRYIGASSMLPTQFVEMQSVAD-KHDWFQFVNVQSCYNL 211

Query: 188 IMRQD---LADYCKSKGLVVEAFSP---------------------LTHGYKLKH----- 218
           + R+D   L  YC+   + +  +SP                     + +G+ +K      
Sbjct: 212 LYREDERDLMQYCEKHNIALTPWSPNHQGLLTRPIGVESERSTTDKIINGWNMKDLKPSE 271

Query: 219 ----PDVLLVAKETGTDAGRVLIRWSLQHGYVPLPKSRSVERLKGNVKAYDFELSPEQVS 274
                 V  ++K+       +   W L  G  P+    S+ R+   + A D + + E+  
Sbjct: 272 IEIINRVEELSKKKNVSMAVISTAWVLSKGCAPIVGMSSISRVDEVITALDVKFTEEETK 331

Query: 275 FLDQPQAYEPTDW 287
            L++P  Y+P ++
Sbjct: 332 QLEEP--YKPRNF 342

>Scas_550.2
          Length = 344

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 70/314 (22%), Positives = 122/314 (38%), Gaps = 80/314 (25%)

Query: 42  EVVYQALK----SGYRHLDTAVLYGN---EHEVGQGIQKWLEEDPEHNKRQDVFYTTKLW 94
           E V+  LK     G R  DTA +Y N   E  +G+ ++K+      + +R+ V   TKL+
Sbjct: 41  EKVFTILKHCYDRGLRTFDTADVYSNGYSERLLGEFLKKY------NIRRETVVILTKLF 94

Query: 95  ------------------------NSQNGYS--NAKRAIKECMEKVSPLGYIDLLLIHSP 128
                                    +Q G S  +  +A+K  +E++    YID+L IH  
Sbjct: 95  APVDESLKFKFADPSTSENILLDLTNQQGLSRKHIMQAVKNSVERLGT--YIDVLQIHRF 152

Query: 129 LSGTRRRLETYKAMQEAVDEGIVRSIGVSNYGKHHIDELLTWKELKHK--PVVNQIEISP 186
              T  + ET K + + ++ G VR IG S+       E+    + KH     VN      
Sbjct: 153 DPNTPIK-ETMKGLNDVIEGGDVRYIGASSMLPTQFVEMQGIAD-KHDWFQFVNVQSCYN 210

Query: 187 WIMRQD---LADYCKSKGLVVEAFSP---------------------LTHGYKLKHPD-- 220
            + R+D   L  YCK   + +  +SP                       +  K+K  D  
Sbjct: 211 LVYREDERDLFQYCKKHNIALTPWSPNHQGLLTRPVGVESTRSSKDTFINATKMKEMDPA 270

Query: 221 -------VLLVAKETGTDAGRVLIRWSLQHGYVPLPKSRSVERLKGNVKAYDFELSPEQV 273
                  +  ++K+       +   W L     P+    S+ R+   + A D   + E++
Sbjct: 271 EVEIINRIEELSKKKNVPMAVLSTAWVLSKQCSPIVGMSSINRVDEAITALDVTFTEEEI 330

Query: 274 SFLDQPQAYEPTDW 287
            +L++P  Y+P ++
Sbjct: 331 KYLEEP--YKPKNF 342

>CAGL0E05214g complement(508038..509078) highly similar to tr|Q02895
           Saccharomyces cerevisiae YPL088w, start by similarity
          Length = 346

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 75/308 (24%), Positives = 119/308 (38%), Gaps = 76/308 (24%)

Query: 39  ETSEVVYQALKSGY----RHLDTAVLYGNEHEVGQGIQKWLEEDPE--HNKRQDVFYTTK 92
           E  E ++  LK  Y    R  DTA +Y N +      ++ L+E  E    KR+ V   TK
Sbjct: 40  EDKEKIFGILKHAYDRGLRTYDTADVYSNGYS-----ERLLKEFFEKYQIKRETVVIMTK 94

Query: 93  LW------------------------NSQNGYSNAK--RAIKECMEKVSPLGYIDLLLIH 126
           ++                         +Q G S       +K   E++    YID+L IH
Sbjct: 95  VFFGVDEDLNLHHGLKAYNDHDDLILTNQRGLSRKHILEGVKNSTERLGT--YIDVLQIH 152

Query: 127 SPLSGTRRRLETYKAMQEAVDEGIVRSIGVSNYGKHHIDELLTWKELKHK---------- 176
                T  + E  KA+ + V+ G  R IG S+       EL    E KH           
Sbjct: 153 RLDKETPMK-EIMKALNDVVEAGYARYIGSSSMLATEFAELQFIAE-KHNWFQFVSLQSF 210

Query: 177 -PVVN---QIEISPWIMRQDLADYC---KSKGLVVEAFSPLTHGYK----LKHPD----- 220
             ++N   + EI P+  R ++A       ++GL+    +  T   K     K+ D     
Sbjct: 211 YNLLNREDEREIIPFAKRHNIALIPWSPNARGLLTRPLNKTTDRIKSDPTFKYLDLDNLT 270

Query: 221 ---------VLLVAKETGTDAGRVLIRWSLQHGYVPLPKSRSVERLKGNVKAYDFELSPE 271
                    V  VAK+  T    +   W L  G  P+    S++R+   + + DFELS E
Sbjct: 271 EDQKEIINRVEEVAKKHNTSMAIISNSWVLSKGCNPIVGLNSIDRVDEAIASIDFELSDE 330

Query: 272 QVSFLDQP 279
            + ++++P
Sbjct: 331 DIKYIEEP 338

>Scas_524.1
          Length = 280

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 53/222 (23%), Positives = 95/222 (42%), Gaps = 39/222 (17%)

Query: 96  SQNGYSNAKRAIKECMEKVSPLG-YIDLLLIHSPLSGTRRRLETYKAMQEAVDEGIVRSI 154
           +Q G S  K  +      V  LG YID+L IH   + T    ET +A+ + V+ G VR +
Sbjct: 61  NQRGLSR-KHIMDGVARSVERLGTYIDVLQIHRFDAETPME-ETMRALNDVVELGQVRYL 118

Query: 155 GVS-----NYGKHHI-------DELLTWK---ELKHKPVVNQIEISPWIMRQDLA---DY 196
           G S      + ++          + + W+    L ++   ++ E+ P+  R ++A    Y
Sbjct: 119 GASRMLGTQFAEYQFVAQLNGWHQFINWQSQYNLLYRE--DEREVIPFAKRHNIALTPFY 176

Query: 197 CKSKGLVVEAFSPLTHGYKLKHPDVL-LVAK-------------ETGTDAGRVLIRWSLQ 242
             + GL+      ++   K   P V  L A+             E G    ++ + W L 
Sbjct: 177 PNAGGLLARPLGQVSARTKSDDPKVKKLTARDKEIINRVEQLSVEKGVSMAQISLAWLLH 236

Query: 243 HGYVPLPKSRSVERLKGNVKAYDFELSPEQVSFLDQPQAYEP 284
            G  P+    S++R + ++ A   +LS + + FL+  + YEP
Sbjct: 237 KGCYPIVGVNSIQRAQESIDALSLQLSEQDLLFLE--EMYEP 276

>CAGL0E05192g complement(506594..507631) highly similar to tr|Q02895
           Saccharomyces cerevisiae YPL088w, start by similarity
          Length = 345

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 71/306 (23%), Positives = 120/306 (39%), Gaps = 73/306 (23%)

Query: 39  ETSEVVYQALKSGY----RHLDTAVLYGNEHEVGQGIQKWLEEDPE--HNKRQDVFYTTK 92
           E  E ++  LK  Y    R  DTA +Y N +      ++ L+E  E    KR+ V   TK
Sbjct: 40  EDKEKIFGILKHAYDRGLRTYDTADVYSNGYS-----ERLLKEFFEKYQIKRETVVIMTK 94

Query: 93  LW-----------------------NSQNGYSNAK--RAIKECMEKVSPLGYIDLLLIHS 127
           ++                        +Q G S       +K   E++    YID+L IH 
Sbjct: 95  VFFGVDEDLNLQPGVKIDEQEDLVLTNQRGLSRKHILEGVKNSTERLGT--YIDVLQIHR 152

Query: 128 PLSGTRRRLETYKAMQEAVDEGIVRSIGVSNY------------GKHHIDELLTWKELKH 175
               T  + E  KA+ + V+ G  R IG S+              KH+  + ++ + L +
Sbjct: 153 LDKETPMK-EIMKALNDVVEAGYARYIGSSSMLATEFAELQFIAEKHNWFQFVSLQSLYN 211

Query: 176 KPVV-NQIEISPWIMRQDLADYC---KSKGLVVEAFSPLTH------GYKLKHPDVLL-- 223
             +  ++ EI P+  R ++A       ++GL+    +  T        +K    D L   
Sbjct: 212 LLIREDEREIIPFAKRHNIALIPWSPNARGLLTRPLNKTTDRIKSDPTFKYLELDKLTED 271

Query: 224 ----------VAKETGTDAGRVLIRWSLQHGYVPLPKSRSVERLKGNVKAYDFELSPEQV 273
                     VAK+  T    +   W L  G  P+    S++R+   + + DFEL  E +
Sbjct: 272 QKEIINRVEEVAKKHNTSMAIISNSWVLSKGCNPIVGLNSIDRVDEAIASIDFELPEEDI 331

Query: 274 SFLDQP 279
            +L++P
Sbjct: 332 KYLEEP 337

>Kwal_26.8377
          Length = 338

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 67/127 (52%), Gaps = 12/127 (9%)

Query: 40  TSEVVYQALKSGYRHLDTAVLYGNEHEV-GQGIQKWLEEDPEHNKRQDVFYTTKLWN--- 95
            SE++  A++ G R +DT+  YG+  ++ G+ ++   +E P    R++ F  TK+     
Sbjct: 45  VSEMLKYAVQHGIRAIDTSPYYGDSEKLFGKALESLKDEIP----RENYFICTKVGRIRL 100

Query: 96  SQNGYS--NAKRAIKECMEKVSPLGYIDLLLIHS-PLSGTRRRLETYKAMQEAVDEGIVR 152
            +  YS  + + ++    E++    Y+D++ +H      T + LE  K +++  DEG++ 
Sbjct: 101 DEFDYSREHVRSSVLRSCERLRT-DYLDVVFLHDVEFVETAQVLEALKELRKLKDEGVLH 159

Query: 153 SIGVSNY 159
           + G+S Y
Sbjct: 160 NFGISGY 166

>CAGL0E05236g complement(509478..510512) highly similar to tr|Q02895
           Saccharomyces cerevisiae YPL088w, start by similarity
          Length = 344

 Score = 41.2 bits (95), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 70/294 (23%), Positives = 117/294 (39%), Gaps = 61/294 (20%)

Query: 43  VVYQALKSGYRHLDTAVLYGN---EHEVGQGIQKW----------------LEEDPEHNK 83
           ++ +A   G R  DTA +Y N   E  + +  +K+                ++ED + + 
Sbjct: 47  ILKRAYDRGLRTYDTADMYSNGYSERLLKEFFEKYQIKRETVVIMSKVFYAVDEDLDLHH 106

Query: 84  RQDVFYTTKL-WNSQNGYSNAK--RAIKECMEKVSPLGYIDLLLIHSPLSGTRRRLETYK 140
             D+     L   +Q G S      A+K   E++    YID+L IH     T  + E  K
Sbjct: 107 GLDINEVEDLHLTNQRGLSRRHILEAVKNSTERLGT--YIDVLQIHRLDKETPMK-EIMK 163

Query: 141 AMQEAVDEGIVRSIGVSNYGKHHIDELLTWKELKHK-----------PVVN---QIEISP 186
           A+ + V+ G  R IG S+       EL    E KH             ++N   + EI P
Sbjct: 164 ALNDVVEAGYARYIGSSSMLATEFAELQFIAE-KHNWFQFVSLQSFYNLLNREDEREIIP 222

Query: 187 WIMRQDLADYC---KSKGLVVEAFSPLTH------GYKLKHPDVLL------------VA 225
           +  R ++A       ++GL+    S ++        +K+   D L             VA
Sbjct: 223 FAKRHNIALTPWSPNARGLLTRPVSKISVRIKSDPTFKIVGLDKLTEDQKEIINRVEEVA 282

Query: 226 KETGTDAGRVLIRWSLQHGYVPLPKSRSVERLKGNVKAYDFELSPEQVSFLDQP 279
           K+  T    +   W L  G  P+    S+ R+   + + DFEL  E + +L++P
Sbjct: 283 KKHNTSMAIISNSWVLSKGCNPIVGLNSIARVDEAIASIDFELPEEDIKYLEEP 336

>Scas_719.39
          Length = 345

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 73/308 (23%), Positives = 115/308 (37%), Gaps = 73/308 (23%)

Query: 39  ETSEVVYQALK----SGYRHLDTAVLYGN---EHEVGQGIQKWLEEDPEHNKRQDVFYTT 91
           +  E V+  LK     G R  DTA +Y N   E  +G+ ++K+      + +R+ V   T
Sbjct: 38  DNKEKVFALLKHCYDVGLRTFDTADVYNNGQSEVLLGEFLKKY------NIRRETVVILT 91

Query: 92  KLWN------------------------SQNGYSNAKRAIKECMEKVSPLG-YIDLLLIH 126
           K++                         +Q G S  K  I+     V  LG YID+L IH
Sbjct: 92  KIYFDSDDSMEVGSNFASINESTKLDLVNQRGLSR-KHIIQGVKNSVRRLGTYIDVLQIH 150

Query: 127 SPLSGTRRRLETYKAMQEAVDEGIVRSIGVSNYGKHHIDELLTWKELKHK--PVVNQIEI 184
             L          K++ + V  G VR IG S+       +L    + KH     VN    
Sbjct: 151 R-LDDNVPMKSIMKSLNDVVLSGDVRYIGASSMLATEFADLQAIAD-KHDWFQFVNWQSQ 208

Query: 185 SPWIMRQD---LADYCKSKGLVVEAFSPLTHGYKLKHPDVLL------------------ 223
              + R+D   +  Y K   + V  +SP   G   K  +V                    
Sbjct: 209 YNLLYREDEREVIPYAKRHNIAVTPWSPNARGLLAKPANVTSERKNFDPRLASISDDDKE 268

Query: 224 -------VAKETGTDAGRVLIRWSLQHGYVPLPKSRSVERLKGNVKAYDFELSPEQVSFL 276
                  +AK+       V   W L   ++P+     +ER+   VKA    L+ E++ +L
Sbjct: 269 IIGRVEKIAKDKDISMAMVSTAWVLSKRFLPIVGMSKMERIDEAVKAIKVTLTQEEIKYL 328

Query: 277 DQPQAYEP 284
           +  +AY+P
Sbjct: 329 E--EAYKP 334

>Scas_705.10
          Length = 348

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 47/220 (21%), Positives = 91/220 (41%), Gaps = 35/220 (15%)

Query: 18  KLSSGYILPSIGLGTYDIPRAETSEVVYQALKSGYRHLDTAVLYGNEHEVGQG------- 70
           K+ +GY L S+      +P+        QA K  +R ++ A+  GN+     G       
Sbjct: 13  KIDTGYGLMSLTWKDVPVPKD-------QAFKCMHRVIELAMQRGNKAFFNVGEFYGPNF 65

Query: 71  -----IQKWLEEDPEHNKRQDV----FYTTKLWNSQNGYSNAKRAIKECMEKVSPLGYID 121
                ++ + ++ P+  K   +     Y+T  +          +++++C+E++   GYID
Sbjct: 66  INLNYVKDFFKKYPDLRKNTIISCKGAYSTVTYKPLLKTDEVIKSVRDCVEQIG--GYID 123

Query: 122 LL--LIHSPLSGTRRRL---ETYKAMQEAVDEGIVRSIGVSNYGKHHIDELLTWKELKHK 176
           +       P +     +   E + A+   V+EG +  I +S      I  +   K+    
Sbjct: 124 IFEPARLDPEAADESEVYAHEPFDALAALVEEGAIGGISLSEVTAEEI--VAIHKDYGKY 181

Query: 177 PVVNQIEISPW---IMRQDLADYCKSKGLVVEAFSPLTHG 213
            V  ++E+S +   I+   +A  C    LVV  +SPL  G
Sbjct: 182 LVCVEVELSMFTKDILNNGIAKACNDLNLVVICYSPLGKG 221

>YPR127W (YPR127W) [5546] chr16 (790077..791114) Protein with
           similarity to S. pombe pyridoxal reductase [1038 bp, 345
           aa]
          Length = 345

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 45/214 (21%), Positives = 91/214 (42%), Gaps = 21/214 (9%)

Query: 17  YKLSSGYILPSIGLGTYDIPRAETSEVVYQAL----KSGYR-HLDTAVLYGNEHEVGQGI 71
           +KL +GY L S+      IP+++  E +++ +    + G++   +    YG +      +
Sbjct: 11  HKLDTGYGLMSLTWRAEPIPQSQAFEAMHRVVELSRERGHKAFFNVGEFYGPDFINLSYV 70

Query: 72  QKWLEEDPEHNKRQDVFYTTK------LWNSQNGYSNAKRAIKECMEKVSPLGYIDLL-- 123
             +  + P+   R+DV  + K          +  + +  +++K  +  +   GYID+   
Sbjct: 71  HDFFAKYPD--LRKDVVISCKGGADNATLTPRGSHDDVVQSVKNSVSAIG--GYIDIFEV 126

Query: 124 -LIHSPLS--GTRRRLETYKAMQEAVDEGIVRSIGVSNYGKHHIDEL-LTWKELKHKPVV 179
             I + L   G     E+++A+ E + EG++  I +S   +  I  +   W +      V
Sbjct: 127 ARIDTSLCTKGEVYPYESFEALAEMISEGVIGGISLSEVNEEQIRAIHKDWGKFLTCVEV 186

Query: 180 NQIEISPWIMRQDLADYCKSKGLVVEAFSPLTHG 213
                S  I+   +A  C   GL +  +SPL  G
Sbjct: 187 ELSLFSNDILHNGIAKTCAELGLSIICYSPLGRG 220

>KLLA0F19360g 1792778..1793812 similar to sgd|S0006009 Saccharomyces
           cerevisiae YPL088w, start by similarity
          Length = 344

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 73/310 (23%), Positives = 117/310 (37%), Gaps = 75/310 (24%)

Query: 42  EVVYQALKSGYRH----LDTAVLYGN---EHEVGQGIQKWLEEDPEHNKRQDVFYTTKLW 94
           E ++  LK  Y H     DTA  Y N   E  VG+ ++K+      + +R+ V   TK++
Sbjct: 40  EKIFSTLKYCYDHGLRTFDTADFYSNGLSEKLVGEFLKKY------NIRRETVVILTKVY 93

Query: 95  ---------NSQNGYS-------------NAKRAIKECMEKVSPLG-YIDLLLIHSPLSG 131
                    +  NG++             + K  +         L   ID+L IH  L  
Sbjct: 94  FPVDEDLELSHSNGFTENDLLDLTNQQGLSRKHILAGVTASCKRLDTCIDVLQIHR-LDR 152

Query: 132 TRRRLETYKAMQEAVDEGIVRSIGVSNYGKHHIDELLTWKELK--HKPVVNQIEISPWIM 189
                E  +++   V+ G VR IG S        EL +  E    HK + +Q      + 
Sbjct: 153 ETPMEEIMRSLNHVVESGQVRYIGASTMLATEFVELQSIAERYGWHKFISSQ-SCYNLLY 211

Query: 190 RQD---LADYCKSKGLVVEAFSPLTHGY--------------------KLKHPDVLL--- 223
           R+D   L  Y K  G+ +  +SP   G                     K +  D L    
Sbjct: 212 REDERELIPYLKRHGVGMIPWSPNARGILCRPVSQQSNSKRYETDGRIKGRQLDQLQPQE 271

Query: 224 ---------VAKETGTDAGRVLIRWSLQHGYVPLPKSRSVERLKGNVKAYDFELSPEQVS 274
                    +AK+ G     V   W L  G  P+    S++R+K  + A + +LS E++ 
Sbjct: 272 TEIVNRVEDLAKKHGVSMAVVSSAWVLAKGGYPIVGLSSIDRVKEIISATELKLSEEEIQ 331

Query: 275 FLDQPQAYEP 284
           +L+QP   +P
Sbjct: 332 YLEQPYLPKP 341

>Scas_633.21
          Length = 344

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 71/311 (22%), Positives = 119/311 (38%), Gaps = 79/311 (25%)

Query: 42  EVVYQALK----SGYRHLDTAVLYGN---EHEVGQGIQKWLEEDPEHNKRQDVFYTTKLW 94
           E +++ LK     G R  DTA +Y N   E  +G+ ++++        KR+ V   TK++
Sbjct: 40  EEIFKILKYCYDRGLRTYDTADVYSNGLSERLLGEFLKRY------KIKRETVVIFTKVF 93

Query: 95  -------------------------NSQNGYSNAKRAIKECMEKVSPLG-YIDLLLIHSP 128
                                     +Q G S  K  +      V  LG Y+D+L IH  
Sbjct: 94  CPVDETLPLTHGRQAIYDESVNLDLTNQKGLSR-KHIVAGVANSVERLGTYVDVLQIHR- 151

Query: 129 LSGTRRRLETYKAMQEAVDEGIVRSIGVSNYGKHHIDEL--LTWKELKHKPVVNQIEISP 186
           L       E  +++ + +  G VR IG S+       EL  +  K    K V +Q     
Sbjct: 152 LDHETSMEEIMRSLNDVILSGQVRYIGASSMRATEFAELQFIAEKNGWFKFVSSQ-SYYN 210

Query: 187 WIMRQD---LADYCKSKGLVVEAFSPLTHGY------------------KLKHPDVLL-- 223
            + R+D   L  + K  G+ +  +SP   G                   K  H + L+  
Sbjct: 211 LLNREDERELIPFAKKHGIGLVPWSPNARGILTRPLDESTPTGRSDNIVKKLHLNALMED 270

Query: 224 ----------VAKETGTDAGRVLIRWSLQHGYVPLPKSRSVERLKGNVKAYDFELSPEQV 273
                     +A++       V I WS++ G  P+    S+ R    + A D  L+ E+V
Sbjct: 271 EKEIVKRVQKIAQKKSVSMAMVSIAWSIKKGCNPIVGLSSISRAAEAIGALDVHLTEEEV 330

Query: 274 SFLDQPQAYEP 284
           ++L+  + Y+P
Sbjct: 331 TYLE--ETYQP 339

>YJR155W (AAD10) [3046] chr10 (727320..728186) Putative aryl alcohol
           dehydrogenase, may participates in late steps of
           degradation of aromatic compounds that arise from the
           degradation of lignocellulose [867 bp, 288 aa]
          Length = 288

 Score = 37.4 bits (85), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 43/74 (58%), Gaps = 8/74 (10%)

Query: 221 VLLVAKETGTDAGRVL----IRWSLQHGYVPLPKSRSVERLKGNVKAYDFELSPEQVSFL 276
           +L VA+E GT++   +    +R   +H + PL   R +E LK N++A   +L+PEQ+ +L
Sbjct: 191 LLKVAEEHGTESVTAIAIAYVRSKAKHVF-PLVGGRKIEHLKQNIEALSIKLTPEQIKYL 249

Query: 277 DQPQAYE---PTDW 287
           +    ++   PT++
Sbjct: 250 ESIVPFDVGFPTNF 263

>ABR094W [685] [Homologous to ScYMR041C - SH]
           complement(555931..557010) [1080 bp, 359 aa]
          Length = 359

 Score = 36.6 bits (83), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 66/137 (48%), Gaps = 21/137 (15%)

Query: 33  YDIPRAETSEVVYQALKSGYRHLDTAVLYGNEHEV-GQGIQKWLEEDPEHNKRQDVFYTT 91
           Y++P   T  +V +AL++G   +DT+  YG   E+ G+ +    +E P    R+  F  T
Sbjct: 52  YEVP---TLGLVRRALEAGICAIDTSPYYGKSEEIYGEALAAVRDEHP----RETYFICT 104

Query: 92  KLWN---SQNGYSNA--KRAIKECMEKVSPLGYIDLLLIHS----PLSGTRRRLETYKAM 142
           K+     S   YS A  + ++     ++    Y+DL+ +H       +G    L+  + +
Sbjct: 105 KVGREGPSDFDYSAAHVRASVHRSCARLHT-EYLDLVYLHDIEFVEAAGIWEALQELRRL 163

Query: 143 QEAVDEGIVRSIGVSNY 159
           +   DEG++R  G+S Y
Sbjct: 164 K---DEGVIRFFGISGY 177

>YFL057C (AAD16) [1627] chr6 complement(14305..14763) Predicted aryl
           alcohol dehydrogenase C-terminal domain, may participate
           in late steps of degradation of aromatic compounds that
           arise from the degradation of lignocellulose [459 bp,
           152 aa]
          Length = 152

 Score = 34.7 bits (78), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 41/71 (57%), Gaps = 8/71 (11%)

Query: 224 VAKETGTDAGRVL----IRWSLQHGYVPLPKSRSVERLKGNVKAYDFELSPEQVSFLDQP 279
           VA+E GT++   +    +R   ++ + PL   R +E LK N++A   +L+PEQ+ +L+  
Sbjct: 59  VAEEHGTESVTAIAIAYVRSKAKNVF-PLVGGRKIEHLKQNIEALSIKLTPEQIKYLESI 117

Query: 280 QAYE---PTDW 287
             ++   PT++
Sbjct: 118 IPFDVGFPTNF 128

>Scas_709.28
          Length = 323

 Score = 35.0 bits (79), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 28/125 (22%), Positives = 61/125 (48%), Gaps = 12/125 (9%)

Query: 42  EVVYQALKSGYRHLDTAVLYGN-EHEVGQGIQKWLEEDPEHNKRQDVFYTTKLWN-SQNG 99
           E++  A ++G   +DT+  YGN E  +G+ +    ++ P    R      TK+   S + 
Sbjct: 28  EILRVAFENGINCIDTSPYYGNSEILIGKALHNLGDKFP----RDSYLICTKVGRLSLDS 83

Query: 100 YS----NAKRAIKECMEKVSPLGYIDLLLIHS-PLSGTRRRLETYKAMQEAVDEGIVRSI 154
           +     N +R++    ++++   Y+DL+ +H       +  L   + +++  +EGI++  
Sbjct: 84  FDYSADNVRRSVVRSCKRLNS-DYLDLVYLHDVEFVNMKDSLVALRELKKLKNEGIIKRF 142

Query: 155 GVSNY 159
           G+S Y
Sbjct: 143 GISGY 147

>YDL243C (AAD4) [634] chr4 complement(17577..18566) Putative
           aryl-alcohol dehydrogenase, may participates in late
           steps of degradation of aromatic compounds that arise
           from the degradation of lignocellulose [990 bp, 329 aa]
          Length = 329

 Score = 34.3 bits (77), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 33/58 (56%), Gaps = 5/58 (8%)

Query: 224 VAKETGTDAGRVL----IRWSLQHGYVPLPKSRSVERLKGNVKAYDFELSPEQVSFLD 277
           VA+E GT++   +    +R S      PL   R +E LK N++A   +L+PEQ+ +L+
Sbjct: 236 VAEEHGTESVTAIAIAYVR-SKAKNVFPLVGGRKIEHLKQNIEALSIKLTPEQIEYLE 292

>YNL331C (AAD14) [4284] chr14 complement(16118..17248) Putative aryl
           alcohol dehydrogenase, may participate in late steps of
           degradation of aromatic compounds that arise from the
           degradation of lignocellulose [1131 bp, 376 aa]
          Length = 376

 Score = 33.1 bits (74), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 33/58 (56%), Gaps = 5/58 (8%)

Query: 224 VAKETGTDAGRVL----IRWSLQHGYVPLPKSRSVERLKGNVKAYDFELSPEQVSFLD 277
           +A+E GT++   +    +R S      PL   R +E LK N++A   +L+PEQ+ +L+
Sbjct: 282 IAEEHGTESVTAIAIAYVR-SKAKNVFPLIGGRKIEHLKQNIEALSIKLTPEQIEYLE 338

>KLLA0B09658g complement(837873..838901) similar to sgd|S0006331
           Saccharomyces cerevisiae YPR127w, hypothetical start
          Length = 342

 Score = 33.1 bits (74), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 37/80 (46%), Gaps = 5/80 (6%)

Query: 137 ETYKAMQEAVDEGIVRSIGVSNYGKHHIDELLTWKELKHKPVVNQIEISPW---IMRQDL 193
           ET+  + E V +G +  I +S      I  +   KE     V  ++E+S +   I+   +
Sbjct: 145 ETFDTIVEYVKKGKIGGISLSEVTAEQIRAI--HKEYGEYLVCVEVELSMFSAEILSNGI 202

Query: 194 ADYCKSKGLVVEAFSPLTHG 213
            D C   GL + A+SPL  G
Sbjct: 203 VDTCNELGLPIVAYSPLGRG 222

>CAGL0L00715g 86810..90244 highly similar to sp|P40527 Saccharomyces
           cerevisiae YIL048w NEO1 ATPase whose overproduction
           confers neomycin resistance, hypothetical start
          Length = 1144

 Score = 32.7 bits (73), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 28/52 (53%), Gaps = 1/52 (1%)

Query: 29  GLGTYDIPRAETSEVVYQALKSGYRHLDTAVLYGNEHEVGQGIQKWLEEDPE 80
           GL T  I R + ++ +Y+  K  Y  + +A +Y  E E+   I K+LE D E
Sbjct: 684 GLRTLVIGRKKLTKKIYEQFKKEYEEV-SASMYNREQEMANTISKYLEHDLE 734

>CAGL0F06061g complement(604063..605073) similar to sp|Q04212
           Saccharomyces cerevisiae YMR041c, hypothetical start
          Length = 336

 Score = 32.0 bits (71), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 62/128 (48%), Gaps = 12/128 (9%)

Query: 42  EVVYQALKSGYRHLDTAVLYG-NEHEVGQGIQKWL--EEDPEHNKRQDVFYTTKLWN--- 95
           +++  A  +G   +DT+  YG +E   GQ + K    +ED     R   +  TK+     
Sbjct: 36  DMLKHAFTNGINAIDTSPYYGPSEIIFGQALHKLKSPDEDGLSFTRDQYYICTKVGRIKL 95

Query: 96  SQNGYS-NAKRA--IKECMEKVSPLGYIDLLLIHS-PLSGTRRRLETYKAMQEAVDEGIV 151
            +  YS  A RA  ++ C E++    Y+DL+ +H        + +E  K +++  +EG++
Sbjct: 96  EEFDYSPKAVRASVLRSC-ERLDT-DYLDLVYLHDVEFVEFTKSMEALKELRKLKEEGVI 153

Query: 152 RSIGVSNY 159
           R  G+S Y
Sbjct: 154 RHFGLSGY 161

>YOL044W (PEX15) [4774] chr15 (247148..248299) Peroxisomal integral
           membrane protein required for peroxisome assembly [1152
           bp, 383 aa]
          Length = 383

 Score = 32.0 bits (71), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 19/24 (79%)

Query: 104 KRAIKECMEKVSPLGYIDLLLIHS 127
           KR IK+C+EK+S +G+ID+ +  S
Sbjct: 55  KRDIKDCLEKMSEVGFIDITVFKS 78

>KLLA0F01254g 115485..119945 weakly similar to sp|P29539
           Saccharomyces cerevisiae YBR275c RIF1 RAP1-interacting
           factor 1 singleton, hypothetical start
          Length = 1486

 Score = 32.0 bits (71), Expect = 0.70,   Method: Composition-based stats.
 Identities = 25/80 (31%), Positives = 37/80 (46%), Gaps = 17/80 (21%)

Query: 63  NEHEVGQGIQKWLEEDPEHNKRQDV-FYTTKLWNSQNGYS-------NAKRA--IKECME 112
           N+H     IQKW++E      ++ V   T  LWN    +        NA++   IK+ +E
Sbjct: 890 NDHLFANFIQKWIQEQKNSWSQETVRMLTESLWNRPAAFKELTALLINAEQTQIIKDTLE 949

Query: 113 K-------VSPLGYIDLLLI 125
           K       +SPLG + LL I
Sbjct: 950 KNPDIIDDISPLGDLSLLDI 969

>KLLA0F26851g complement(2478465..2479451) similar to sp|Q04212
           Saccharomyces cerevisiae YMR041c singleton, start by
           similarity
          Length = 328

 Score = 30.4 bits (67), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 34/131 (25%), Positives = 59/131 (45%), Gaps = 9/131 (6%)

Query: 33  YDIPRAETSEVVYQALKSGYRHLDTAVLYG-NEHEVGQGIQKWLEEDPEHNKRQDVFYTT 91
           Y IP     +++  A  +G   +DT+  YG +E   G+ ++   E+ P  N  Q      
Sbjct: 31  YSIP---VVDMLKFAFANGINAIDTSPYYGPSEIIYGEALESIQEQWP-RNSYQICTKVG 86

Query: 92  KLWNSQNGYS--NAKRAIKECMEKVSPLGYIDLLLIHS-PLSGTRRRLETYKAMQEAVDE 148
           ++      YS  + + ++    E++    Y+D+L +H          LE    M++  DE
Sbjct: 87  RIQLDDFDYSKEHVRSSVLRSCERLKT-NYLDVLYLHDIEFVEEDMILEALTEMRKLKDE 145

Query: 149 GIVRSIGVSNY 159
           GIV  IG+S Y
Sbjct: 146 GIVLRIGISGY 156

>CAGL0M04235g complement(464973..467324) similar to tr|Q12440
           Saccharomyces cerevisiae YLR127c APC2 component of the
           anaphase promoting complex, hypothetical start
          Length = 783

 Score = 30.4 bits (67), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 19/31 (61%)

Query: 251 SRSVERLKGNVKAYDFELSPEQVSFLDQPQA 281
           SR+VERL+  +   DFEL+ E V + D  Q 
Sbjct: 142 SRAVERLRNRMLEDDFELATEIVDYFDYCQT 172

>YKL171W (YKL171W) [3100] chr11 (127480..130266) Serine/threonine
           protein kinase of unknown function [2787 bp, 928 aa]
          Length = 928

 Score = 30.0 bits (66), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 25/48 (52%), Gaps = 3/48 (6%)

Query: 150 IVRSIGVSNYGKHHIDELLTWKELKHKPVVNQIEISPWIMRQDLADYC 197
           IV+  G  N  KH + E+  W+ LKH  ++  ++   W +  + A YC
Sbjct: 479 IVKFKGHQNIKKHVLREVAIWRTLKHNRILPLLD---WKLDDNYAMYC 523

>YCR107W (AAD3) [628] chr3 (313886..314977) Putative aryl alcohol
           dehydrogenase, homolog of Phanerochaete chrysosporium
           (white-rot fungus) ligninolytic aryl alcohol
           dehydrogenase (PHAAD) [1092 bp, 363 aa]
          Length = 363

 Score = 28.5 bits (62), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 32/58 (55%), Gaps = 5/58 (8%)

Query: 224 VAKETGTDAGRVL----IRWSLQHGYVPLPKSRSVERLKGNVKAYDFELSPEQVSFLD 277
           +A+E GT++   +    +R S    + P  +   +E LK N+KA   +L+P+ + +L+
Sbjct: 279 IAEEHGTESVTAIAIAYVR-SKAKNFFPSVEGGKIEDLKENIKALSIDLTPDNIKYLE 335

>Sklu_2274.6 YMR041C, Contig c2274 7634-8653
          Length = 339

 Score = 28.5 bits (62), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 29/122 (23%), Positives = 56/122 (45%), Gaps = 16/122 (13%)

Query: 47  ALKSGYRHLDTAVLYG-NEHEVGQGIQKWLEEDPEHNKRQDVFYTTKLWNSQ-NGYSNAK 104
           A+  G R +DT+  YG +E   G  +    +E      R   +  TK+   + + +   +
Sbjct: 49  AMDHGIRAIDTSPYYGPSETLYGNALDAIKDE----YARDTYYICTKVGRIRLDEFDYTR 104

Query: 105 RAIKECMEKVSP---LGYIDLLLIHS----PLSGTRRRLETYKAMQEAVDEGIVRSIGVS 157
             ++  +++        Y+DL+ +H      LS     LE  ++++   DEGI+R+ G+S
Sbjct: 105 EHVRFSVQRSCARLKTTYLDLVYLHDVEFVELSQIFEALEELRSLK---DEGIIRNFGLS 161

Query: 158 NY 159
            Y
Sbjct: 162 GY 163

>YOL165C (AAD15) [4660] chr15 complement(1647..2078) Putative aryl
           alcohol dehydrogenase, may participate in late steps of
           degradation of aromatic compounds that arise from the
           degradation of lignocellulose [432 bp, 143 aa]
          Length = 143

 Score = 27.7 bits (60), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 33/59 (55%), Gaps = 5/59 (8%)

Query: 224 VAKETGTDAGRVL----IRWSLQHGYVPLPKSRSVERLKGNVKAYDFELSPEQVSFLDQ 278
           VA+E GT++   +    +R   ++ + P  +   +E LK N+KA   +L+P+ + +L+ 
Sbjct: 59  VAEEHGTESVTAIAIAYVRSKAKNVF-PSVEGGKIEDLKENIKALSIDLTPDNIKYLEN 116

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.134    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,171,590
Number of extensions: 447230
Number of successful extensions: 1387
Number of sequences better than 10.0: 84
Number of HSP's gapped: 1253
Number of HSP's successfully gapped: 98
Length of query: 290
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 189
Effective length of database: 13,099,691
Effective search space: 2475841599
Effective search space used: 2475841599
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 61 (28.1 bits)