Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_47.1821633332916490.0
Sklu_2334.231932912621e-176
AGL311C36232912201e-169
YJR095W (SFC1)32233212071e-167
Scas_691.433433011841e-164
CAGL0M09020g34835011641e-161
KLLA0F03212g30532711411e-158
YBR291C (CTP1)2993293594e-40
CAGL0L02079g2973293586e-40
Sklu_1149.22963223431e-37
KLLA0E18810g3773283452e-37
Scas_489.42973273351e-36
Kwal_26.79672973253342e-36
Scas_640.253063383272e-35
YPR021C (AGC1)9023163422e-35
Scas_602.88853183229e-33
ADL049W9123173071e-30
CAGL0K02365g9193163052e-30
Sklu_2359.69023163042e-30
Kwal_47.173218813163024e-30
YOR222W (ODC2)3073292898e-30
Kwal_26.86692963142888e-30
Scas_589.103163302871e-29
ACR109W2993262818e-29
YPL134C (ODC1)3103402765e-28
AGL064W2963272722e-27
KLLA0E13453g9063162803e-27
KLLA0D07073g2973302582e-25
CAGL0J04114g3033242573e-25
YEL006W3353382583e-25
Scas_709.93653292481e-23
KLLA0E15532g3263322451e-23
YPR011C3263282442e-23
CAGL0H03839g2823252412e-23
YIL006W3733262453e-23
KLLA0F17864g3073242423e-23
CAGL0D01606g3053182371e-22
Sklu_2363.23233272363e-22
Scas_667.223063192344e-22
Scas_718.53243322354e-22
Kwal_0.2322743272325e-22
Scas_558.22893332291e-21
CAGL0J02002g3613272322e-21
Scas_582.73293252302e-21
Scas_578.3*5243342342e-21
YJL133W (MRS3)3143212241e-20
KLLA0B08503g3033002231e-20
YPR058W (YMC1)3073212222e-20
ACR260W3113222212e-20
Sklu_2442.82753352193e-20
AAL014C2713202176e-20
CAGL0K08250g2973182177e-20
CAGL0C02013g3293302197e-20
YKR052C (MRS4)3043212178e-20
YNL003C (PET8)2843242151e-19
Kwal_27.125993043192151e-19
Scas_662.123083342142e-19
CAGL0K12210g3113232142e-19
Kwal_56.230113033142142e-19
Kwal_33.140503143222143e-19
CAGL0L05742g3053312133e-19
Kwal_14.22103153332134e-19
AFR131C3443102134e-19
Sklu_2398.43093252116e-19
Sklu_1926.23053262116e-19
CAGL0G08910g2893162098e-19
KLLA0C11363g5173452122e-18
CAGL0J01661g3273232082e-18
KLLA0D15015g3173202072e-18
Sklu_1275.13113362063e-18
KLLA0E23705g3683682074e-18
Scas_697.473283212064e-18
YBR104W (YMC2)3293342055e-18
YNL083W5453402085e-18
AGL047C3163312046e-18
KLLA0D04950g2743242027e-18
AEL253W3653602049e-18
Scas_379.23013222029e-18
CAGL0K10362g3013222011e-17
Scas_632.92923261983e-17
Kwal_23.35293953122004e-17
KLLA0E02772g2843171965e-17
Kwal_33.129883033201966e-17
Sklu_2374.75133461989e-17
CAGL0J05522g5193441981e-16
Sklu_2431.53703501961e-16
CAGL0B04543g3173241941e-16
Kwal_23.30425423451962e-16
YMR166C3683391942e-16
AFR146W2813151903e-16
AAR036W3173261904e-16
Kwal_47.192282812741886e-16
CAGL0J09790g3003251861e-15
CAGL0G03135g3073441862e-15
Scas_721.273743551862e-15
Kwal_26.76533252261843e-15
ADL264C3293221843e-15
Kwal_55.208683803331853e-15
YOR100C (CRC1)3273301834e-15
AER419W4933301864e-15
Kwal_23.29133203331834e-15
Sklu_2433.84203281855e-15
Sklu_2127.52783161815e-15
CAGL0F08305g3742961828e-15
KLLA0F04697g3073281808e-15
Scas_687.15*3283271818e-15
Kwal_27.120813693481811e-14
KLLA0A00979g3433521801e-14
Kwal_55.213353173141782e-14
YKL120W (OAC1)3242371782e-14
KLLA0A09383g3662841782e-14
Scas_714.183053191763e-14
YIL134W (FLX1)3113401754e-14
YDL198C (YHM1)3003351745e-14
YOR130C (ORT1)2923181736e-14
Kwal_23.39653073441746e-14
CAGL0F00231g3073101737e-14
ADL009W3793341748e-14
YBR192W (RIM2)3773511731e-13
YLR348C (DIC1)2983301711e-13
CAGL0M05225g3812851721e-13
Sklu_2432.52883171692e-13
Sklu_2117.22983341692e-13
AFR147C3152821702e-13
Sklu_2115.42993481692e-13
KLLA0F13464g3003221692e-13
CAGL0F07711g3682611703e-13
Sklu_2037.23103411674e-13
Kwal_23.47313143361674e-13
Scas_716.293163271674e-13
YGR096W (TPC1)3143251675e-13
Scas_721.1293233151667e-13
Scas_669.63733251677e-13
AFL196W3613111677e-13
Scas_562.123003321657e-13
YGR257C (MTM1)3662781661e-12
KLLA0D14036g4313551661e-12
KLLA0C13431g3283331641e-12
YJR077C (MIR1)3113101641e-12
CAGL0G01166g2953281622e-12
Kwal_23.43543433531632e-12
Sklu_2075.33453161632e-12
KLLA0B12826g3193321613e-12
Scas_702.103023181603e-12
Sklu_1119.13073111595e-12
Scas_673.173143111595e-12
AFR253W3443361605e-12
Kwal_33.155973053111587e-12
Kwal_27.116262993361551e-11
AER366W2933291552e-11
CAGL0K02915g3423541552e-11
YHR002W (LEU5)3573291543e-11
AGR191W2983401524e-11
CAGL0K11616g3203151524e-11
Scas_645.93912971534e-11
KLLA0D09889g3643161517e-11
Sklu_2127.43232951491e-10
Scas_717.203563421472e-10
Sklu_2430.103242391463e-10
Kwal_33.154463053371427e-10
YFR045W2852151411e-09
CAGL0K07436g3073131373e-09
Kwal_55.213383232671374e-09
Kwal_27.114192983381355e-09
CAGL0B03883g3063261355e-09
KLLA0B14454g3053121356e-09
AGL065C3353541357e-09
AER450C3083071347e-09
KLLA0D04290g1882091308e-09
CAGL0H10538g2973431348e-09
YMR241W (YHM2)3143121349e-09
KLLA0E02750g3043091349e-09
Scas_718.243373351341e-08
YMR056C (AAC1)3093121331e-08
KLLA0E18788g3813521331e-08
KLLA0F08547g3081351312e-08
ABL023W3093051303e-08
AFR542W3102981303e-08
Kwal_26.79723583161303e-08
Scas_667.43083171303e-08
Scas_696.93121211293e-08
Kwal_23.57573073061294e-08
KLLA0E08877g2943451276e-08
Sklu_2260.53023091268e-08
KLLA0E09680g3073161251e-07
YER053C3003051251e-07
Kwal_34.159073123121241e-07
CAGL0D04774g3223411232e-07
AGR383W2931611223e-07
CAGL0F04213g3063361223e-07
AER184W3053421213e-07
YBL030C (PET9)3183281214e-07
YBR085W (AAC3)3073321205e-07
Kwal_27.124813043391187e-07
Sklu_2194.33122921152e-06
Scas_715.453053051091e-05
Scas_705.93233261072e-05
YPR128C (ANT1)3283411072e-05
KLLA0D04312g10386993e-05
KLLA0E12353g3053391001e-04
KLLA0E22880g436851012e-04
Sklu_2435.2344154983e-04
ADR036C340157983e-04
YDL119C30785920.001
Scas_613.2417787830.012
Scas_328.1227136830.014
Scas_671.1*123102770.032
KLLA0B11319g355282810.034
AEL060C42979820.035
Kwal_55.21106328149810.041
YOR084W38722691.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_47.18216
         (329 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_47.18216                                                         639   0.0  
Sklu_2334.2 YJR095W, Contig c2334 6303-7262 reverse complement        490   e-176
AGL311C [4001] [Homologous to ScYJR095W (SFC1) - SH] (119645..12...   474   e-169
YJR095W (SFC1) [2987] chr10 (609690..610658) Mitochondrial membr...   469   e-167
Scas_691.4                                                            460   e-164
CAGL0M09020g complement(896312..897358) highly similar to sp|P33...   452   e-161
KLLA0F03212g 302915..303832 highly similar to sp|P33303 Saccharo...   444   e-158
YBR291C (CTP1) [469] chr2 complement(783631..784530) Mitochondri...   142   4e-40
CAGL0L02079g 243467..244360 highly similar to sp|P38152 Saccharo...   142   6e-40
Sklu_1149.2 YBR291C, Contig c1149 2019-2909 reverse complement        136   1e-37
KLLA0E18810g 1663220..1664353 some similarities with sp|P38152 S...   137   2e-37
Scas_489.4                                                            133   1e-36
Kwal_26.7967                                                          133   2e-36
Scas_640.25                                                           130   2e-35
YPR021C (AGC1) [5455] chr16 complement(600644..603352) Member of...   136   2e-35
Scas_602.8                                                            128   9e-33
ADL049W [1692] [Homologous to ScYPR021C - SH] complement(598135....   122   1e-30
CAGL0K02365g 212702..215461 highly similar to tr|Q12482 Saccharo...   122   2e-30
Sklu_2359.6 YPR021C, Contig c2359 14617-17325                         121   2e-30
Kwal_47.17321                                                         120   4e-30
YOR222W (ODC2) [5014] chr15 (758330..759253) 2-Oxodicarboxylate ...   115   8e-30
Kwal_26.8669                                                          115   8e-30
Scas_589.10                                                           115   1e-29
ACR109W [1156] [Homologous to ScYOR222W (ODC2) - SH; ScYPL134C (...   112   8e-29
YPL134C (ODC1) [5311] chr16 complement(298570..299502) 2-Oxodica...   110   5e-28
AGL064W [4247] [Homologous to ScYBR291C (CTP1) - SH] complement(...   109   2e-27
KLLA0E13453g complement(1184806..1187526) similar to sgd|S000622...   112   3e-27
KLLA0D07073g 606857..607750 similar to sp|Q03028 Saccharomyces c...   103   2e-25
CAGL0J04114g complement(384321..385232) similar to sp|Q99297 Sac...   103   3e-25
YEL006W (YEL006W) [1417] chr5 (144326..145333) Member of the mit...   103   3e-25
Scas_709.9                                                            100   1e-23
KLLA0E15532g complement(1383230..1384210) similar to sp|P23500 S...    99   1e-23
YPR011C (YPR011C) [5447] chr16 complement(583057..584037) Protei...    99   2e-23
CAGL0H03839g 359987..360835 highly similar to sp|P38921 Saccharo...    97   2e-23
YIL006W (YIL006W) [2659] chr9 (344059..345180) Member of the mit...    99   3e-23
KLLA0F17864g complement(1634241..1635164) similar to sp|P32331 S...    98   3e-23
CAGL0D01606g complement(169066..169983) highly similar to sp|P32...    96   1e-22
Sklu_2363.2 YPR011C, Contig c2363 11969-12940                          96   3e-22
Scas_667.22                                                            95   4e-22
Scas_718.5                                                             95   4e-22
Kwal_0.232                                                             94   5e-22
Scas_558.2                                                             93   1e-21
CAGL0J02002g 198226..199311 similar to sp|P40556 Saccharomyces c...    94   2e-21
Scas_582.7                                                             93   2e-21
Scas_578.3*                                                            95   2e-21
YJL133W (MRS3) [2785] chr10 (160537..161481) Member of the mitoc...    91   1e-20
KLLA0B08503g complement(753498..754409) similar to sp|P32331 Sac...    91   1e-20
YPR058W (YMC1) [5488] chr16 (673746..674669) Member of the mitoc...    90   2e-20
ACR260W [1307] [Homologous to ScYJL133W (MRS3) - SH; ScYKR052C (...    90   2e-20
Sklu_2442.8 YNL003C, Contig c2442 12309-13136                          89   3e-20
AAL014C [173] [Homologous to ScYNL003C (PET8) - SH] (317388..318...    88   6e-20
CAGL0K08250g complement(820185..821078) highly similar to sp|P23...    88   7e-20
CAGL0C02013g complement(209930..210919) weakly similar to sp|P38...    89   7e-20
YKR052C (MRS4) [3303] chr11 complement(532192..533106) Member of...    88   8e-20
YNL003C (PET8) [4582] chr14 complement(624974..625828) Protein o...    87   1e-19
Kwal_27.12599                                                          87   1e-19
Scas_662.12                                                            87   2e-19
CAGL0K12210g 1193771..1194706 similar to sp|P38087 Saccharomyces...    87   2e-19
Kwal_56.23011                                                          87   2e-19
Kwal_33.14050                                                          87   3e-19
CAGL0L05742g complement(630844..631761) similar to sp|P10566 Sac...    87   3e-19
Kwal_14.2210                                                           87   4e-19
AFR131C [3323] [Homologous to ScYGR257C - SH] (672999..674033) [...    87   4e-19
Sklu_2398.4 , Contig c2398 9476-10405                                  86   6e-19
Sklu_1926.2 YPR058W, Contig c1926 347-1264 reverse complement          86   6e-19
CAGL0G08910g complement(853693..854562) similar to sp|P40464 Sac...    85   8e-19
KLLA0C11363g complement(975442..976995) similar to sp|P48233 Sac...    86   2e-18
CAGL0J01661g 154646..155629 highly similar to tr|Q12251 Saccharo...    85   2e-18
KLLA0D15015g 1267803..1268756 similar to sp|P53257 Saccharomyces...    84   2e-18
Sklu_1275.1 , Contig c1275 314-1249                                    84   3e-18
KLLA0E23705g complement(2099965..2101071) highly similar to sp|P...    84   4e-18
Scas_697.47                                                            84   4e-18
YBR104W (YMC2) [293] chr2 (449624..450613) Member of the mitocho...    84   5e-18
YNL083W (YNL083W) [4507] chr14 (471377..473014) Member of the mi...    85   5e-18
AGL047C [4264] [Homologous to ScYPR011C - NSH] (616853..617803) ...    83   6e-18
KLLA0D04950g 424550..425374 similar to sp|P38921 Saccharomyces c...    82   7e-18
AEL253W [2253] [Homologous to ScYBR192W (RIM2) - SH] complement(...    83   9e-18
Scas_379.2                                                             82   9e-18
CAGL0K10362g complement(1009155..1010060) similar to sp|Q12375 S...    82   1e-17
Scas_632.9                                                             81   3e-17
Kwal_23.3529                                                           82   4e-17
KLLA0E02772g complement(261895..262749) similar to sp|Q12375 Sac...    80   5e-17
Kwal_33.12988                                                          80   6e-17
Sklu_2374.7 YNL083W, Contig c2374 13874-15415 reverse complement       81   9e-17
CAGL0J05522g complement(524930..526489) highly similar to sp|P48...    81   1e-16
Sklu_2431.5 YBR192W, Contig c2431 8526-9638                            80   1e-16
CAGL0B04543g 441599..442552 highly similar to tr|Q12289 Saccharo...    79   1e-16
Kwal_23.3042                                                           80   2e-16
YMR166C (YMR166C) [4121] chr13 complement(593366..594472) Member...    79   2e-16
AFR146W [3338] [Homologous to ScYOR130C (ORT1) - SH] complement(...    78   3e-16
AAR036W [222] [Homologous to ScYGR096W - SH] complement(406887.....    78   4e-16
Kwal_47.19228                                                          77   6e-16
CAGL0J09790g complement(957759..958661) highly similar to sp|P38...    76   1e-15
CAGL0G03135g 290834..291757 similar to sp|P53257 Saccharomyces c...    76   2e-15
Scas_721.27                                                            76   2e-15
Kwal_26.7653                                                           75   3e-15
ADL264C [1477] [Homologous to ScYOR100C (CRC1) - SH] (241532..24...    75   3e-15
Kwal_55.20868                                                          76   3e-15
YOR100C (CRC1) [4905] chr15 complement(513295..514278) Mitochond...    75   4e-15
AER419W [2919] [Homologous to ScYNL083W - SH] complement(1442595...    76   4e-15
Kwal_23.2913                                                           75   4e-15
Sklu_2433.8 YFR045W, Contig c2433 11995-13257 reverse complement       76   5e-15
Sklu_2127.5 YOR130C, Contig c2127 7354-8190 reverse complement         74   5e-15
CAGL0F08305g complement(827705..828829) similar to sp|P53320 Sac...    75   8e-15
KLLA0F04697g complement(461126..462049) similar to sp|P40464 Sac...    74   8e-15
Scas_687.15*                                                           74   8e-15
Kwal_27.12081                                                          74   1e-14
KLLA0A00979g complement(92561..93592) weakly similar to sp|P3815...    74   1e-14
Kwal_55.21335                                                          73   2e-14
YKL120W (OAC1) [3145] chr11 (216990..217964) Mitochondrial oxalo...    73   2e-14
KLLA0A09383g complement(818752..819852) similar to sp|P53320 Sac...    73   2e-14
Scas_714.18                                                            72   3e-14
YIL134W (FLX1) [2542] chr9 (97395..98330) Protein involved in tr...    72   4e-14
YDL198C (GGC1) [676] chr4 complement(103650..104552) Member of t...    72   5e-14
YOR130C (ORT1) [4932] chr15 complement(569929..570807) Ornithine...    71   6e-14
Kwal_23.3965                                                           72   6e-14
CAGL0F00231g 29705..30628 highly similar to sp|P23641 Saccharomy...    71   7e-14
ADL009W [1733] [Homologous to ScYIL006W - SH; ScYEL006W - SH] co...    72   8e-14
YBR192W (RIM2) [375] chr2 (607609..608742) Member of the mitocho...    71   1e-13
YLR348C (DIC1) [3731] chr12 complement(826976..827872) Mitochond...    70   1e-13
CAGL0M05225g 563163..564308 highly similar to sp|P38127 Saccharo...    71   1e-13
Sklu_2432.5 YLR348C, Contig c2432 10310-11176 reverse complement       70   2e-13
Sklu_2117.2 YDL198C, Contig c2117 3737-4633                            70   2e-13
AFR147C [3339] [Homologous to NOHBY] (703270..704217) [948 bp, 3...    70   2e-13
Sklu_2115.4 YDL119C, Contig c2115 2906-3805                            70   2e-13
KLLA0F13464g 1246646..1247548 highly similar to sp|P38988 Saccha...    70   2e-13
CAGL0F07711g complement(751794..752900) similar to sp|Q03829 Sac...    70   3e-13
Sklu_2037.2 YIL134W, Contig c2037 1645-2577 reverse complement         69   4e-13
Kwal_23.4731                                                           69   4e-13
Scas_716.29                                                            69   4e-13
YGR096W (TPC1) [2056] chr7 (676623..677567) Mitochondrial thiami...    69   5e-13
Scas_721.129                                                           69   7e-13
Scas_669.6                                                             69   7e-13
AFL196W [2999] [Homologous to ScYMR166C - SH] complement(66955.....    69   7e-13
Scas_562.12                                                            68   7e-13
YGR257C (MTM1) [2204] chr7 complement(1006210..1007310) Member o...    69   1e-12
KLLA0D14036g complement(1203522..1204817) some similarities with...    69   1e-12
KLLA0C13431g 1145919..1146905 similar to sgd|S0005626 Saccharomy...    68   1e-12
YJR077C (MIR1) [2970] chr10 complement(577169..578104) Phosphate...    68   1e-12
CAGL0G01166g complement(111298..112185) highly similar to tr|Q06...    67   2e-12
Kwal_23.4354                                                           67   2e-12
Sklu_2075.3 , Contig c2075 6414-7451 reverse complement                67   2e-12
KLLA0B12826g 1121106..1122065 similar to sp|P32332 Saccharomyces...    67   3e-12
Scas_702.10                                                            66   3e-12
Sklu_1119.1 YJR077C, Contig c1119 366-1289                             66   5e-12
Scas_673.17                                                            66   5e-12
AFR253W [3445] [Homologous to ScYFR045W - SH] complement(892939....    66   5e-12
Kwal_33.15597                                                          65   7e-12
Kwal_27.11626                                                          64   1e-11
AER366W [2867] [Homologous to ScYIL134W (FLX1) - SH] complement(...    64   2e-11
CAGL0K02915g 259026..260054 highly similar to sp|P38702 Saccharo...    64   2e-11
YHR002W (LEU5) [2287] chr8 (108806..109879) Protein with similar...    64   3e-11
AGR191W [4502] [Homologous to ScYDL198C (YHM1) - SH] complement(...    63   4e-11
CAGL0K11616g complement(1121834..1122796) highly similar to sp|P...    63   4e-11
Scas_645.9                                                             64   4e-11
KLLA0D09889g complement(834904..835998) similar to sp|Q03829 Sac...    63   7e-11
Sklu_2127.4 , Contig c2127 6322-7293                                   62   1e-10
Scas_717.20                                                            61   2e-10
Sklu_2430.10 YKL120W, Contig c2430 18856-19830                         61   3e-10
Kwal_33.15446                                                          59   7e-10
YFR045W (YFR045W) [1727] chr6 (242129..242986) Member of the mit...    59   1e-09
CAGL0K07436g complement(734496..735419) highly similar to sp|Q04...    57   3e-09
Kwal_55.21338                                                          57   4e-09
Kwal_27.11419                                                          57   5e-09
CAGL0B03883g 383602..384522 weakly similar to sp|P32331 Saccharo...    57   5e-09
KLLA0B14454g complement(1268709..1269626) highly similar to sp|P...    57   6e-09
AGL065C [4246] [Homologous to ScYHR002W (LEU5) - SH] (585963..58...    57   7e-09
AER450C [2950] [Homologous to ScYJR077C (MIR1) - SH] (1500683..1...    56   7e-09
KLLA0D04290g 366536..367102 similar to sgd|S0006215 Saccharomyce...    55   8e-09
CAGL0H10538g 1027739..1028632 highly similar to tr|Q07534 Saccha...    56   8e-09
YMR241W (YHM2) [4197] chr13 (751960..752904) Suppressor of abf1 ...    56   9e-09
KLLA0E02750g 260854..261768 similar to ca|CA6127|IPF149 Candida ...    56   9e-09
Scas_718.24                                                            56   1e-08
YMR056C (AAC1) [4016] chr13 complement(387314..388243) ADP/ATP c...    56   1e-08
KLLA0E18788g complement(1661093..1662238) similar to sp|P38702 S...    56   1e-08
KLLA0F08547g 796328..797254 similar to sp|Q04013 Saccharomyces c...    55   2e-08
ABL023W [569] [Homologous to ScYKL120W (OAC1) - SH] complement(3...    55   3e-08
AFR542W [3734] [Homologous to ScYMR241W (YHM2) - SH] complement(...    55   3e-08
Kwal_26.7972                                                           55   3e-08
Scas_667.4                                                             55   3e-08
Scas_696.9                                                             54   3e-08
Kwal_23.5757                                                           54   4e-08
KLLA0E08877g complement(791157..792041) similar to sgd|S0002277 ...    54   6e-08
Sklu_2260.5 YER053C, Contig c2260 6981-7889 reverse complement         53   8e-08
KLLA0E09680g complement(860245..861168) similar to ca|CA5146|CaY...    53   1e-07
YER053C (PIC2) [1481] chr5 complement(258736..259638) Member of ...    53   1e-07
Kwal_34.15907                                                          52   1e-07
CAGL0D04774g complement(467712..468680) similar to tr|Q06497 Sac...    52   2e-07
AGR383W [4694] [Homologous to ScYDL119C - SH] complement(1436769...    52   3e-07
CAGL0F04213g 419473..420393 highly similar to sp|P18239 Saccharo...    52   3e-07
AER184W [2686] [Homologous to ScYBL030C (PET9) - SH; ScYBR085W (...    51   3e-07
YBL030C (PET9) [164] chr2 complement(163006..163962) ADP/ATP car...    51   4e-07
YBR085W (AAC3) [275] chr2 (415940..416863) ADP/ATP transporter p...    51   5e-07
Kwal_27.12481                                                          50   7e-07
Sklu_2194.3 YMR241W, Contig c2194 5245-6183                            49   2e-06
Scas_715.45                                                            47   1e-05
Scas_705.9                                                             46   2e-05
YPR128C (ANT1) [5547] chr16 complement(791212..792198) Peroxisom...    46   2e-05
KLLA0D04312g 367160..367471 highly similar to sgd|S0006215 Sacch...    43   3e-05
KLLA0E12353g complement(1092303..1093220) gi|1351895|sp|P49382|A...    43   1e-04
KLLA0E22880g complement(2033077..2034387) similar to ca|CA2800|I...    44   2e-04
Sklu_2435.2 YPR128C, Contig c2435 2489-3523 reverse complement         42   3e-04
ADR036C [1777] [Homologous to ScYPR128C (ANT1) - SH] (771097..77...    42   3e-04
YDL119C (YDL119C) [751] chr4 complement(246689..247612) Member o...    40   0.001
Scas_613.24                                                            37   0.012
Scas_328.1                                                             37   0.014
Scas_671.1*                                                            34   0.032
KLLA0B11319g 988293..989360 similar to sgd|S0006332 Saccharomyce...    36   0.034
AEL060C [2446] [Homologous to NOHBY] (525069..526358) [1290 bp, ...    36   0.035
Kwal_55.21106                                                          36   0.041
YOR084W (YOR084W) [4890] chr15 (480588..481751) Peroxisomal matr...    31   1.0  

>Kwal_47.18216
          Length = 333

 Score =  639 bits (1649), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/329 (95%), Positives = 315/329 (95%)

Query: 1   MSNRKNSSHPAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARD 60
           MSNRKNSSHPAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARD
Sbjct: 1   MSNRKNSSHPAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARD 60

Query: 61  ISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNTFVAGVGAG 120
           ISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNTFVAGVGAG
Sbjct: 61  ISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNTFVAGVGAG 120

Query: 121 ITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYR 180
           ITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSV              ENVAATPKYR
Sbjct: 121 ITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVTSSSATFSSATTATENVAATPKYR 180

Query: 181 NAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPSWE 240
           NAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPSWE
Sbjct: 181 NAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPSWE 240

Query: 241 TSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKG 300
           TSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKG
Sbjct: 241 TSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKG 300

Query: 301 ITPRVMRVAPGQAVTFTVYELIRKKLEGL 329
           ITPRVMRVAPGQAVTFTVYELIRKKLEGL
Sbjct: 301 ITPRVMRVAPGQAVTFTVYELIRKKLEGL 329

>Sklu_2334.2 YJR095W, Contig c2334 6303-7262 reverse complement
          Length = 319

 Score =  490 bits (1262), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 241/329 (73%), Positives = 271/329 (82%), Gaps = 26/329 (7%)

Query: 1   MSNRKNSSHPAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARD 60
           MS++K SS+PA+NL+AGGTAGLFEALCCHPLDTIKVRMQIY R+  +G +  GFI T R+
Sbjct: 1   MSSKKKSSNPAVNLIAGGTAGLFEALCCHPLDTIKVRMQIYRRSALEGIKPPGFIKTGRN 60

Query: 61  ISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNTFVAGVGAG 120
           I T+EG LALYKGLGAVVIGIIPKMAIRF+SYEF+R+ LAD+QTG VSTGNTF+AGVGAG
Sbjct: 61  IYTEEGLLALYKGLGAVVIGIIPKMAIRFSSYEFYRSALADKQTGSVSTGNTFLAGVGAG 120

Query: 121 ITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYR 180
            TEAV+VVNPMEVVKIRLQAQH+                              AA+P+YR
Sbjct: 121 TTEAVLVVNPMEVVKIRLQAQHLH--------------------------PETAASPRYR 154

Query: 181 NAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPSWE 240
           NA+QA Y+IVKEEG  ALYRGVSLTAARQATNQGANFTVYS LK  LQE+H+TD LPSWE
Sbjct: 155 NALQACYLIVKEEGIGALYRGVSLTAARQATNQGANFTVYSKLKEFLQEHHKTDALPSWE 214

Query: 241 TSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKG 300
           TS IGLISGA+GPFSNAPLDTIKTRLQKDKST+  SGWSRI+ IG+QLI+EEGFRALYKG
Sbjct: 215 TSCIGLISGAIGPFSNAPLDTIKTRLQKDKSTANMSGWSRIVTIGKQLIKEEGFRALYKG 274

Query: 301 ITPRVMRVAPGQAVTFTVYELIRKKLEGL 329
           ITPRVMRVAPGQAVTFTVYE +R+ LE L
Sbjct: 275 ITPRVMRVAPGQAVTFTVYEFVREHLETL 303

>AGL311C [4001] [Homologous to ScYJR095W (SFC1) - SH]
           (119645..120733) [1089 bp, 362 aa]
          Length = 362

 Score =  474 bits (1220), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 242/329 (73%), Positives = 265/329 (80%), Gaps = 29/329 (8%)

Query: 1   MSNRKNSSHPAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARD 60
           MS++K S++PA+NLVAGGTAGLFEALCCHPLDTIKVRMQIY RA E G +  GF+ T  +
Sbjct: 49  MSSKK-STNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANE-GTKPPGFLRTGAN 106

Query: 61  ISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNTFVAGVGAG 120
           I + EG LA YKGLGAVVIGIIPKMAIRF+SYEF+RTLLADRQTGVVSTGNTF+AGVGAG
Sbjct: 107 IYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNTFLAGVGAG 166

Query: 121 ITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYR 180
           +TEAV+VVNPMEVVKIRLQAQH+                              A   KYR
Sbjct: 167 VTEAVLVVNPMEVVKIRLQAQHL---------------------------HGAAEQQKYR 199

Query: 181 NAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPSWE 240
           NAIQAAY+IVKEEG  ALYRGVSLTAARQATNQGANFTVYS L  RLQEYH +  LPSWE
Sbjct: 200 NAIQAAYLIVKEEGIGALYRGVSLTAARQATNQGANFTVYSKLMERLQEYHGSQNLPSWE 259

Query: 241 TSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKG 300
           TSLIGL+SGA+GPFSNAPLDTIKTRLQKDKST   S W RI  IGRQL++EEGFRALYKG
Sbjct: 260 TSLIGLVSGAIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKG 319

Query: 301 ITPRVMRVAPGQAVTFTVYELIRKKLEGL 329
           ITPRVMRVAPGQAVTFTVYE +R+ LEGL
Sbjct: 320 ITPRVMRVAPGQAVTFTVYEFVRRHLEGL 348

>YJR095W (SFC1) [2987] chr10 (609690..610658) Mitochondrial membrane
           succinate-fumarate transporter, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [969 bp, 322 aa]
          Length = 322

 Score =  469 bits (1207), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 240/332 (72%), Positives = 264/332 (79%), Gaps = 28/332 (8%)

Query: 1   MSNRKNSSHPAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSR-AREQGQRARGFIGTAR 59
           MS +K +SHPAINL+AGGTAGLFEALCCHPLDTIKVRMQIY R A  +  +  GFI T R
Sbjct: 1   MSQKKKASHPAINLMAGGTAGLFEALCCHPLDTIKVRMQIYRRVAGIEHVKPPGFIKTGR 60

Query: 60  DISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNTFVAGVGA 119
            I  +EGFLALYKGLGAVVIGIIPKMAIRF+SYEF+RTLL ++++G+VSTGNTFVAGVGA
Sbjct: 61  TIYQKEGFLALYKGLGAVVIGIIPKMAIRFSSYEFYRTLLVNKESGIVSTGNTFVAGVGA 120

Query: 120 GITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKY 179
           GITEAV+VVNPMEVVKIRLQAQH+   P +                         A PKY
Sbjct: 121 GITEAVLVVNPMEVVKIRLQAQHL--TPSEPN-----------------------AGPKY 155

Query: 180 RNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPSW 239
            NAI AAY IVKEEG  ALYRGVSLTAARQATNQGANFTVYS LK  LQ YHQ D+LPSW
Sbjct: 156 NNAIHAAYTIVKEEGVSALYRGVSLTAARQATNQGANFTVYSKLKEFLQNYHQMDVLPSW 215

Query: 240 ETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTS--KDSGWSRILAIGRQLIREEGFRAL 297
           ETS IGLISGA+GPFSNAPLDTIKTRLQKDKS S  K SG  +I+ IG QL++EEGFRAL
Sbjct: 216 ETSCIGLISGAIGPFSNAPLDTIKTRLQKDKSISLEKQSGMKKIITIGAQLLKEEGFRAL 275

Query: 298 YKGITPRVMRVAPGQAVTFTVYELIRKKLEGL 329
           YKGITPRVMRVAPGQAVTFTVYE +R+ LE L
Sbjct: 276 YKGITPRVMRVAPGQAVTFTVYEYVREHLENL 307

>Scas_691.4
          Length = 334

 Score =  460 bits (1184), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 239/330 (72%), Positives = 258/330 (78%), Gaps = 21/330 (6%)

Query: 3   NRKNSSHPAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDIS 62
           N K SS P INLVAGGTAGLFEALCCHPLDTIKVRMQI  R   +G R  GFI T R+I 
Sbjct: 7   NDKKSS-PLINLVAGGTAGLFEALCCHPLDTIKVRMQIAKRT--EGMRPHGFITTGRNIY 63

Query: 63  TQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNTFVAGVGAGIT 122
           + EGFLALYKGLGAVVIGIIPKMAIRF+SYEF+R  L D++T  ++TGNTF+AGVGAGIT
Sbjct: 64  SHEGFLALYKGLGAVVIGIIPKMAIRFSSYEFYRNALTDKETRTITTGNTFLAGVGAGIT 123

Query: 123 EAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAAT---PKY 179
           EAV+VVNPMEVVKIRLQAQH+    L  Q AG                   AAT   PKY
Sbjct: 124 EAVLVVNPMEVVKIRLQAQHLN--DLIPQPAG-------------VSAAGTAATVTKPKY 168

Query: 180 RNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPSW 239
            NAI AAY IVKEEG  ALYRGVSLTAARQATNQGANFTVYS LK  LQ+YH  + LPSW
Sbjct: 169 ANAIHAAYTIVKEEGAGALYRGVSLTAARQATNQGANFTVYSYLKDYLQKYHNRESLPSW 228

Query: 240 ETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYK 299
           ETS IGLISGA+GPFSNAPLDTIKTRLQKDKS S +S W +I  IG QLI+EEGFRALYK
Sbjct: 229 ETSCIGLISGAIGPFSNAPLDTIKTRLQKDKSISSNSAWKKIYIIGTQLIKEEGFRALYK 288

Query: 300 GITPRVMRVAPGQAVTFTVYELIRKKLEGL 329
           GITPRVMRVAPGQAVTFTVYE +RK LE L
Sbjct: 289 GITPRVMRVAPGQAVTFTVYEFVRKHLETL 318

>CAGL0M09020g complement(896312..897358) highly similar to sp|P33303
           Saccharomyces cerevisiae YJR095w succinate-fumarate
           transporter, start by similarity
          Length = 348

 Score =  452 bits (1164), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 234/350 (66%), Positives = 256/350 (73%), Gaps = 54/350 (15%)

Query: 9   HPAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQ------------------- 49
           +P +NLVAGGTAGLFEALCCHPLDTIKVRMQIY R                         
Sbjct: 10  NPVVNLVAGGTAGLFEALCCHPLDTIKVRMQIYKRQAAPAAAAVASMAGGAGGAATATVG 69

Query: 50  --------RARGFIGTARDISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLAD 101
                   +  GFI T R+I  QEGFLALYKGLGAVVIGIIPKMAIRF+SYEF+RTLLAD
Sbjct: 70  GGDATAAIKPPGFIRTGRNIYAQEGFLALYKGLGAVVIGIIPKMAIRFSSYEFYRTLLAD 129

Query: 102 RQTGVVSTGNTFVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXX 161
           +QTGVVST NTF+AGVGAG+TEAV+VVNPMEVVKIRLQAQH+                  
Sbjct: 130 KQTGVVSTSNTFIAGVGAGVTEAVLVVNPMEVVKIRLQAQHLN----------------- 172

Query: 162 XXXXXXXXXENVAATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYS 221
                     +  A PKY NA+QA Y I+KEEG  ALYRGVSLTAARQATNQGANFTVYS
Sbjct: 173 --------PNHDLAKPKYTNAVQAGYTIIKEEGISALYRGVSLTAARQATNQGANFTVYS 224

Query: 222 TLKSRLQEYHQTDMLPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTS--KDSGWS 279
            L+  LQEYH T+ LPSWETS IGLISGA+GPFSNAPLDTIKTRLQKDKSTS   +SGW 
Sbjct: 225 KLREFLQEYHGTETLPSWETSCIGLISGAIGPFSNAPLDTIKTRLQKDKSTSFKGESGWK 284

Query: 280 RILAIGRQLIREEGFRALYKGITPRVMRVAPGQAVTFTVYELIRKKLEGL 329
           RI  IG QL++EEGFRALYKGITPRVMRVAPGQAVTFTVYE +R+ LE L
Sbjct: 285 RIAHIGTQLLKEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHLENL 334

>KLLA0F03212g 302915..303832 highly similar to sp|P33303
           Saccharomyces cerevisiae YJR095w ACR1 succinate-fumarate
           transporter, start by similarity
          Length = 305

 Score =  444 bits (1141), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 233/327 (71%), Positives = 256/327 (78%), Gaps = 27/327 (8%)

Query: 1   MSNRKNSSHPAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARD 60
           M++++ SS+PA+NL+AGG AGL E LCCHPLDTIKVRMQIY  A   G +A GFI T  +
Sbjct: 1   MASKQKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGE 60

Query: 61  ISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNTFVAGVGAG 120
           I   EGFLA YKGLGAVVIGI PKMAIRF+SYEF+RTLLAD++TG VSTGNTF+AGVGAG
Sbjct: 61  IYRNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAGVGAG 120

Query: 121 ITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYR 180
           ITEAV+VVNPMEVVKIRLQAQH+                             V   PKY+
Sbjct: 121 ITEAVVVVNPMEVVKIRLQAQHL---------------------------NPVEGAPKYK 153

Query: 181 NAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPSWE 240
           NA+QA Y IVKEEG  ALYRGVSLTAARQATNQGANFTVYS LK  LQ YH  +MLPSWE
Sbjct: 154 NAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANFTVYSKLKEFLQGYHNQEMLPSWE 213

Query: 241 TSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKG 300
           TSLIGLISGA+GPFSNAPLDTIKTRLQKDKST   SG  RI  IG+QLI+EEGFRALYKG
Sbjct: 214 TSLIGLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKG 273

Query: 301 ITPRVMRVAPGQAVTFTVYELIRKKLE 327
           ITPRVMRVAPGQAVTFT YE IRK+LE
Sbjct: 274 ITPRVMRVAPGQAVTFTAYEFIRKELE 300

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 46/220 (20%), Positives = 87/220 (39%), Gaps = 33/220 (15%)

Query: 112 TFVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXE 171
             +AG GAG+ E  +  +P++ +K+R+Q                                
Sbjct: 13  NLIAGGGAGLMEG-LCCHPLDTIKVRMQ----------------------------IYKN 43

Query: 172 NVAATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYH 231
            V +  K    I+    I + EG  A Y+G+              F+ Y   ++ L +  
Sbjct: 44  AVGSGVKAPGFIKTGGEIYRNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLAD-K 102

Query: 232 QTDMLPSWETSLIGL---ISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQL 288
           +T  + +  T + G+   I+ A+   +   +  I+ + Q          +   +     +
Sbjct: 103 ETGKVSTGNTFIAGVGAGITEAVVVVNPMEVVKIRLQAQHLNPVEGAPKYKNAVQACYTI 162

Query: 289 IREEGFRALYKGITPRVMRVAPGQAVTFTVYELIRKKLEG 328
           ++EEGF ALY+G++    R A  Q   FTVY  +++ L+G
Sbjct: 163 VKEEGFSALYRGVSLTAARQATNQGANFTVYSKLKEFLQG 202

 Score = 35.4 bits (80), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 25/41 (60%)

Query: 189 IVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQE 229
           +++EEG RALY+G++    R A  Q   FT Y  ++  L++
Sbjct: 261 LIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRKELEK 301

>YBR291C (CTP1) [469] chr2 complement(783631..784530) Mitochondrial
           inner membrane citrate transport protein, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [900 bp, 299 aa]
          Length = 299

 Score =  142 bits (359), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 97/329 (29%), Positives = 155/329 (47%), Gaps = 46/329 (13%)

Query: 1   MSNR--KNSSHPAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTA 58
           MS++  K+   P  + +AG  AG  EA   +P +  K R+Q+  +A +  +     I   
Sbjct: 1   MSSKATKSDVDPLHSFLAGSLAGAAEACITYPFEFAKTRLQLIDKASKASRNPLVLI--- 57

Query: 59  RDISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNTFVAGVG 118
              +  +G  ++Y G  A +IG   K  IRF  ++  + +L D +TG +S     +AG+G
Sbjct: 58  YKTAKTQGIGSIYVGCPAFIIGNTAKAGIRFLGFDTIKDMLRDSETGELSGTRGVIAGLG 117

Query: 119 AGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPK 178
           AG+ E+V  V P E +K  L                                +  +ATPK
Sbjct: 118 AGLLESVAAVTPFEAIKTAL------------------------------IDDKQSATPK 147

Query: 179 YRN----AIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTD 234
           Y N     ++    +V+++G   LYRGV   + RQA NQ      Y+ +K+ +Q+Y  + 
Sbjct: 148 YHNNGRGVVRNYSSLVRDKGFSGLYRGVLPVSMRQAANQAVRLGCYNKIKTLIQDYTDSP 207

Query: 235 M---LPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIRE 291
               L S  T L+G  SG +  +S  PLDT+KTR+Q   ST     +S  +     + +E
Sbjct: 208 KDKPLSSGLTFLVGAFSGIVTVYSTMPLDTVKTRMQSLDSTK----YSSTMNCFATIFKE 263

Query: 292 EGFRALYKGITPRVMRVAPGQAVTFTVYE 320
           EG +  +KG TPR+ R+     + FT+YE
Sbjct: 264 EGLKTFWKGATPRLGRLVLSGGIVFTIYE 292

 Score = 54.3 bits (129), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 56/217 (25%), Positives = 84/217 (38%), Gaps = 37/217 (17%)

Query: 111 NTFVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXX 170
           ++F+AG  AG  EA  +  P E  K RLQ                               
Sbjct: 14  HSFLAGSLAGAAEAC-ITYPFEFAKTRLQLID---------------------------- 44

Query: 171 ENVAATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEY 230
               A+   RN +   Y   K +G  ++Y G            G  F  + T+K  L++ 
Sbjct: 45  ---KASKASRNPLVLIYKTAKTQGIGSIYVGCPAFIIGNTAKAGIRFLGFDTIKDMLRD- 100

Query: 231 HQTDMLPSWETSLIGLISGALGPFSN-APLDTIKTRLQKDKSTSKDSGWSRILAIGRQ-- 287
            +T  L      + GL +G L   +   P + IKT L  DK ++     +    + R   
Sbjct: 101 SETGELSGTRGVIAGLGAGLLESVAAVTPFEAIKTALIDDKQSATPKYHNNGRGVVRNYS 160

Query: 288 -LIREEGFRALYKGITPRVMRVAPGQAVTFTVYELIR 323
            L+R++GF  LY+G+ P  MR A  QAV    Y  I+
Sbjct: 161 SLVRDKGFSGLYRGVLPVSMRQAANQAVRLGCYNKIK 197

 Score = 29.6 bits (65), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 35/89 (39%), Gaps = 5/89 (5%)

Query: 12  INLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALY 71
           +  + G  +G+       PLDT+K RMQ     +         +     I  +EG    +
Sbjct: 216 LTFLVGAFSGIVTVYSTMPLDTVKTRMQSLDSTKYSST-----MNCFATIFKEEGLKTFW 270

Query: 72  KGLGAVVIGIIPKMAIRFTSYEFFRTLLA 100
           KG    +  ++    I FT YE    +LA
Sbjct: 271 KGATPRLGRLVLSGGIVFTIYEKVLVMLA 299

>CAGL0L02079g 243467..244360 highly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, hypothetical start
          Length = 297

 Score =  142 bits (358), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 100/329 (30%), Positives = 155/329 (47%), Gaps = 48/329 (14%)

Query: 1   MSNRKNSSHPAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARD 60
           MS       P  + VAG  AG  EA   +P +  K R+Q+  ++ +  +     I    +
Sbjct: 1   MSKDSKKVDPTKSFVAGALAGAVEASITYPFEFAKTRLQLIDKSSKASRNPLVLI---YN 57

Query: 61  ISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNTFVAGVGAG 120
            +  +G  A+Y G  A ++G   K A RF  Y+  R LL D++TG +S     +AG+GAG
Sbjct: 58  TAKTQGVGAIYVGCPAFIVGNTAKAATRFLGYDTIRNLLKDKKTGELSGPRGVLAGLGAG 117

Query: 121 ITEAVMVVNPMEVVKIRL--QAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPK 178
           + E+V+ V P E +K  L    Q VR                                PK
Sbjct: 118 LLESVVAVTPFEAIKTVLIDDKQSVR--------------------------------PK 145

Query: 179 YRN---AIQAAYV-IVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYH--- 231
           Y+N   ++   Y+ +VK+EG R LY GV   + RQA NQ      Y+ +K  +Q+Y    
Sbjct: 146 YQNNGRSMARNYISLVKDEGFRGLYGGVLPVSMRQAANQAVRLGCYNKIKVLVQDYTGAP 205

Query: 232 QTDMLPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIRE 291
           +   L S  T ++G  SG +  ++  P+DT+KTR+Q   +    S +S  L     + +E
Sbjct: 206 KDKPLTSGLTFIVGAFSGVVTVYATMPIDTVKTRMQSLTA----SKYSSTLNCFTTIYKE 261

Query: 292 EGFRALYKGITPRVMRVAPGQAVTFTVYE 320
           EG +  +KG TPR+ R+     + FT+YE
Sbjct: 262 EGLKTFWKGATPRLGRLILSGGIVFTIYE 290

 Score = 55.8 bits (133), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 59/221 (26%), Positives = 85/221 (38%), Gaps = 37/221 (16%)

Query: 107 VSTGNTFVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXX 166
           V    +FVAG  AG  EA  +  P E  K RLQ                           
Sbjct: 8   VDPTKSFVAGALAGAVEA-SITYPFEFAKTRLQLID------------------------ 42

Query: 167 XXXXENVAATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSR 226
                   ++   RN +   Y   K +G  A+Y G               F  Y T+++ 
Sbjct: 43  -------KSSKASRNPLVLIYNTAKTQGVGAIYVGCPAFIVGNTAKAATRFLGYDTIRNL 95

Query: 227 LQEYHQTDMLPSWETSLIGLISGAL-GPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIG 285
           L++  +T  L      L GL +G L    +  P + IKT L  DK + +    +   ++ 
Sbjct: 96  LKD-KKTGELSGPRGVLAGLGAGLLESVVAVTPFEAIKTVLIDDKQSVRPKYQNNGRSMA 154

Query: 286 RQ---LIREEGFRALYKGITPRVMRVAPGQAVTFTVYELIR 323
           R    L+++EGFR LY G+ P  MR A  QAV    Y  I+
Sbjct: 155 RNYISLVKDEGFRGLYGGVLPVSMRQAANQAVRLGCYNKIK 195

 Score = 47.4 bits (111), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 54/222 (24%), Positives = 90/222 (40%), Gaps = 51/222 (22%)

Query: 14  LVAGGTAGLFEALCC-HPLDTIKV-----RMQIYSRAREQGQR-ARGFIGTARDISTQEG 66
           ++AG  AGL E++    P + IK      +  +  + +  G+  AR +I   +D    EG
Sbjct: 110 VLAGLGAGLLESVVAVTPFEAIKTVLIDDKQSVRPKYQNNGRSMARNYISLVKD----EG 165

Query: 67  FLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGV-----VSTGNTFVAGVGAGI 121
           F  LY G+  V +      A+R   Y   + L+ D  TG      +++G TF+ G  +G+
Sbjct: 166 FRGLYGGVLPVSMRQAANQAVRLGCYNKIKVLVQD-YTGAPKDKPLTSGLTFIVGAFSGV 224

Query: 122 TEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRN 181
              V    P++ VK R+Q+           L  S                      KY +
Sbjct: 225 V-TVYATMPIDTVKTRMQS-----------LTAS----------------------KYSS 250

Query: 182 AIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTL 223
            +     I KEEG +  ++G +    R   + G  FT+Y  +
Sbjct: 251 TLNCFTTIYKEEGLKTFWKGATPRLGRLILSGGIVFTIYENV 292

>Sklu_1149.2 YBR291C, Contig c1149 2019-2909 reverse complement
          Length = 296

 Score =  136 bits (343), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 93/322 (28%), Positives = 154/322 (47%), Gaps = 46/322 (14%)

Query: 9   HPAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFL 68
            P+ + +AG  AG  EA   +P +  K R+Q+  +A +  +     I    + +  +G  
Sbjct: 8   DPSKSFIAGCLAGAVEASVTYPFEFAKTRLQLLDKASKASRNPLVLI---YNTAKTQGIG 64

Query: 69  ALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNTFVAGVGAGITEAVMVV 128
           ++Y G  A ++G   K  +RF  ++  + LL D +TG +S     +AG+GAG+ E+V+ V
Sbjct: 65  SVYVGCPAFIVGNTAKAGVRFLGFDTIKNLLRDPKTGELSGPRGVIAGLGAGLLESVVAV 124

Query: 129 NPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRN----AIQ 184
            P E +K  L                                +  +ATPKY N     ++
Sbjct: 125 TPFEAIKTAL------------------------------IDDKQSATPKYHNNGKGMLR 154

Query: 185 AAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYH---QTDMLPSWET 241
               +V+++G   LYRGV   + RQA NQ      Y+ +K  +Q+Y    +   L S  T
Sbjct: 155 NYTALVRKQGLSGLYRGVLPVSMRQAANQAVRLGCYNKIKVMVQDYTNAPKDKPLSSGLT 214

Query: 242 SLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSG-WSRILAIGRQLIREEGFRALYKG 300
            ++G  SG +  ++  P+DT+KTR+Q     S DS  +S  +     + +EEG +A +KG
Sbjct: 215 FVVGAFSGIVTVYTTMPIDTVKTRMQ-----SLDSKRYSSTINCFTTIFKEEGLKAFWKG 269

Query: 301 ITPRVMRVAPGQAVTFTVYELI 322
            TPR+ R+     + FTVYE +
Sbjct: 270 ATPRLGRLFLSGGIVFTVYEKV 291

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 58/225 (25%), Positives = 86/225 (38%), Gaps = 37/225 (16%)

Query: 103 QTGVVSTGNTFVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXX 162
           Q+  V    +F+AG  AG  EA  V  P E  K RLQ                       
Sbjct: 3   QSKQVDPSKSFIAGCLAGAVEA-SVTYPFEFAKTRLQLLD-------------------- 41

Query: 163 XXXXXXXXENVAATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYST 222
                       A+   RN +   Y   K +G  ++Y G            G  F  + T
Sbjct: 42  -----------KASKASRNPLVLIYNTAKTQGIGSVYVGCPAFIVGNTAKAGVRFLGFDT 90

Query: 223 LKSRLQEYHQTDMLPSWETSLIGLISGAL-GPFSNAPLDTIKTRLQKDKSTSKDSGWSRI 281
           +K+ L++  +T  L      + GL +G L    +  P + IKT L  DK ++     +  
Sbjct: 91  IKNLLRD-PKTGELSGPRGVIAGLGAGLLESVVAVTPFEAIKTALIDDKQSATPKYHNNG 149

Query: 282 LAIGRQ---LIREEGFRALYKGITPRVMRVAPGQAVTFTVYELIR 323
             + R    L+R++G   LY+G+ P  MR A  QAV    Y  I+
Sbjct: 150 KGMLRNYTALVRKQGLSGLYRGVLPVSMRQAANQAVRLGCYNKIK 194

 Score = 33.5 bits (75), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 36/88 (40%), Gaps = 5/88 (5%)

Query: 12  INLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALY 71
           +  V G  +G+       P+DT+K RMQ         +R    I     I  +EG  A +
Sbjct: 213 LTFVVGAFSGIVTVYTTMPIDTVKTRMQ-----SLDSKRYSSTINCFTTIFKEEGLKAFW 267

Query: 72  KGLGAVVIGIIPKMAIRFTSYEFFRTLL 99
           KG    +  +     I FT YE   T+L
Sbjct: 268 KGATPRLGRLFLSGGIVFTVYEKVLTVL 295

>KLLA0E18810g 1663220..1664353 some similarities with sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, mitochondrial (MCF), hypothetical start
          Length = 377

 Score =  137 bits (345), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 95/328 (28%), Positives = 157/328 (47%), Gaps = 46/328 (14%)

Query: 1   MSNRKNSSHPAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARD 60
           MS+ K +  P  + +AG  AG  EA   +P +  K R+Q+  +A +  +     I    +
Sbjct: 81  MSSNKPAVDPFHSFLAGSIAGAIEASITYPFEFAKTRLQLVDKASKASRNPLVLI---YN 137

Query: 61  ISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNTFVAGVGAG 120
                G  ++Y G  A ++G   K  IRF  ++  + LL D++TG +S     VAG+GAG
Sbjct: 138 TGKNYGISSIYVGCPAFIVGNTAKAGIRFLGFDTIKNLLRDKKTGELSGFRGVVAGLGAG 197

Query: 121 ITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYR 180
           + E+V+ V P E +K  L                                +  AA PKY+
Sbjct: 198 LLESVVAVTPFEAIKTAL------------------------------IDDKQAAVPKYQ 227

Query: 181 N---AIQAAYV-IVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYH---QT 233
           N    + + Y  ++ ++G   LYRGV   + RQA NQ      Y+ +K+ +Q+Y    + 
Sbjct: 228 NNGKGMVSNYAKLLSDQGFSGLYRGVLPVSMRQAANQAVRLGCYNKIKTLVQDYTNVPKD 287

Query: 234 DMLPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSG-WSRILAIGRQLIREE 292
             L S  T ++G  SG +  ++  P+DT+KTR+Q     S ++G +S  +     + +EE
Sbjct: 288 KPLSSGLTFIVGAFSGIVTVYTTMPIDTVKTRMQ-----SLNAGQYSSTINCFATIFKEE 342

Query: 293 GFRALYKGITPRVMRVAPGQAVTFTVYE 320
           G +  +KG TPR+ R+     + FT+YE
Sbjct: 343 GLKTFWKGATPRLGRLILSGGIVFTIYE 370

 Score = 52.0 bits (123), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 63/274 (22%), Positives = 105/274 (38%), Gaps = 43/274 (15%)

Query: 59  RDISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTG----VVSTGNTFV 114
           R  S +E     +K L +  + ++   ++ F S + +     +         V   ++F+
Sbjct: 36  RTASYKESLFNCFKRLSSFQLCLVLFYSVLFFSAQIYELTQCESTMSSNKPAVDPFHSFL 95

Query: 115 AGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVA 174
           AG  AG  EA  +  P E  K RLQ                                   
Sbjct: 96  AGSIAGAIEA-SITYPFEFAKTRLQLVD-------------------------------K 123

Query: 175 ATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTD 234
           A+   RN +   Y   K  G  ++Y G            G  F  + T+K+ L++  +T 
Sbjct: 124 ASKASRNPLVLIYNTGKNYGISSIYVGCPAFIVGNTAKAGIRFLGFDTIKNLLRD-KKTG 182

Query: 235 MLPSWETSLIGLISGAL-GPFSNAPLDTIKTRLQKDKSTS----KDSGWSRILAIGRQLI 289
            L  +   + GL +G L    +  P + IKT L  DK  +    +++G   +    + L+
Sbjct: 183 ELSGFRGVVAGLGAGLLESVVAVTPFEAIKTALIDDKQAAVPKYQNNGKGMVSNYAK-LL 241

Query: 290 REEGFRALYKGITPRVMRVAPGQAVTFTVYELIR 323
            ++GF  LY+G+ P  MR A  QAV    Y  I+
Sbjct: 242 SDQGFSGLYRGVLPVSMRQAANQAVRLGCYNKIK 275

 Score = 32.3 bits (72), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 39/89 (43%), Gaps = 5/89 (5%)

Query: 12  INLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALY 71
           +  + G  +G+       P+DT+K RMQ    +   GQ +   I     I  +EG    +
Sbjct: 294 LTFIVGAFSGIVTVYTTMPIDTVKTRMQ----SLNAGQYSST-INCFATIFKEEGLKTFW 348

Query: 72  KGLGAVVIGIIPKMAIRFTSYEFFRTLLA 100
           KG    +  +I    I FT YE   T+LA
Sbjct: 349 KGATPRLGRLILSGGIVFTIYEKVLTVLA 377

>Scas_489.4
          Length = 297

 Score =  133 bits (335), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 91/327 (27%), Positives = 150/327 (45%), Gaps = 44/327 (13%)

Query: 1   MSNRKNSSHPAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARD 60
           MS  K    P  + +AG  AG  EA   +P +  K R+Q+  +     +     I    +
Sbjct: 1   MSQEKKPVDPLHSFIAGALAGAIEASITYPFEFAKTRLQLIDKTSTASRNPLVLI---YN 57

Query: 61  ISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNTFVAGVGAG 120
            +  +G  A+Y G  A ++G   K  IRF  ++  + +L D  TG +S     VAG+GAG
Sbjct: 58  TAKTQGTGAIYVGCPAFIVGNTAKAGIRFLGFDTIKNMLRDPVTGELSGPRGVVAGLGAG 117

Query: 121 ITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYR 180
           + E+V+ V P E +K  L                                +  A  PKY+
Sbjct: 118 LLESVVAVTPFEAIKTAL------------------------------IDDKQALKPKYQ 147

Query: 181 N----AIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDM- 235
           N     ++    +V+++G   LYRGV   + RQA NQ      Y+ +K+ +Q+Y      
Sbjct: 148 NNGRGMLRNYGSLVRDQGIMGLYRGVLPVSMRQAANQAVRLGCYNKIKTMVQDYTNAPKD 207

Query: 236 --LPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEG 293
             L S  T ++G  SG +  ++  P+DT+KTR+Q   +T     ++  +    ++ +EEG
Sbjct: 208 RPLSSGLTFIVGAFSGVVTVYTTMPIDTVKTRMQSLDATK----YTSTVNCFAKIFKEEG 263

Query: 294 FRALYKGITPRVMRVAPGQAVTFTVYE 320
            +  +KG TPR+ R+     + FT+YE
Sbjct: 264 LKTFWKGATPRLGRLILSGGIVFTIYE 290

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 44/153 (28%), Positives = 67/153 (43%), Gaps = 7/153 (4%)

Query: 180 RNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPSW 239
           RN +   Y   K +G  A+Y G            G  F  + T+K+ L++   T  L   
Sbjct: 49  RNPLVLIYNTAKTQGTGAIYVGCPAFIVGNTAKAGIRFLGFDTIKNMLRD-PVTGELSGP 107

Query: 240 ETSLIGLISGAL-GPFSNAPLDTIKTRLQKDKSTSK----DSGWSRILAIGRQLIREEGF 294
              + GL +G L    +  P + IKT L  DK   K    ++G   +   G  L+R++G 
Sbjct: 108 RGVVAGLGAGLLESVVAVTPFEAIKTALIDDKQALKPKYQNNGRGMLRNYG-SLVRDQGI 166

Query: 295 RALYKGITPRVMRVAPGQAVTFTVYELIRKKLE 327
             LY+G+ P  MR A  QAV    Y  I+  ++
Sbjct: 167 MGLYRGVLPVSMRQAANQAVRLGCYNKIKTMVQ 199

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 50/217 (23%), Positives = 87/217 (40%), Gaps = 41/217 (18%)

Query: 14  LVAGGTAGLFEALCC-HPLDTIKVRMQIYSRAREQG--QRARGFIGTARDISTQEGFLAL 70
           +VAG  AGL E++    P + IK  +    +A +       RG +     +   +G + L
Sbjct: 110 VVAGLGAGLLESVVAVTPFEAIKTALIDDKQALKPKYQNNGRGMLRNYGSLVRDQGIMGL 169

Query: 71  YKGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGV----VSTGNTFVAGVGAGITEAVM 126
           Y+G+  V +      A+R   Y   +T++ D         +S+G TF+ G  +G+   V 
Sbjct: 170 YRGVLPVSMRQAANQAVRLGCYNKIKTMVQDYTNAPKDRPLSSGLTFIVGAFSGVV-TVY 228

Query: 127 VVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAA 186
              P++ VK R+Q+                                + AT KY + +   
Sbjct: 229 TTMPIDTVKTRMQS--------------------------------LDAT-KYTSTVNCF 255

Query: 187 YVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTL 223
             I KEEG +  ++G +    R   + G  FT+Y  +
Sbjct: 256 AKIFKEEGLKTFWKGATPRLGRLILSGGIVFTIYENV 292

>Kwal_26.7967
          Length = 297

 Score =  133 bits (334), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 91/325 (28%), Positives = 150/325 (46%), Gaps = 44/325 (13%)

Query: 3   NRKNSSHPAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDIS 62
           ++K    P  + +AG  AG  EA   +P +  K R+Q+  ++    +     I     + 
Sbjct: 2   SQKKQVDPLHSFLAGSLAGAVEASITYPFEFAKTRLQLVDKSSTASRNPLTLIYRTAKV- 60

Query: 63  TQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNTFVAGVGAGIT 122
             +G  A+Y G  A ++G   K  +RF  ++  + +L D  TG +S     VAG+GAG+ 
Sbjct: 61  --QGLGAVYVGCPAFIVGNTAKAGVRFLGFDAIKNILRDPTTGELSGPRGIVAGLGAGLL 118

Query: 123 EAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRN- 181
           E+V+ V P E +K  L                                +  +A+PKY N 
Sbjct: 119 ESVVAVTPFEAIKTAL------------------------------IDDKQSASPKYHNN 148

Query: 182 ---AIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQT---DM 235
               ++    +V ++G   LYRGV   + RQA NQ      Y+ +K+ +Q+Y  +     
Sbjct: 149 GRGMLRNYSSLVYDKGFSGLYRGVLPVSMRQAANQAVRLGCYNKIKTMIQDYTNSAKDKP 208

Query: 236 LPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFR 295
           L S  T ++G  SG +  ++  P+DT+KTR+Q   S    S +S  +     + REEG +
Sbjct: 209 LSSGMTFVVGAFSGIVTVYTTMPIDTVKTRMQSLDS----SKYSSTINCFATVFREEGLK 264

Query: 296 ALYKGITPRVMRVAPGQAVTFTVYE 320
             +KG TPR+ R+     + FT+YE
Sbjct: 265 TFWKGATPRLGRLILSGGIVFTIYE 289

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 56/221 (25%), Positives = 85/221 (38%), Gaps = 37/221 (16%)

Query: 111 NTFVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXX 170
           ++F+AG  AG  EA  +  P E  K RLQ         K+  A                 
Sbjct: 11  HSFLAGSLAGAVEA-SITYPFEFAKTRLQLVD------KSSTAS---------------- 47

Query: 171 ENVAATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEY 230
                    RN +   Y   K +G  A+Y G            G  F  +  +K+ L++ 
Sbjct: 48  ---------RNPLTLIYRTAKVQGLGAVYVGCPAFIVGNTAKAGVRFLGFDAIKNILRD- 97

Query: 231 HQTDMLPSWETSLIGLISGAL-GPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQ-- 287
             T  L      + GL +G L    +  P + IKT L  DK ++     +    + R   
Sbjct: 98  PTTGELSGPRGIVAGLGAGLLESVVAVTPFEAIKTALIDDKQSASPKYHNNGRGMLRNYS 157

Query: 288 -LIREEGFRALYKGITPRVMRVAPGQAVTFTVYELIRKKLE 327
            L+ ++GF  LY+G+ P  MR A  QAV    Y  I+  ++
Sbjct: 158 SLVYDKGFSGLYRGVLPVSMRQAANQAVRLGCYNKIKTMIQ 198

>Scas_640.25
          Length = 306

 Score =  130 bits (327), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 97/338 (28%), Positives = 150/338 (44%), Gaps = 65/338 (19%)

Query: 1   MSNRKNSSHPA---INLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRA---RGF 54
           MS+  N+  P       +AG  AG+ E +  +PLD +K RMQ+       G  A   +G 
Sbjct: 1   MSSNHNTQAPLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGV 60

Query: 55  IGTARDISTQEGFLALYKGLGAVVIGIIPKMAIRFTSY-EFFRTLLADRQTGVVSTGNTF 113
           I     I  +EG + +YKG+ + ++   PK A++F S  EF +   +   T  ++   + 
Sbjct: 61  IDCLSQIVKKEGPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISV 120

Query: 114 VAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENV 173
           ++G  AGITEA+++V P E+VKIRLQ                                  
Sbjct: 121 LSGASAGITEALVIV-PFELVKIRLQ---------------------------------- 145

Query: 174 AATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRL------ 227
               K++  ++    I+K++G + LY GV  T  R A      F V   ++  L      
Sbjct: 146 DVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYFGVIFQVRELLPVAKSK 205

Query: 228 QEYHQTDMLPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKST------SKDSGWSRI 281
           QE  + D+         G + G  G   N P D +K+R+Q D +         +  W  +
Sbjct: 206 QEKTRNDLCA-------GFVGGTFGVMFNTPFDVVKSRIQSDGNEIINGVRKYNWTWPSV 258

Query: 282 LAIGRQLIREEGFRALYKGITPRVMRVAPGQAVTFTVY 319
           + I      EEGFRALYKG  P+V+R+ PG AV   V+
Sbjct: 259 MKI----YHEEGFRALYKGFVPKVLRLGPGGAVLLVVF 292

 Score = 64.7 bits (156), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 60/218 (27%), Positives = 93/218 (42%), Gaps = 39/218 (17%)

Query: 113 FVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXEN 172
           F+AG  AGI+E +MV+ P++VVK R+Q Q      +    AG                  
Sbjct: 17  FMAGAIAGISE-LMVMYPLDVVKTRMQLQ------VSTGAAG------------------ 51

Query: 173 VAATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQ 232
            A+   Y+  I     IVK+EGP  +Y+G+S     +A  +   F          +    
Sbjct: 52  -ASATHYKGVIDCLSQIVKKEGPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFG 110

Query: 233 TDMLPSWETSLIGLISGALGPFSNA----PLDTIKTRLQKDKSTSKDSGWSRILAIGRQL 288
           T  L    T  I ++SGA    + A    P + +K RLQ   S  K       + + + +
Sbjct: 111 TKQL----TQQISVLSGASAGITEALVIVPFELVKIRLQDVNSKFKGP-----VEVLKHI 161

Query: 289 IREEGFRALYKGITPRVMRVAPGQAVTFTVYELIRKKL 326
           I+++G + LY G+   V R A   A  F V   +R+ L
Sbjct: 162 IKQDGLKGLYSGVESTVWRNAVWNAGYFGVIFQVRELL 199

>YPR021C (AGC1) [5455] chr16 complement(600644..603352) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [2709 bp, 902 aa]
          Length = 902

 Score =  136 bits (342), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 101/316 (31%), Positives = 144/316 (45%), Gaps = 42/316 (13%)

Query: 13  NLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYK 72
           N   G  AG   A   +P+D IK RMQ    A+    + +  I     I ++EG   LY 
Sbjct: 533 NFSLGSIAGCIGATVVYPIDFIKTRMQ----AQRSLAQYKNSIDCLLKIISREGIKGLYS 588

Query: 73  GLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNTFVAGVGAGITEAVMVVNPME 132
           GLG  +IG+ P+ AI+ T  +F R  L D+  G +S     ++G  AG  + V+  NP+E
Sbjct: 589 GLGPQLIGVAPEKAIKLTVNDFMRNRLTDK-NGKLSLFPEIISGASAGACQ-VIFTNPLE 646

Query: 133 VVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAAYVIVKE 192
           +VKIRLQ Q        +   G                EN+      + A + A  IVK+
Sbjct: 647 IVKIRLQVQ--------SDYVG----------------ENI------QQANETATQIVKK 676

Query: 193 EGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDM-----LPSWETSLIGLI 247
            G R LY GV+    R        F  Y+ LK  L ++   D      L +WE    G I
Sbjct: 677 LGLRGLYNGVAACLMRDVPFSAIYFPTYAHLKKDLFDFDPNDKTKRNRLKTWELLTAGAI 736

Query: 248 SGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITPRVMR 307
           +G    F   P D IKTRLQ D     ++ ++ I    R +++EE FR+ +KG   RV+R
Sbjct: 737 AGMPAAFLTTPFDVIKTRLQIDPRKG-ETKYNGIFHAIRTILKEESFRSFFKGGGARVLR 795

Query: 308 VAPGQAVTFTVYELIR 323
            +P    T   YEL +
Sbjct: 796 SSPQFGFTLAAYELFK 811

 Score = 57.0 bits (136), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 59/229 (25%), Positives = 90/229 (39%), Gaps = 43/229 (18%)

Query: 3   NRKNSSHPAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSR-AREQGQRARGFIGTARDI 61
           N K S  P I  ++G +AG  + +  +PL+ +K+R+Q+ S    E  Q+A     TA  I
Sbjct: 619 NGKLSLFPEI--ISGASAGACQVIFTNPLEIVKIRLQVQSDYVGENIQQAN---ETATQI 673

Query: 62  STQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLAD------RQTGVVSTGNTFVA 115
             + G   LY G+ A ++  +P  AI F +Y   +  L D       +   + T     A
Sbjct: 674 VKKLGLRGLYNGVAACLMRDVPFSAIYFPTYAHLKKDLFDFDPNDKTKRNRLKTWELLTA 733

Query: 116 GVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAA 175
           G  AG+  A +   P +V+K RLQ       P K +                        
Sbjct: 734 GAIAGMPAAFLTT-PFDVIKTRLQID-----PRKGE------------------------ 763

Query: 176 TPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLK 224
             KY     A   I+KEE  R+ ++G      R +   G     Y   K
Sbjct: 764 -TKYNGIFHAIRTILKEESFRSFFKGGGARVLRSSPQFGFTLAAYELFK 811

 Score = 55.1 bits (131), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 52/215 (24%), Positives = 85/215 (39%), Gaps = 36/215 (16%)

Query: 112 TFVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXE 171
            F  G  AG   A  VV P++ +K R+QAQ                              
Sbjct: 533 NFSLGSIAGCIGAT-VVYPIDFIKTRMQAQR----------------------------- 562

Query: 172 NVAATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYH 231
              +  +Y+N+I     I+  EG + LY G+       A  +    TV   +++RL +  
Sbjct: 563 ---SLAQYKNSIDCLLKIISREGIKGLYSGLGPQLIGVAPEKAIKLTVNDFMRNRLTD-- 617

Query: 232 QTDMLPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIRE 291
           +   L  +   + G  +GA       PL+ +K RLQ  +S        +      Q++++
Sbjct: 618 KNGKLSLFPEIISGASAGACQVIFTNPLEIVKIRLQV-QSDYVGENIQQANETATQIVKK 676

Query: 292 EGFRALYKGITPRVMRVAPGQAVTFTVYELIRKKL 326
            G R LY G+   +MR  P  A+ F  Y  ++K L
Sbjct: 677 LGLRGLYNGVAACLMRDVPFSAIYFPTYAHLKKDL 711

>Scas_602.8
          Length = 885

 Score =  128 bits (322), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 97/318 (30%), Positives = 143/318 (44%), Gaps = 42/318 (13%)

Query: 12  INLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALY 71
            N   G  AG   A   +P+D IK RMQ    A+    + +  I     I  +EG   LY
Sbjct: 500 FNFSLGSVAGCIGATLVYPIDFIKTRMQ----AQRSLTKYKNSIDCLVKIFGKEGIRGLY 555

Query: 72  KGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNTFVAGVGAGITEAVMVVNPM 131
            GLG  +IG+ P+ AI+ T  +F R  L D++ G +  G   ++G  AG  + V   NP+
Sbjct: 556 SGLGPQLIGVAPEKAIKLTVNDFMRKSLVDKK-GNLQLGAEVLSGATAGACQVVFT-NPL 613

Query: 132 EVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAAYVIVK 191
           E+VKIRLQ        +K++                      A  PK   +   A+ I+K
Sbjct: 614 EIVKIRLQ--------VKSEYTN-------------------AMIPK---SQLTAFQIIK 643

Query: 192 EEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYH-----QTDMLPSWETSLIGL 246
           E     LY+GV     R        F  Y+ LK  + ++      + D L +WE    G 
Sbjct: 644 ELKLIGLYKGVGACLLRDVPFSAIYFPTYAHLKKNVFQFDPNDKDKRDRLKTWELLTAGA 703

Query: 247 ISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITPRVM 306
           ++G    F   P D IKTRLQ +     ++ ++ IL   R +++EE FR+ +KG   RVM
Sbjct: 704 LAGVPAAFLTTPFDVIKTRLQIEPGVG-ETRYTGILHAVRTILKEESFRSFFKGGAARVM 762

Query: 307 RVAPGQAVTFTVYELIRK 324
           R +P    T   YEL + 
Sbjct: 763 RSSPQFGFTLAAYELFKN 780

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 49/83 (59%), Gaps = 3/83 (3%)

Query: 244 IGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITP 303
           +G ++G +G     P+D IKTR+Q  +S +K   +   +    ++  +EG R LY G+ P
Sbjct: 504 LGSVAGCIGATLVYPIDFIKTRMQAQRSLTK---YKNSIDCLVKIFGKEGIRGLYSGLGP 560

Query: 304 RVMRVAPGQAVTFTVYELIRKKL 326
           +++ VAP +A+  TV + +RK L
Sbjct: 561 QLIGVAPEKAIKLTVNDFMRKSL 583

 Score = 48.1 bits (113), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 55/216 (25%), Positives = 86/216 (39%), Gaps = 38/216 (17%)

Query: 112 TFVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXE 171
            F  G  AG   A +V  P++ +K R+QAQ                              
Sbjct: 501 NFSLGSVAGCIGATLVY-PIDFIKTRMQAQR----------------------------- 530

Query: 172 NVAATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYH 231
              +  KY+N+I     I  +EG R LY G+       A  +    TV   ++  L +  
Sbjct: 531 ---SLTKYKNSIDCLVKIFGKEGIRGLYSGLGPQLIGVAPEKAIKLTVNDFMRKSLVD-- 585

Query: 232 QTDMLPSWETSLIGLISGALGPFSNAPLDTIKTRLQ-KDKSTSKDSGWSRILAIGRQLIR 290
           +   L      L G  +GA       PL+ +K RLQ K + T+     S++ A   Q+I+
Sbjct: 586 KKGNLQLGAEVLSGATAGACQVVFTNPLEIVKIRLQVKSEYTNAMIPKSQLTAF--QIIK 643

Query: 291 EEGFRALYKGITPRVMRVAPGQAVTFTVYELIRKKL 326
           E     LYKG+   ++R  P  A+ F  Y  ++K +
Sbjct: 644 ELKLIGLYKGVGACLLRDVPFSAIYFPTYAHLKKNV 679

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/111 (30%), Positives = 48/111 (43%), Gaps = 6/111 (5%)

Query: 14  LVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYKG 73
           L AG  AG+  A    P D IK R+QI     E   R  G +   R I  +E F + +KG
Sbjct: 699 LTAGALAGVPAAFLTTPFDVIKTRLQIEPGVGET--RYTGILHAVRTILKEESFRSFFKG 756

Query: 74  LGAVVIGIIPKMAIRFTSYEFFRTLL---ADRQ-TGVVSTGNTFVAGVGAG 120
             A V+   P+      +YE F+ +     D+Q T    +   +   VG G
Sbjct: 757 GAARVMRSSPQFGFTLAAYELFKNMFNISDDKQPTKNEKSTEDYNDSVGTG 807

>ADL049W [1692] [Homologous to ScYPR021C - SH]
           complement(598135..600873) [2739 bp, 912 aa]
          Length = 912

 Score =  122 bits (307), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 95/317 (29%), Positives = 140/317 (44%), Gaps = 43/317 (13%)

Query: 13  NLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYK 72
           N   G  AG   A+  +P+D +K RMQ    A+    + +  I     I ++EG   LY 
Sbjct: 527 NFTLGSVAGCIGAMVVYPIDMVKTRMQ----AQRDFSKYKNSIDCLLKILSKEGVRGLYS 582

Query: 73  GLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNTFVAGVGAGITEAVMVVNPME 132
           GLG  +IG+ P+ AI+ T  +  R  LA R  G +S     ++G  AG  + V+  NP+E
Sbjct: 583 GLGPQLIGVAPEKAIKLTVNDHMRATLAGRD-GKLSLPCEIISGATAGACQ-VVFTNPLE 640

Query: 133 VVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAAYVIVKE 192
           +VKIRLQ +   YV   A                             RN++ A  VI K 
Sbjct: 641 IVKIRLQVK-SDYVADAA-----------------------------RNSVNAISVI-KN 669

Query: 193 EGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTD-----MLPSWETSLIGLI 247
            G   LYRG      R        F  Y+ +KS +  +   D      L +W+  + G +
Sbjct: 670 LGLIGLYRGAGACLLRDIPFSAIYFPTYAHIKSNVFNFDPKDSDKRNKLNTWQLLVSGGL 729

Query: 248 SGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITPRVMR 307
           +G    F   P D IKTRLQ D     +S ++ I    R +++EEG ++ +KG   RV+R
Sbjct: 730 AGMPAAFLTTPFDVIKTRLQIDPKKG-ESVYNGIWDAARTILKEEGIKSFFKGGPARVLR 788

Query: 308 VAPGQAVTFTVYELIRK 324
            +P    T   YE+   
Sbjct: 789 SSPQFGFTLAAYEIFHN 805

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 49/85 (57%), Gaps = 3/85 (3%)

Query: 244 IGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITP 303
           +G ++G +G     P+D +KTR+Q  +  SK   +   +    +++ +EG R LY G+ P
Sbjct: 530 LGSVAGCIGAMVVYPIDMVKTRMQAQRDFSK---YKNSIDCLLKILSKEGVRGLYSGLGP 586

Query: 304 RVMRVAPGQAVTFTVYELIRKKLEG 328
           +++ VAP +A+  TV + +R  L G
Sbjct: 587 QLIGVAPEKAIKLTVNDHMRATLAG 611

 Score = 52.0 bits (123), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 56/215 (26%), Positives = 83/215 (38%), Gaps = 37/215 (17%)

Query: 112 TFVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXE 171
            F  G  AG   A MVV P+++VK R+QAQ                              
Sbjct: 527 NFTLGSVAGCIGA-MVVYPIDMVKTRMQAQR----------------------------- 556

Query: 172 NVAATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYH 231
                 KY+N+I     I+ +EG R LY G+       A  +    TV   +++ L    
Sbjct: 557 ---DFSKYKNSIDCLLKILSKEGVRGLYSGLGPQLIGVAPEKAIKLTVNDHMRATLAGRD 613

Query: 232 QTDMLPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIRE 291
               LP    S  G  +GA       PL+ +K RLQ       D+  + + AI   +I+ 
Sbjct: 614 GKLSLPCEIIS--GATAGACQVVFTNPLEIVKIRLQVKSDYVADAARNSVNAIS--VIKN 669

Query: 292 EGFRALYKGITPRVMRVAPGQAVTFTVYELIRKKL 326
            G   LY+G    ++R  P  A+ F  Y  I+  +
Sbjct: 670 LGLIGLYRGAGACLLRDIPFSAIYFPTYAHIKSNV 704

 Score = 48.9 bits (115), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 32/98 (32%), Positives = 46/98 (46%), Gaps = 2/98 (2%)

Query: 2   SNRKNSSHPAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDI 61
           S+++N  +    LV+GG AG+  A    P D IK R+QI  +  E      G    AR I
Sbjct: 712 SDKRNKLNTWQLLVSGGLAGMPAAFLTTPFDVIKTRLQIDPKKGESV--YNGIWDAARTI 769

Query: 62  STQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLL 99
             +EG  + +KG  A V+   P+      +YE F  L 
Sbjct: 770 LKEEGIKSFFKGGPARVLRSSPQFGFTLAAYEIFHNLF 807

>CAGL0K02365g 212702..215461 highly similar to tr|Q12482
           Saccharomyces cerevisiae YPR021c, start by similarity
          Length = 919

 Score =  122 bits (305), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 92/316 (29%), Positives = 138/316 (43%), Gaps = 42/316 (13%)

Query: 13  NLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYK 72
           N   G  AG   A   +P+D +K RMQ    A+    + +  I     I ++EG   +Y 
Sbjct: 546 NFSLGSVAGCIGATIVYPIDFVKTRMQ----AQRSLSQYKNSIDCFLKILSREGIRGVYS 601

Query: 73  GLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNTFVAGVGAGITEAVMVVNPME 132
           GLG  +IG+ P+ AI+ T  ++ R  L D+  G +   +  ++G  AG  + V+  NP+E
Sbjct: 602 GLGPQLIGVAPEKAIKLTVNDYMRNKLKDK-NGKLGLLSEIISGASAGACQ-VIFTNPLE 659

Query: 133 VVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAAYVIVKE 192
           +VKIRLQ +   YV   A+                             NA   A  I+K 
Sbjct: 660 IVKIRLQVKG-EYVAENAE-----------------------------NAKLTALQIIKR 689

Query: 193 EGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDM-----LPSWETSLIGLI 247
            G   LY+G +    R        F  Y+ LK  L  +   D      L +WE    G +
Sbjct: 690 LGLPGLYKGAAACLLRDVPFSAIYFPTYAHLKRDLFNFDPNDKNKRSRLNTWELLSAGAL 749

Query: 248 SGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITPRVMR 307
           +G    +   P D IKTRLQ D     ++ +  I+   R ++REE F++ +KG   RV+R
Sbjct: 750 AGMPAAYLTTPFDVIKTRLQIDPKKG-ETIYKGIIHAARTILREESFKSFFKGGAARVLR 808

Query: 308 VAPGQAVTFTVYELIR 323
            +P    T   YEL  
Sbjct: 809 SSPQFGFTLAAYELFH 824

 Score = 52.4 bits (124), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 50/85 (58%), Gaps = 3/85 (3%)

Query: 244 IGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITP 303
           +G ++G +G     P+D +KTR+Q  +S S+   +   +    +++  EG R +Y G+ P
Sbjct: 549 LGSVAGCIGATIVYPIDFVKTRMQAQRSLSQ---YKNSIDCFLKILSREGIRGVYSGLGP 605

Query: 304 RVMRVAPGQAVTFTVYELIRKKLEG 328
           +++ VAP +A+  TV + +R KL+ 
Sbjct: 606 QLIGVAPEKAIKLTVNDYMRNKLKD 630

 Score = 52.0 bits (123), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 62/283 (21%), Positives = 115/283 (40%), Gaps = 56/283 (19%)

Query: 52  RGFIGTARDISTQEGFLALYKGLGAVVIGIIPKMAIR-------FTSYEFFRTLLADRQT 104
           R  I T R   T + FL +       +  ++ ++ +R       +T+Y F+         
Sbjct: 490 RSDIATMRSDLTVQDFLKILNP--NYLNDVVHRLELRHIEEESLYTNYYFY--------- 538

Query: 105 GVVSTGNTFVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXX 164
            +  +   F  G  AG   A +V  P++ VK R+QAQ                       
Sbjct: 539 PIFDSLYNFSLGSVAGCIGATIVY-PIDFVKTRMQAQR---------------------- 575

Query: 165 XXXXXXENVAATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLK 224
                     +  +Y+N+I     I+  EG R +Y G+       A  +    TV   ++
Sbjct: 576 ----------SLSQYKNSIDCFLKILSREGIRGVYSGLGPQLIGVAPEKAIKLTVNDYMR 625

Query: 225 SRLQEYHQTDMLPSWETSLIGLISGALGPFSNAPLDTIKTRLQ-KDKSTSKDSGWSRILA 283
           ++L++  +   L      + G  +GA       PL+ +K RLQ K +  ++++  +++ A
Sbjct: 626 NKLKD--KNGKLGLLSEIISGASAGACQVIFTNPLEIVKIRLQVKGEYVAENAENAKLTA 683

Query: 284 IGRQLIREEGFRALYKGITPRVMRVAPGQAVTFTVYELIRKKL 326
           +  Q+I+  G   LYKG    ++R  P  A+ F  Y  +++ L
Sbjct: 684 L--QIIKRLGLPGLYKGAAACLLRDVPFSAIYFPTYAHLKRDL 724

 Score = 48.1 bits (113), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 46/101 (45%), Gaps = 5/101 (4%)

Query: 14  LVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYKG 73
           L AG  AG+  A    P D IK R+QI  +  E     +G I  AR I  +E F + +KG
Sbjct: 744 LSAGALAGMPAAYLTTPFDVIKTRLQIDPKKGET--IYKGIIHAARTILREESFKSFFKG 801

Query: 74  LGAVVIGIIPKMAIRFTSYEFFRTLL---ADRQTGVVSTGN 111
             A V+   P+      +YE F  +     D+   V+S  +
Sbjct: 802 GAARVLRSSPQFGFTLAAYELFHNIFPLPNDKDKFVISEDD 842

>Sklu_2359.6 YPR021C, Contig c2359 14617-17325
          Length = 902

 Score =  121 bits (304), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 87/316 (27%), Positives = 142/316 (44%), Gaps = 43/316 (13%)

Query: 13  NLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYK 72
           N   G  AG   A   +P+D +K RMQ    A+    + +  I     I ++EG   +Y 
Sbjct: 521 NFTLGSIAGCIGATVVYPIDLVKTRMQ----AQRSFSQYKNSIDCFAKIFSREGIRGIYS 576

Query: 73  GLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNTFVAGVGAGITEAVMVVNPME 132
           GLG  +IG+ P+ AI+ T  ++ R  L D+   +       ++G  AG  + V   NP+E
Sbjct: 577 GLGPQLIGVAPEKAIKLTVNDYMRGRLMDKHANLKWYFEI-LSGACAGACQVVF-TNPLE 634

Query: 133 VVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAAYVIVKE 192
           VVKIRLQ        ++++ AG V                             A  ++K+
Sbjct: 635 VVKIRLQ--------VRSEYAGDVLKSQV-----------------------TALGVIKQ 663

Query: 193 EGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYH-----QTDMLPSWETSLIGLI 247
            G + LY+G++    R        F  Y+ LK  + +Y      Q + L +WE  + G +
Sbjct: 664 LGIKGLYKGIAACLMRDVPFSAIYFPTYAHLKKDVFKYDPKDKKQRNKLKTWELLVAGGL 723

Query: 248 SGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITPRVMR 307
           +G    +   P D IKTRLQ D     ++ +  I    R +++EE F++ +KG + RV+R
Sbjct: 724 AGMPAAYLTTPFDVIKTRLQIDPRKG-ETRYEGIFHAARTILKEESFKSFFKGGSARVLR 782

Query: 308 VAPGQAVTFTVYELIR 323
            +P    T   YE+ +
Sbjct: 783 SSPQFGFTLAAYEIFQ 798

 Score = 64.7 bits (156), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 58/215 (26%), Positives = 89/215 (41%), Gaps = 37/215 (17%)

Query: 112 TFVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXE 171
            F  G  AG   A  VV P+++VK R+QAQ                              
Sbjct: 521 NFTLGSIAGCIGAT-VVYPIDLVKTRMQAQR----------------------------- 550

Query: 172 NVAATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYH 231
              +  +Y+N+I     I   EG R +Y G+       A  +    TV   ++ RL + H
Sbjct: 551 ---SFSQYKNSIDCFAKIFSREGIRGIYSGLGPQLIGVAPEKAIKLTVNDYMRGRLMDKH 607

Query: 232 QTDMLPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIRE 291
               L  +   L G  +GA       PL+ +K RLQ     + D   S++ A+G  +I++
Sbjct: 608 AN--LKWYFEILSGACAGACQVVFTNPLEVVKIRLQVRSEYAGDVLKSQVTALG--VIKQ 663

Query: 292 EGFRALYKGITPRVMRVAPGQAVTFTVYELIRKKL 326
            G + LYKGI   +MR  P  A+ F  Y  ++K +
Sbjct: 664 LGIKGLYKGIAACLMRDVPFSAIYFPTYAHLKKDV 698

 Score = 53.9 bits (128), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 42/86 (48%), Gaps = 2/86 (2%)

Query: 14  LVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYKG 73
           LVAGG AG+  A    P D IK R+QI  R  E   R  G    AR I  +E F + +KG
Sbjct: 718 LVAGGLAGMPAAYLTTPFDVIKTRLQIDPRKGET--RYEGIFHAARTILKEESFKSFFKG 775

Query: 74  LGAVVIGIIPKMAIRFTSYEFFRTLL 99
             A V+   P+      +YE F+ + 
Sbjct: 776 GSARVLRSSPQFGFTLAAYEIFQNMF 801

>Kwal_47.17321
          Length = 881

 Score =  120 bits (302), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 90/316 (28%), Positives = 145/316 (45%), Gaps = 43/316 (13%)

Query: 13  NLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYK 72
           N + G  AG   A   +P+D +K RMQ    A+    + +  I     I ++EG   +Y 
Sbjct: 503 NFLLGSVAGCIGATAVYPIDLVKTRMQ----AQRNFSQYKNSIDCFVKIFSREGIRGIYS 558

Query: 73  GLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNTFVAGVGAGITEAVMVVNPME 132
           GLG  ++G+ P+ AI+ T  ++ R LL D +   ++     ++G  AG  + V+  NP+E
Sbjct: 559 GLGPQLVGVAPEKAIKLTVNDYVRKLLMD-ENNRLTLPLEIISGAAAGACQ-VIFTNPLE 616

Query: 133 VVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAAYVIVKE 192
           +VKIRLQ        ++++ A S+                    PK   +   A  +VK 
Sbjct: 617 IVKIRLQ--------VRSEYADSL--------------------PK---SQLTALGVVKS 645

Query: 193 EGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDM-----LPSWETSLIGLI 247
            G R LY+G+     R        F  Y+ LK  +  Y   D      L +WE    G +
Sbjct: 646 LGLRGLYKGLVACLMRDVPFSAIYFPTYAHLKRDIFNYDPQDKNKRARLHTWELLTAGGL 705

Query: 248 SGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITPRVMR 307
           +G    +   P D IKTRLQ D     ++ ++ IL   R +++EE F++ +KG   RV+R
Sbjct: 706 AGMPAAYLTTPFDVIKTRLQIDPRKG-ETRYTGILHAARTILKEERFKSFFKGGGARVLR 764

Query: 308 VAPGQAVTFTVYELIR 323
            +P    T   YE+ +
Sbjct: 765 SSPQFGFTLAAYEIFQ 780

 Score = 56.6 bits (135), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 62/259 (23%), Positives = 103/259 (39%), Gaps = 63/259 (24%)

Query: 80  GIIPKMAIR-------FTSYEFFRTLLADRQTGVVSTGNTFVAGVGAGITEAVMVVNPME 132
            ++ KM IR       +T++ FF          +  +   F+ G  AG   A  V  P++
Sbjct: 473 DLVHKMEIRRMQSESLYTNFYFF---------PIFDSIYNFLLGSVAGCIGATAVY-PID 522

Query: 133 VVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAAYVIVKE 192
           +VK R+QAQ                                    +Y+N+I     I   
Sbjct: 523 LVKTRMQAQR--------------------------------NFSQYKNSIDCFVKIFSR 550

Query: 193 EGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPSWETSLIGLISGALG 252
           EG R +Y G+       A  +    TV   ++  L + +    LP      + +ISGA  
Sbjct: 551 EGIRGIYSGLGPQLVGVAPEKAIKLTVNDYVRKLLMDENNRLTLP------LEIISGAAA 604

Query: 253 -----PFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITPRVMR 307
                 F+N PL+ +K RLQ     +     S++ A+G  +++  G R LYKG+   +MR
Sbjct: 605 GACQVIFTN-PLEIVKIRLQVRSEYADSLPKSQLTALG--VVKSLGLRGLYKGLVACLMR 661

Query: 308 VAPGQAVTFTVYELIRKKL 326
             P  A+ F  Y  +++ +
Sbjct: 662 DVPFSAIYFPTYAHLKRDI 680

 Score = 53.9 bits (128), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 43/86 (50%), Gaps = 2/86 (2%)

Query: 14  LVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYKG 73
           L AGG AG+  A    P D IK R+QI  R  E   R  G +  AR I  +E F + +KG
Sbjct: 700 LTAGGLAGMPAAYLTTPFDVIKTRLQIDPRKGET--RYTGILHAARTILKEERFKSFFKG 757

Query: 74  LGAVVIGIIPKMAIRFTSYEFFRTLL 99
            GA V+   P+      +YE F+ + 
Sbjct: 758 GGARVLRSSPQFGFTLAAYEIFQNMF 783

 Score = 53.1 bits (126), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 56/249 (22%), Positives = 100/249 (40%), Gaps = 41/249 (16%)

Query: 12  INLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALY 71
           + +++G  AG  + +  +PL+ +K+R+Q+ S   +   +++    TA  +    G   LY
Sbjct: 596 LEIISGAAAGACQVIFTNPLEIVKIRLQVRSEYADSLPKSQ---LTALGVVKSLGLRGLY 652

Query: 72  KGLGAVVIGIIPKMAIRFTSY-----EFFRTLLADRQT-GVVSTGNTFVAGVGAGITEAV 125
           KGL A ++  +P  AI F +Y     + F     D+     + T     AG  AG+  A 
Sbjct: 653 KGLVACLMRDVPFSAIYFPTYAHLKRDIFNYDPQDKNKRARLHTWELLTAGGLAGMPAAY 712

Query: 126 MVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQA 185
           +   P +V+K RLQ       P K +                          +Y   + A
Sbjct: 713 LTT-PFDVIKTRLQID-----PRKGE-------------------------TRYTGILHA 741

Query: 186 AYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPSWETSLIG 245
           A  I+KEE  ++ ++G      R +   G     Y   ++     H  +   S ET+   
Sbjct: 742 ARTILKEERFKSFFKGGGARVLRSSPQFGFTLAAYEIFQNMFPLQHSENN-ESRETNDTP 800

Query: 246 LISGALGPF 254
           +++G    F
Sbjct: 801 IVTGMFSNF 809

>YOR222W (ODC2) [5014] chr15 (758330..759253) 2-Oxodicarboxylate
           transporter, specific for 2-oxoadipate and
           2-oxoglutarate, member of the mitochondrial carrier
           family (MCF) of membrane transporters [924 bp, 307 aa]
          Length = 307

 Score =  115 bits (289), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 90/329 (27%), Positives = 147/329 (44%), Gaps = 46/329 (13%)

Query: 1   MSNRKNSSH-PAI-NLVAGGTAGLFEALCCHPLDTIKVRMQIY------SRAREQGQRAR 52
           MS+  N+   P I   ++G  AG+ E    +PLD +K R Q+       +   +Q +R  
Sbjct: 1   MSSDSNAKPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYN 60

Query: 53  GFIGTARDISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADR-QTGVVSTGN 111
           G I   + I  +EGF  LY+G+ + ++   PK A +F   + ++ +  +   T   +   
Sbjct: 61  GVIDCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKI 120

Query: 112 TFVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXE 171
           +  AG  AG+TEA ++V P E++KIR+Q     Y+                         
Sbjct: 121 SIAAGASAGMTEAAVIV-PFELIKIRMQDVKSSYL------------------------- 154

Query: 172 NVAATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYH 231
                      +      +K EG   LY+G+  T  R A   G  F V   +++ +    
Sbjct: 155 ---------GPMDCLKKTIKNEGIMGLYKGIESTMWRNALWNGGYFGVIYQVRNSM-PVA 204

Query: 232 QTDMLPSWETSLIGLISGALGPFSNAPLDTIKTRLQK-DKSTSKDSGWSRILAIGRQLIR 290
           +T    +    + G I G +G   N P D +K+R+Q  D  +S    ++  L     + R
Sbjct: 205 KTKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYR 264

Query: 291 EEGFRALYKGITPRVMRVAPGQAVTFTVY 319
           EEGFRALYKG  P+V R+APG ++   V+
Sbjct: 265 EEGFRALYKGFVPKVCRLAPGGSLMLVVF 293

 Score = 53.1 bits (126), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 56/218 (25%), Positives = 87/218 (39%), Gaps = 36/218 (16%)

Query: 113 FVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXEN 172
           F++G  AGI+E + V+ P++VVK R Q +     P  A +   V                
Sbjct: 16  FISGAVAGISE-LTVMYPLDVVKTRFQLEVT--TPTAAAVGKQVE--------------- 57

Query: 173 VAATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQ 232
                +Y   I     IVK+EG   LYRG+S     +A  +   F      +   +    
Sbjct: 58  -----RYNGVIDCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFN 112

Query: 233 TDMLPSWETSLIGLISGALGPFSNA----PLDTIKTRLQKDKSTSKDSGWSRILAIGRQL 288
           T+      T  I + +GA    + A    P + IK R+Q  KS+     +   +   ++ 
Sbjct: 113 TNE----TTQKISIAAGASAGMTEAAVIVPFELIKIRMQDVKSS-----YLGPMDCLKKT 163

Query: 289 IREEGFRALYKGITPRVMRVAPGQAVTFTVYELIRKKL 326
           I+ EG   LYKGI   + R A      F V   +R  +
Sbjct: 164 IKNEGIMGLYKGIESTMWRNALWNGGYFGVIYQVRNSM 201

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 55/224 (24%), Positives = 86/224 (38%), Gaps = 35/224 (15%)

Query: 6   NSSHPAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQE 65
           N +   I++ AG +AG+ EA    P + IK+RMQ      +      G +   +     E
Sbjct: 114 NETTQKISIAAGASAGMTEAAVIVPFELIKIRMQ------DVKSSYLGPMDCLKKTIKNE 167

Query: 66  GFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNTFVAGVGAGITEAV 125
           G + LYKG+ + +          F      R  +   +T    T N  +AG   G T   
Sbjct: 168 GIMGLYKGIESTMWRNALWNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIAGAIGG-TVGT 226

Query: 126 MVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQA 185
           M+  P +VVK R+Q               SV                 +A  KY   + +
Sbjct: 227 MLNTPFDVVKSRIQ---------------SVDAVS-------------SAVKKYNWCLPS 258

Query: 186 AYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQE 229
             VI +EEG RALY+G      R A        V++ + +  ++
Sbjct: 259 LLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTGMMNFFRD 302

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 49/95 (51%), Gaps = 11/95 (11%)

Query: 246 LISGALGPFSNA----PLDTIKTRLQKDKSTSKDSG-------WSRILAIGRQLIREEGF 294
            ISGA+   S      PLD +KTR Q + +T   +        ++ ++   ++++++EGF
Sbjct: 16  FISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGF 75

Query: 295 RALYKGITPRVMRVAPGQAVTFTVYELIRKKLEGL 329
             LY+GI+  ++  AP +A  F   +  +K  + L
Sbjct: 76  SRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNL 110

 Score = 37.0 bits (84), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 39/90 (43%), Gaps = 4/90 (4%)

Query: 13  NLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYK 72
           +L+AG   G    +   P D +K R+Q         ++    + +   I  +EGF ALYK
Sbjct: 214 DLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYK 273

Query: 73  GLGAVVIGIIPK---MAIRFTS-YEFFRTL 98
           G    V  + P    M + FT    FFR L
Sbjct: 274 GFVPKVCRLAPGGSLMLVVFTGMMNFFRDL 303

>Kwal_26.8669
          Length = 296

 Score =  115 bits (288), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 88/314 (28%), Positives = 143/314 (45%), Gaps = 49/314 (15%)

Query: 13  NLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYK 72
              AG  AG+ E L  +PLD +K RMQ+   +   G + +G +   + I  +EG   LYK
Sbjct: 12  QFAAGAVAGISEILVMYPLDVVKTRMQL-QVSGGLGPQYKGVVDCIKQIVAKEGASRLYK 70

Query: 73  GLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGV--VSTGNTFVAGVGAGITEAVMVVNP 130
           G+ + V+   PK A +F   + F+ +   R+ GV  ++   + ++G  AG  EA +VV P
Sbjct: 71  GISSPVLMEAPKRATKFACNDEFQKIY-KREFGVEKLTQSLSILSGASAGCCEAFVVV-P 128

Query: 131 MEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAAYVIV 190
            E+VKIRLQ                                +V+++  Y+  I     I+
Sbjct: 129 FELVKIRLQ--------------------------------DVSSS--YKGPIDVVRKII 154

Query: 191 KEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPSWETSLIGLISGA 250
            +EG  A+Y G+  T  R        F +   +++ L E  ++    +    + G I G 
Sbjct: 155 AQEGVLAMYNGLESTLWRHGVWNAGYFGIIFQVRALLPE-AKSKSQQTRNDLIAGSIGGT 213

Query: 251 LGPFSNAPLDTIKTRLQKDKSTS-----KDSGWSRILAIGRQLIREEGFRALYKGITPRV 305
           +G   + P D +K+R+Q     +      +  W  I  I     +EEGFRALYKG  P+V
Sbjct: 214 IGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIFTI----YKEEGFRALYKGFVPKV 269

Query: 306 MRVAPGQAVTFTVY 319
           +R+ PG  +   V+
Sbjct: 270 LRLGPGGGILLVVF 283

 Score = 58.9 bits (141), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 52/214 (24%), Positives = 88/214 (41%), Gaps = 35/214 (16%)

Query: 113 FVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXEN 172
           F AG  AGI+E ++V+ P++VVK R+Q Q          ++G +                
Sbjct: 13  FAAGAVAGISE-ILVMYPLDVVKTRMQLQ----------VSGGLG--------------- 46

Query: 173 VAATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQ 232
               P+Y+  +     IV +EG   LY+G+S     +A  +   F      +   +    
Sbjct: 47  ----PQYKGVVDCIKQIVAKEGASRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFG 102

Query: 233 TDMLPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREE 292
            + L    + L G  +G    F   P + +K RLQ   S+ K       + + R++I +E
Sbjct: 103 VEKLTQSLSILSGASAGCCEAFVVVPFELVKIRLQDVSSSYKGP-----IDVVRKIIAQE 157

Query: 293 GFRALYKGITPRVMRVAPGQAVTFTVYELIRKKL 326
           G  A+Y G+   + R     A  F +   +R  L
Sbjct: 158 GVLAMYNGLESTLWRHGVWNAGYFGIIFQVRALL 191

 Score = 58.5 bits (140), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 59/231 (25%), Positives = 93/231 (40%), Gaps = 55/231 (23%)

Query: 11  AINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLAL 70
           ++++++G +AG  EA    P + +K+R+Q  S +       +G I   R I  QEG LA+
Sbjct: 109 SLSILSGASAGCCEAFVVVPFELVKIRLQDVSSSY------KGPIDVVRKIIAQEGVLAM 162

Query: 71  YKGLGAVV----------IGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNTFVAGVGAG 120
           Y GL + +           GII ++          R LL + ++    T N  +AG   G
Sbjct: 163 YNGLESTLWRHGVWNAGYFGIIFQV----------RALLPEAKSKSQQTRNDLIAGSIGG 212

Query: 121 ITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYR 180
              ++M   P +VVK R+Q   V        +AG                       KY 
Sbjct: 213 TIGSLM-STPFDVVKSRIQNTAV--------VAGGAR--------------------KYN 243

Query: 181 NAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYH 231
            +  + + I KEEG RALY+G      R     G    V++      +  H
Sbjct: 244 WSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVFTGCMDFFRTLH 294

>Scas_589.10
          Length = 316

 Score =  115 bits (287), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 90/330 (27%), Positives = 140/330 (42%), Gaps = 58/330 (17%)

Query: 13  NLVAGGTAGLFEALCCHPLDTIKVRMQIY---------SRAREQGQRARGFIGTARDIST 63
             ++G  AG+ E +  +PLD +K R Q+          S A  +       +     I  
Sbjct: 16  QFISGAVAGMSETIMMYPLDVVKTRFQLQINKKALATSSVAVPKQPEHSSILSCLSKILK 75

Query: 64  QEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADR-QTGVVSTGNTFVAGVGAGIT 122
           +EGF  LYKG+   ++  +PK A++F S E F+ ++  + +   V++  T +AG  AGIT
Sbjct: 76  EEGFKNLYKGMSPPLLMEVPKRAVKFASNEQFQQIMMKKFKLKEVTSTVTLLAGTFAGIT 135

Query: 123 EAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNA 182
           E+++VV P E+VKIRLQ                                   A   YR+ 
Sbjct: 136 ESLIVV-PFELVKIRLQ----------------------------------DAQSDYRSP 160

Query: 183 IQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPSWETS 242
           I+    I++ +G   +Y G   T  R      + F +   +K  +     T         
Sbjct: 161 IRCTRTIIENQGLFGIYAGFESTIWRNTIWNASYFGLIFQVKKFIPRAKSTTKFQGIRND 220

Query: 243 -LIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDS----GWSRILAIGRQLIREEGFRAL 297
            L+G I+G +  F + P D +KTR+Q  K TS        W  +  I     R EG + +
Sbjct: 221 FLVGAIAGCMSCFLSVPFDVVKTRMQGSKKTSSGMCYGWAWQSVFLI----YRTEGIKGI 276

Query: 298 YKGITPRVMRVAPGQAVTFTVY----ELIR 323
           YKGI P + R  PG  +   V+    EL R
Sbjct: 277 YKGILPIICRYGPGGGLLLVVFNGVNELFR 306

 Score = 53.5 bits (127), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 49/212 (23%), Positives = 86/212 (40%), Gaps = 25/212 (11%)

Query: 113 FVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXEN 172
           F++G  AG++E +M+  P++VVK R Q Q    +  KA    SV                
Sbjct: 17  FISGAVAGMSETIMMY-PLDVVKTRFQLQ----INKKALATSSVA--------------- 56

Query: 173 VAATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQ 232
           V   P++ + +     I+KEEG + LY+G+S     +   +   F      +  + +  +
Sbjct: 57  VPKQPEHSSILSCLSKILKEEGFKNLYKGMSPPLLMEVPKRAVKFASNEQFQQIMMKKFK 116

Query: 233 TDMLPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREE 292
              + S  T L G  +G        P + +K RLQ  +S  +       +   R +I  +
Sbjct: 117 LKEVTSTVTLLAGTFAGITESLIVVPFELVKIRLQDAQSDYRSP-----IRCTRTIIENQ 171

Query: 293 GFRALYKGITPRVMRVAPGQAVTFTVYELIRK 324
           G   +Y G    + R     A  F +   ++K
Sbjct: 172 GLFGIYAGFESTIWRNTIWNASYFGLIFQVKK 203

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 49/229 (21%), Positives = 83/229 (36%), Gaps = 45/229 (19%)

Query: 12  INLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALY 71
           + L+AG  AG+ E+L   P + +K+R+Q      +     R  I   R I   +G   +Y
Sbjct: 124 VTLLAGTFAGITESLIVVPFELVKIRLQ------DAQSDYRSPIRCTRTIIENQGLFGIY 177

Query: 72  KGLGAVV----IGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNTFVAGVGAGITEAVMV 127
            G  + +    I       + F   +F     A   T      N F+ G  AG     + 
Sbjct: 178 AGFESTIWRNTIWNASYFGLIFQVKKFIPR--AKSTTKFQGIRNDFLVGAIAGCMSCFLS 235

Query: 128 VNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAAY 187
           V P +VVK R+Q                               +  ++   Y  A Q+ +
Sbjct: 236 V-PFDVVKTRMQGS-----------------------------KKTSSGMCYGWAWQSVF 265

Query: 188 VIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQ---EYHQT 233
           +I + EG + +Y+G+     R     G    V++ +    +    Y QT
Sbjct: 266 LIYRTEGIKGIYKGILPIICRYGPGGGLLLVVFNGVNELFRMSDHYFQT 314

>ACR109W [1156] [Homologous to ScYOR222W (ODC2) - SH; ScYPL134C
           (ODC1) - SH] complement(546745..547644) [900 bp, 299 aa]
          Length = 299

 Score =  112 bits (281), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 96/326 (29%), Positives = 140/326 (42%), Gaps = 48/326 (14%)

Query: 1   MSNRKNSSHPAI-NLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTAR 59
           MS+    S P +    AG  AG+ E L  +PLD +K RMQ+  +    G    G +   +
Sbjct: 1   MSSSDTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQG-GAGPHYTGVVDCLK 59

Query: 60  DISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGV--VSTGNTFVAGV 117
            I   EG   LYKG+ + ++   PK A +F   + F+ L   +  GV  +S   + +AG 
Sbjct: 60  KIVAGEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLY-KQAFGVEKLSQPLSMLAGA 118

Query: 118 GAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATP 177
            AG  EA +VV P E+VKIRLQ                                   A+ 
Sbjct: 119 SAGCVEAFVVV-PFELVKIRLQ----------------------------------DASS 143

Query: 178 KYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLP 237
            Y+  +     IV  EG  A+Y G+  T  R A   G  F +    ++ L   H      
Sbjct: 144 SYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFGIIFQARALLPAAHNKTQCI 203

Query: 238 SWETSLIG-LISGALGPFSNAPLDTIKTRLQKD---KSTSKDSGWSRILAIGRQLIREEG 293
           +    LI   I  ++G   + P D +K+R+Q         +   WS  L     + REEG
Sbjct: 204 T--NDLISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPGVVRKYNWS--LPSLLTIYREEG 259

Query: 294 FRALYKGITPRVMRVAPGQAVTFTVY 319
           FRALYKG  P+V+R+ PG  +   V+
Sbjct: 260 FRALYKGFVPKVLRLGPGGGILLVVF 285

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 42/93 (45%)

Query: 232 QTDMLPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIRE 291
            T  LP       G ++G        PLD +KTR+Q          ++ ++   ++++  
Sbjct: 5   DTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAG 64

Query: 292 EGFRALYKGITPRVMRVAPGQAVTFTVYELIRK 324
           EG   LYKGI+  ++  AP +A  F   +  +K
Sbjct: 65  EGVGRLYKGISSPILMEAPKRATKFACNDEFQK 97

>YPL134C (ODC1) [5311] chr16 complement(298570..299502)
           2-Oxodicarboxylate transporter, has specificity for
           2-oxoadipate and 2-oxoglutarate, member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [933 bp, 310 aa]
          Length = 310

 Score =  110 bits (276), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 92/340 (27%), Positives = 141/340 (41%), Gaps = 67/340 (19%)

Query: 1   MSNRKNSSHPAI-NLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQ---------GQR 50
           M++  N   P I    AG  AG+ E L  +PLD +K RMQ+    +              
Sbjct: 1   MTSIDNRPLPFIYQFTAGAIAGVSELLVMYPLDVVKTRMQLQVTTKGHPAVVAAKAAVDH 60

Query: 51  ARGFIGTARDISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTL---LADRQTGVV 107
             G +     I  +EGF  LYKG+ + ++   PK AI+F+  + F+T    +     G +
Sbjct: 61  YTGVMDCLTKIVKKEGFSHLYKGITSPILMEAPKRAIKFSGNDTFQTFYKKIFPTPNGEM 120

Query: 108 STGNTFVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXX 167
           +      +G  AG  EA  VV P E+VKIRLQ                            
Sbjct: 121 TQKIAIYSGASAGAVEA-FVVAPFELVKIRLQD--------------------------- 152

Query: 168 XXXENVAATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRL 227
                     +++  I+     V + G  +L+ G+  T  R        F +   ++   
Sbjct: 153 -------VNSQFKTPIEVVKNSVVKGGVLSLFNGLEATIWRHVLWNAGYFGIIFQIRK-- 203

Query: 228 QEYHQTDMLPSWETS--------LIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWS 279
                  +LP+ +TS        + G I G +G   N P D +K+R+Q+     +   WS
Sbjct: 204 -------LLPAAKTSTEKTRNDLIAGAIGGTVGCLLNTPFDVVKSRIQRSSGPLRKYNWS 256

Query: 280 RILAIGRQLIREEGFRALYKGITPRVMRVAPGQAVTFTVY 319
             L     + REEGF+ALYKG  P+VMR+APG  +   V+
Sbjct: 257 --LPSVLLVYREEGFKALYKGFAPKVMRLAPGGGLLLVVF 294

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 57/219 (26%), Positives = 92/219 (42%), Gaps = 33/219 (15%)

Query: 113 FVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXEN 172
           F AG  AG++E ++V+ P++VVK R+Q Q    V  K                       
Sbjct: 15  FTAGAIAGVSE-LLVMYPLDVVKTRMQLQ----VTTKGH---------------PAVVAA 54

Query: 173 VAATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQ 232
            AA   Y   +     IVK+EG   LY+G++     +A  +   F+   T ++  ++   
Sbjct: 55  KAAVDHYTGVMDCLTKIVKKEGFSHLYKGITSPILMEAPKRAIKFSGNDTFQTFYKKIFP 114

Query: 233 TDMLPSWE-TSLIGLIS----GALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQ 287
           T   P+ E T  I + S    GA+  F  AP + +K RLQ   S  K       + + + 
Sbjct: 115 T---PNGEMTQKIAIYSGASAGAVEAFVVAPFELVKIRLQDVNSQFKTP-----IEVVKN 166

Query: 288 LIREEGFRALYKGITPRVMRVAPGQAVTFTVYELIRKKL 326
            + + G  +L+ G+   + R     A  F +   IRK L
Sbjct: 167 SVVKGGVLSLFNGLEATIWRHVLWNAGYFGIIFQIRKLL 205

 Score = 36.6 bits (83), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 43/88 (48%), Gaps = 7/88 (7%)

Query: 13  NLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYK 72
           +L+AG   G    L   P D +K R+Q   R+    ++    + +   +  +EGF ALYK
Sbjct: 218 DLIAGAIGGTVGCLLNTPFDVVKSRIQ---RSSGPLRKYNWSLPSVLLVYREEGFKALYK 274

Query: 73  GLGAVVIGIIPK---MAIRFTS-YEFFR 96
           G    V+ + P    + + FT+  +FFR
Sbjct: 275 GFAPKVMRLAPGGGLLLVVFTNVMDFFR 302

>AGL064W [4247] [Homologous to ScYBR291C (CTP1) - SH]
           complement(587623..588513) [891 bp, 296 aa]
          Length = 296

 Score =  109 bits (272), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 97/327 (29%), Positives = 149/327 (45%), Gaps = 45/327 (13%)

Query: 1   MSNRKNSSHPAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARD 60
           M+  +  +  A + VAG  AG  E    +P +  K R+Q+  +    G+     +   R 
Sbjct: 1   MARSREGADAARSFVAGAAAGAIEGCVTYPFEFAKTRLQLAQQG--SGESRNPLVLLYRT 58

Query: 61  ISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNTFVAGVGAG 120
             TQ G  ALY G  A V+G   K  +RF  ++  R  L D + G +S     +AG+GAG
Sbjct: 59  ARTQ-GAGALYVGCPAFVVGNTCKAGVRFLGFDALRRALQD-ERGALSGPRGMLAGLGAG 116

Query: 121 ITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYR 180
           + E+V+ V P E VK  L                                +  AA P+Y+
Sbjct: 117 LLESVLAVTPFEAVKTAL------------------------------IDDRQAARPRYQ 146

Query: 181 NAIQAA---YVIVKEEGPRALYRGVSLTAA-RQATNQGANFTVYSTLKSRLQEYHQTDM- 235
           +  + A   Y ++  E       G  +  A RQA+NQ   F  Y+ LK  +Q Y  T   
Sbjct: 147 HNGRGAARNYALLLRELGLRGLYGGLVPVALRQASNQAVRFGCYTQLKQAVQRYAGTPAD 206

Query: 236 --LPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEG 293
             L S +T L+G +SG +  ++  P+DT+KTR+Q   +      +   +   R ++REEG
Sbjct: 207 QPLGSGQTFLVGALSGIVTVYATMPVDTVKTRMQALDAAR----YGSTVGCFRAVVREEG 262

Query: 294 FRALYKGITPRVMRVAPGQAVTFTVYE 320
            RAL++G TPR+ R+     + FT YE
Sbjct: 263 VRALWRGATPRLGRLVLSGGIVFTAYE 289

 Score = 37.0 bits (84), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 39/87 (44%), Gaps = 5/87 (5%)

Query: 13  NLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYK 72
             + G  +G+       P+DT+K RMQ    AR         +G  R +  +EG  AL++
Sbjct: 214 TFLVGALSGIVTVYATMPVDTVKTRMQALDAARYGST-----VGCFRAVVREEGVRALWR 268

Query: 73  GLGAVVIGIIPKMAIRFTSYEFFRTLL 99
           G    +  ++    I FT+YE    LL
Sbjct: 269 GATPRLGRLVLSGGIVFTAYEKLLVLL 295

 Score = 34.7 bits (78), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 36/145 (24%), Positives = 54/145 (37%), Gaps = 44/145 (30%)

Query: 86  AIRFTSYEFFRTLL-------ADRQTGVVSTGNTFVAGVGAGITEAVMVVNPMEVVKIRL 138
           A+RF  Y   +  +       AD+  G   +G TF+ G  +GI   V    P++ VK R+
Sbjct: 184 AVRFGCYTQLKQAVQRYAGTPADQPLG---SGQTFLVGALSGIV-TVYATMPVDTVKTRM 239

Query: 139 QAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAAYVIVKEEGPRAL 198
           QA                                     +Y + +     +V+EEG RAL
Sbjct: 240 QALD---------------------------------AARYGSTVGCFRAVVREEGVRAL 266

Query: 199 YRGVSLTAARQATNQGANFTVYSTL 223
           +RG +    R   + G  FT Y  L
Sbjct: 267 WRGATPRLGRLVLSGGIVFTAYEKL 291

 Score = 29.6 bits (65), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 40/156 (25%), Positives = 61/156 (39%), Gaps = 14/156 (8%)

Query: 180 RNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPSW 239
           RN +   Y   + +G  ALY G            G  F  +  L+  LQ+  +   L   
Sbjct: 49  RNPLVLLYRTARTQGAGALYVGCPAFVVGNTCKAGVRFLGFDALRRALQD--ERGALSGP 106

Query: 240 ETSLIGLISGAL-GPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEG----- 293
              L GL +G L    +  P + +KT L  D+  ++     R    GR   R        
Sbjct: 107 RGMLAGLGAGLLESVLAVTPFEAVKTALIDDRQAAR----PRYQHNGRGAARNYALLLRE 162

Query: 294 --FRALYKGITPRVMRVAPGQAVTFTVYELIRKKLE 327
              R LY G+ P  +R A  QAV F  Y  +++ ++
Sbjct: 163 LGLRGLYGGLVPVALRQASNQAVRFGCYTQLKQAVQ 198

>KLLA0E13453g complement(1184806..1187526) similar to sgd|S0006225
           Saccharomyces cerevisiae YPR021c, start by similarity
          Length = 906

 Score =  112 bits (280), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 86/316 (27%), Positives = 139/316 (43%), Gaps = 43/316 (13%)

Query: 13  NLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYK 72
           N   G  AG   A   +P+D +K RMQ    A+    + +  I     I   +G   LY 
Sbjct: 507 NFTLGSIAGCIGATVVYPIDLVKTRMQ----AQRNSVQYKNSIDCVVKIFQTKGIRGLYS 562

Query: 73  GLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNTFVAGVGAGITEAVMVVNPME 132
           GLG  +IG+ P+ AI+ T  +F R    ++ +  +      ++G  AG  + V   NP+E
Sbjct: 563 GLGPQLIGVAPEKAIKLTVNDFMRQYFMNK-SRTIKWYQEILSGATAGACQVVFT-NPLE 620

Query: 133 VVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAAYVIVKE 192
           +VKIRLQ        +++   G                EN  A P+       A  I+++
Sbjct: 621 IVKIRLQ--------MRSDYVG----------------EN--ARPQL-----GAVGIIRQ 649

Query: 193 EGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDM-----LPSWETSLIGLI 247
            G R LY+G +    R        F  Y+ LK  +  +   D      L +WE  L G I
Sbjct: 650 LGLRGLYKGAAACLLRDVPFSAIYFPTYAHLKKDVFNFDPNDKNKRNKLKTWELLLAGGI 709

Query: 248 SGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITPRVMR 307
           +G    +   P D IKTRLQ D     ++ ++ ++   R +++EE  ++ +KG   RV+R
Sbjct: 710 AGMPAAYLTTPFDVIKTRLQIDPRKG-ETTYTGVIHAARTILKEESIKSFFKGGPARVLR 768

Query: 308 VAPGQAVTFTVYELIR 323
            +P    T   +E+ +
Sbjct: 769 SSPQFGFTLAAFEMFQ 784

 Score = 55.8 bits (133), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 55/221 (24%), Positives = 91/221 (41%), Gaps = 37/221 (16%)

Query: 106 VVSTGNTFVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXX 165
           +  + + F  G  AG   A  VV P+++VK R+QAQ             SV         
Sbjct: 501 IFDSIHNFTLGSIAGCIGAT-VVYPIDLVKTRMQAQR-----------NSV--------- 539

Query: 166 XXXXXENVAATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKS 225
                       +Y+N+I     I + +G R LY G+       A  +    TV   ++ 
Sbjct: 540 ------------QYKNSIDCVVKIFQTKGIRGLYSGLGPQLIGVAPEKAIKLTVNDFMRQ 587

Query: 226 RLQEYHQTDMLPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIG 285
                 +T  +  ++  L G  +GA       PL+ +K RLQ       ++   ++ A+G
Sbjct: 588 YFMNKSRT--IKWYQEILSGATAGACQVVFTNPLEIVKIRLQMRSDYVGENARPQLGAVG 645

Query: 286 RQLIREEGFRALYKGITPRVMRVAPGQAVTFTVYELIRKKL 326
             +IR+ G R LYKG    ++R  P  A+ F  Y  ++K +
Sbjct: 646 --IIRQLGLRGLYKGAAACLLRDVPFSAIYFPTYAHLKKDV 684

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 45/97 (46%), Gaps = 2/97 (2%)

Query: 3   NRKNSSHPAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDIS 62
           N++N       L+AGG AG+  A    P D IK R+QI  R  E      G I  AR I 
Sbjct: 693 NKRNKLKTWELLLAGGIAGMPAAYLTTPFDVIKTRLQIDPRKGETT--YTGVIHAARTIL 750

Query: 63  TQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLL 99
            +E   + +KG  A V+   P+      ++E F+ L 
Sbjct: 751 KEESIKSFFKGGPARVLRSSPQFGFTLAAFEMFQGLF 787

>KLLA0D07073g 606857..607750 similar to sp|Q03028 Saccharomyces
           cerevisiae YPL134c ODC1, start by similarity
          Length = 297

 Score =  103 bits (258), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 88/330 (26%), Positives = 144/330 (43%), Gaps = 58/330 (17%)

Query: 1   MSNRKNSSHPAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARD 60
           MS++K         +AG  AG+ E L  +PLD +K  MQ+   +   G + +G     + 
Sbjct: 1   MSDQKPLPF-VYQFMAGAVAGVSEILVMYPLDMVKTVMQL-QVSGGSGPQYKGVFDCLKQ 58

Query: 61  ISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADR-QTGVVSTGNTFVAGVGA 119
           I+ +EG   LYKG+ + ++   PK A +F   + F+ +  D      ++   + ++G  A
Sbjct: 59  IAAKEGPSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSILSGASA 118

Query: 120 GITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKY 179
           GI E+ +VV P E+VKIRLQ                                    + K+
Sbjct: 119 GICESFVVV-PFELVKIRLQ----------------------------------DVSSKF 143

Query: 180 RNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRL------QEYHQT 233
            + I     IV++EG  A+Y G+  T  R        F +   +++ L       E  + 
Sbjct: 144 TSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFGIIFQVRALLPKASTKSEQTRN 203

Query: 234 DMLPSWETSLIGLISGALGPFSNAPLDTIKTRLQKD---KSTSKDSGWSR-ILAIGRQLI 289
           D+       L G + G L    + P D +K+R+Q         +   WS   LA    + 
Sbjct: 204 DL-------LAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALA---TIY 253

Query: 290 REEGFRALYKGITPRVMRVAPGQAVTFTVY 319
           +EEGF+ALYKG  P+V+R+ PG  +   V+
Sbjct: 254 KEEGFKALYKGFVPKVLRLGPGGGILLVVF 283

 Score = 36.6 bits (83), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 36/74 (48%), Gaps = 3/74 (4%)

Query: 258 PLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITPRVMRVAPGQAVTFT 317
           PLD +KT +Q   S      +  +    +Q+  +EG   LYKGI+  ++  AP +A  F 
Sbjct: 29  PLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYKGISSPILMEAPKRATKFA 88

Query: 318 V---YELIRKKLEG 328
               ++ I K L G
Sbjct: 89  CNDEFQKIYKDLFG 102

 Score = 36.2 bits (82), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 40/90 (44%), Gaps = 4/90 (4%)

Query: 13  NLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYK 72
           +L+AG   G   +L   P D +K R+Q  +      ++          I  +EGF ALYK
Sbjct: 204 DLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYK 263

Query: 73  GLGAVVIGIIPKMAIRFTSY----EFFRTL 98
           G    V+ + P   I    +    +FFRT+
Sbjct: 264 GFVPKVLRLGPGGGILLVVFTGVMDFFRTV 293

>CAGL0J04114g complement(384321..385232) similar to sp|Q99297
           Saccharomyces cerevisiae YOR222w ODC2 or sp|Q03028
           Saccharomyces cerevisiae YPL134c ODC1, start by
           similarity
          Length = 303

 Score =  103 bits (257), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 86/324 (26%), Positives = 139/324 (42%), Gaps = 62/324 (19%)

Query: 14  LVAGGTAGLFEALCCHPLDTIKVRMQI-YSRAREQGQRARGFIGTARDISTQEGFLALYK 72
            V+G  AG+ E L  +PLD +K RMQ+        G    G I     I  +EGF  LYK
Sbjct: 12  FVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYK 71

Query: 73  GLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGV--VSTGNTFVAGVGAGITEAVMVVNP 130
           G+ + ++   PK A +F   + ++ +  D   GV  ++   + ++G  AG+TEA ++V P
Sbjct: 72  GISSPMLMEAPKRATKFACNDSYQKMFKDLY-GVDKLTQQISILSGSLAGVTEACVIV-P 129

Query: 131 MEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAAYVIV 190
            E+VKIRLQ                                      K+   ++  +  +
Sbjct: 130 FELVKIRLQ----------------------------------DVNSKFNGPMEVVFKTI 155

Query: 191 KEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPSWETSLIGLISGA 250
           +E G  +LY G+  T  R A   G  F V   +++ L +          E +   LI+G 
Sbjct: 156 RETGILSLYNGLESTMWRNAFWNGGYFGVIFQIRALLPKAKTNT-----EKTTNDLIAGT 210

Query: 251 LGPFS-----NAPLDTIKTRLQKDKSTSKDSG---------WSRILAIGRQLIREEGFRA 296
           +G +      +  L  +K+R+Q   +T+   G         W  +  I      EEGF A
Sbjct: 211 IGGYCRYSTEHTILSVVKSRIQSGATTTLADGTVVPKYNWTWPSLFKI----YSEEGFTA 266

Query: 297 LYKGITPRVMRVAPGQAVTFTVYE 320
           LYKG  P+++R+ PG  +   V+ 
Sbjct: 267 LYKGFIPKILRLGPGGGIMLVVFN 290

 Score = 57.4 bits (137), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 57/218 (26%), Positives = 91/218 (41%), Gaps = 41/218 (18%)

Query: 113 FVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXEN 172
           FV+G  AG++E ++V+ P++VVK R+Q Q            GS                 
Sbjct: 12  FVSGAAAGVSE-LLVMYPLDVVKTRMQLQ-----------VGS----------------G 43

Query: 173 VAATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQ 232
             +   Y   I     IVK EG   LY+G+S     +A  +   F    + +   ++ + 
Sbjct: 44  TGSGVAYNGVIDCLGQIVKREGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYG 103

Query: 233 TDMLPSWETSLIGLISGALGPFSNA----PLDTIKTRLQKDKSTSKDSGWSRILAIGRQL 288
            D L    T  I ++SG+L   + A    P + +K RLQ       +S ++  + +  + 
Sbjct: 104 VDKL----TQQISILSGSLAGVTEACVIVPFELVKIRLQ-----DVNSKFNGPMEVVFKT 154

Query: 289 IREEGFRALYKGITPRVMRVAPGQAVTFTVYELIRKKL 326
           IRE G  +LY G+   + R A      F V   IR  L
Sbjct: 155 IRETGILSLYNGLESTMWRNAFWNGGYFGVIFQIRALL 192

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 41/74 (55%), Gaps = 2/74 (2%)

Query: 258 PLDTIKTRLQKDKSTSKDSG--WSRILAIGRQLIREEGFRALYKGITPRVMRVAPGQAVT 315
           PLD +KTR+Q    +   SG  ++ ++    Q+++ EGF  LYKGI+  ++  AP +A  
Sbjct: 28  PLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYKGISSPMLMEAPKRATK 87

Query: 316 FTVYELIRKKLEGL 329
           F   +  +K  + L
Sbjct: 88  FACNDSYQKMFKDL 101

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 49/228 (21%), Positives = 81/228 (35%), Gaps = 50/228 (21%)

Query: 12  INLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALY 71
           I++++G  AG+ EA    P + +K+R+Q      +   +  G +        + G L+LY
Sbjct: 111 ISILSGSLAGVTEACVIVPFELVKIRLQ------DVNSKFNGPMEVVFKTIRETGILSLY 164

Query: 72  KGLGAVV----------IGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNTFVAGVGAGI 121
            GL + +           G+I ++          R LL   +T    T N  +AG   G 
Sbjct: 165 NGLESTMWRNAFWNGGYFGVIFQI----------RALLPKAKTNTEKTTNDLIAGTIGGY 214

Query: 122 TEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRN 181
                    + VVK R+Q+                               +    PKY  
Sbjct: 215 CRYSTEHTILSVVKSRIQS------------------------GATTTLADGTVVPKYNW 250

Query: 182 AIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQE 229
              + + I  EEG  ALY+G      R     G    V++ + +  QE
Sbjct: 251 TWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVFNGMMAFFQE 298

>YEL006W (YEL006W) [1417] chr5 (144326..145333) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1008 bp, 335 aa]
          Length = 335

 Score =  103 bits (258), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 89/338 (26%), Positives = 139/338 (41%), Gaps = 51/338 (15%)

Query: 3   NR-KNSSHPAINLVAGGTAGLFEALCCHPLDTIKVRMQI--YSRAREQGQRARGFIGTAR 59
           NR K ++ P +  ++G  +G   A+   P D  K R+Q         Q Q  +GF GT  
Sbjct: 30  NRLKKNADPRVAAISGALSGALSAMLVCPFDVAKTRLQAQGLQNMTHQSQHYKGFFGTFA 89

Query: 60  DISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNTFVAGVGA 119
            I   EG   LYKGL   V+G IP + I F+ Y+F R    D     +   + F++   +
Sbjct: 90  TIFKDEGAAGLYKGLQPTVLGYIPTLMIYFSVYDFCRKYSVD-----IFPHSPFLSNASS 144

Query: 120 GITE---AVMVVNPMEVVKIRLQAQH--VRYVPLKAQLAGSVXXXXXXXXXXXXXXENVA 174
            IT    + +  NP+ VVK RL  Q    +Y                             
Sbjct: 145 AITAGAISTVATNPIWVVKTRLMLQTGIGKY----------------------------- 175

Query: 175 ATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTD 234
            +  Y+  I     I+++EG +ALY G+ + A     N    F +Y  LK R      TD
Sbjct: 176 -STHYKGTIDTFRKIIQQEGAKALYAGL-VPALLGMLNVAIQFPLYENLKIRFGYSESTD 233

Query: 235 MLPSWETS------LIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQL 288
           +     +S      L  ++S  +      P + ++TR+Q  KS   ++    +L + +  
Sbjct: 234 VSTDVTSSNFQKLILASMLSKMVASTVTYPHEILRTRMQL-KSDLPNTVQRHLLPLIKIT 292

Query: 289 IREEGFRALYKGITPRVMRVAPGQAVTFTVYELIRKKL 326
            R+EGF   Y G    ++R  P   VT   +E  +K L
Sbjct: 293 YRQEGFAGFYSGFATNLVRTVPAAVVTLVSFEYSKKYL 330

>Scas_709.9
          Length = 365

 Score =  100 bits (248), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 92/329 (27%), Positives = 133/329 (40%), Gaps = 45/329 (13%)

Query: 8   SHPAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGF 67
           S P I  ++G  AG    +   PLD  K R+Q       +    RG +GT   I   EG 
Sbjct: 62  SDPKITALSGALAGFLSGIIVCPLDVTKTRLQAQGIQSIENPYYRGVLGTMSTIVVDEGV 121

Query: 68  LALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNTFVAGVGAGIT---EA 124
             LYKGL  +++G  P   I F+ YEF + L        V   + F++   + IT    +
Sbjct: 122 RGLYKGLIPIILGYFPTWMIYFSVYEFAKDLYPR-----VLPNSDFISHSCSAITAGAAS 176

Query: 125 VMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQ 184
            ++ NP+ VVK RL  Q     PL                          +   YR  I 
Sbjct: 177 TVLTNPIWVVKTRLMLQ----TPLG------------------------ESRTHYRGTID 208

Query: 185 AAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPSWETS-- 242
           A   I+ +EG R LY G+ + +     +   +F VY  LK+RL     T    S E S  
Sbjct: 209 AFKKIITQEGVRTLYTGL-VPSMFGLLHVAIHFPVYEKLKNRLHCDTITGGHNSQEHSLH 267

Query: 243 LIGLI-----SGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRAL 297
           L  LI     S  L      P + ++TR+Q  KS        ++L + ++  R EG    
Sbjct: 268 LTRLIIASSASKMLASILTYPHEILRTRMQL-KSDKLLISKHKLLDLIKRTYRYEGLLGF 326

Query: 298 YKGITPRVMRVAPGQAVTFTVYELIRKKL 326
           Y G    ++R  P  A+T   +E  R  L
Sbjct: 327 YSGFATNLLRTVPASAITLVSFEYFRNAL 355

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 21/98 (21%), Positives = 45/98 (45%), Gaps = 2/98 (2%)

Query: 2   SNRKNSSHPAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDI 61
           +++++S H    ++A   + +  ++  +P + ++ RMQ+ S      +     +   +  
Sbjct: 260 NSQEHSLHLTRLIIASSASKMLASILTYPHEILRTRMQLKSDKLLISKHK--LLDLIKRT 317

Query: 62  STQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLL 99
              EG L  Y G    ++  +P  AI   S+E+FR  L
Sbjct: 318 YRYEGLLGFYSGFATNLLRTVPASAITLVSFEYFRNAL 355

>KLLA0E15532g complement(1383230..1384210) similar to sp|P23500
           Saccharomyces cerevisiae YKR052c MRS4 RNA splicing
           protein and member of the mitochondrial carrier family
           (MCF), start by similarity
          Length = 326

 Score = 99.0 bits (245), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 87/332 (26%), Positives = 136/332 (40%), Gaps = 56/332 (16%)

Query: 14  LVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARG--------------FIGTAR 59
           L+AG  AG+ E     P+D +K RMQ  S  +     +                 +    
Sbjct: 24  LIAGAFAGIMEHSIMFPIDALKTRMQAVSEIKAAASASASGGAGAASGGAGAGTLLQQIS 83

Query: 60  DISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLAD-RQTGVVSTGNTFVAGVG 118
            IS+ EG LAL++G+ ++V+G  P  A+ F +YEF +  L D +         T V+GV 
Sbjct: 84  RISSTEGSLALWRGVQSMVMGAGPAHAVYFATYEFCKEQLIDAKDFNTHQPLKTAVSGVA 143

Query: 119 AGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPK 178
           A +  A  ++NP + +K RLQ Q                                + +  
Sbjct: 144 ATVA-ADALMNPFDTIKQRLQLQ-----------------------------SKSSDSSM 173

Query: 179 YRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPS 238
           +R     A+ I K EGP A +     T A        NF +Y   +S  + ++ T+    
Sbjct: 174 WR----MAFNIYKNEGPMAFFYSYPTTLAMNIPFAALNFVIY---ESSTKFFNPTNAYNP 226

Query: 239 WETSLIGLISGALGPFSNAPLDTIKTRLQ---KDKSTSKDSGWSRILAIGRQLIREE-GF 294
           W   L G I+GA       PLD IKT LQ    D    +    +       Q I +  G+
Sbjct: 227 WIHCLCGGIAGATCAAVTTPLDCIKTVLQIRGSDTVHVESFKTANTFKKAAQAIWQSYGW 286

Query: 295 RALYKGITPRVMRVAPGQAVTFTVYELIRKKL 326
           +  ++G+ PRV+   P  A+++T YE  +  L
Sbjct: 287 KGFWRGLQPRVISNIPATAISWTSYEFAKHLL 318

 Score = 58.5 bits (140), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 38/104 (36%), Positives = 51/104 (49%), Gaps = 3/104 (2%)

Query: 3   NRKNSSHPAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAR---EQGQRARGFIGTAR 59
           N  N+ +P I+ + GG AG   A    PLD IK  +QI        E  + A  F   A+
Sbjct: 219 NPTNAYNPWIHCLCGGIAGATCAAVTTPLDCIKTVLQIRGSDTVHVESFKTANTFKKAAQ 278

Query: 60  DISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQ 103
            I    G+   ++GL   VI  IP  AI +TSYEF + LL  +Q
Sbjct: 279 AIWQSYGWKGFWRGLQPRVISNIPATAISWTSYEFAKHLLFTKQ 322

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/140 (25%), Positives = 56/140 (40%), Gaps = 20/140 (14%)

Query: 6   NSSHPAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQE 65
           N+  P    V+G  A +      +P DTIK R+Q+ S++ +       F     +I   E
Sbjct: 130 NTHQPLKTAVSGVAATVAADALMNPFDTIKQRLQLQSKSSDSSMWRMAF-----NIYKNE 184

Query: 66  GFLALYKGLGAVVIGIIPKMAIRFTSYE----FFRTLLADRQTGVVSTGNTFVAGVGAGI 121
           G +A +      +   IP  A+ F  YE    FF            +  N ++  +  GI
Sbjct: 185 GPMAFFYSYPTTLAMNIPFAALNFVIYESSTKFFNP---------TNAYNPWIHCLCGGI 235

Query: 122 TEAVM--VVNPMEVVKIRLQ 139
             A    V  P++ +K  LQ
Sbjct: 236 AGATCAAVTTPLDCIKTVLQ 255

>YPR011C (YPR011C) [5447] chr16 complement(583057..584037) Protein
           with similarity to human Grave's disease carrier protein
           and to bovine homolog of Grave's disease protein, member
           of the mitochondrial carrier family (MCF) of membrane
           transporters [981 bp, 326 aa]
          Length = 326

 Score = 98.6 bits (244), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 87/328 (26%), Positives = 136/328 (41%), Gaps = 49/328 (14%)

Query: 12  INLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALY 71
           I  +AGG AG        P + +K+ +Q+ S         RG   + R +  +EG   L+
Sbjct: 24  IAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYN---RGIFSSIRQVYHEEGTKGLF 80

Query: 72  KGLGAVVIGIIPKMAIRFTSYE-----FFRTLLADRQTGVVSTGNTFVAGVGAGITEAVM 126
           +G G   I I P  A++F  YE      F     + Q  + +T   F   +  G +  V+
Sbjct: 81  RGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCS--VV 138

Query: 127 VVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAA 186
              P++++K RL  Q      L    A S+                 +  P     +   
Sbjct: 139 ATYPLDLIKTRLSIQTANLSSLNRSKAKSI-----------------SKPPGIWQLLSET 181

Query: 187 YVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEY--HQTDMLPSWETSL- 243
           Y +  E G R LYRGV  T+         NF VY     +L+E+  + +D  PSW+++L 
Sbjct: 182 YRL--EGGLRGLYRGVWPTSLGVVPYVALNFAVYE----QLREFGVNSSDAQPSWKSNLY 235

Query: 244 ---IGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSG------WSRILAIGRQLIREEGF 294
              IG ISG +      P D ++ R Q       + G      W  ++ IGR     EG 
Sbjct: 236 KLTIGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGR----AEGV 291

Query: 295 RALYKGITPRVMRVAPGQAVTFTVYELI 322
              YKG+   + +V P  AV++ VYE++
Sbjct: 292 SGYYKGLAANLFKVVPSTAVSWLVYEVV 319

 Score = 65.5 bits (158), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 63/228 (27%), Positives = 89/228 (39%), Gaps = 50/228 (21%)

Query: 114 VAGVGAGITEAV--MVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXE 171
           +A +  G+  AV   VV+P E VKI LQ Q                              
Sbjct: 24  IAFLAGGVAGAVSRTVVSPFERVKILLQVQS----------------------------- 54

Query: 172 NVAATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYH 231
             + T   R    +   +  EEG + L+RG  L   R        F VY   K +L   +
Sbjct: 55  --STTSYNRGIFSSIRQVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVN 112

Query: 232 QTD---MLPSWETSLIGLISGALGPFSNAPLDTIKTRLQ------------KDKSTSKDS 276
             +    L + +    G + G     +  PLD IKTRL             K KS SK  
Sbjct: 113 GNNGQEQLTNTQRLFSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPP 172

Query: 277 GWSRILAIGRQLIREEGFRALYKGITPRVMRVAPGQAVTFTVYELIRK 324
           G  ++L+   +L  E G R LY+G+ P  + V P  A+ F VYE +R+
Sbjct: 173 GIWQLLSETYRL--EGGLRGLYRGVWPTSLGVVPYVALNFAVYEQLRE 218

 Score = 47.8 bits (112), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 47/85 (55%), Gaps = 4/85 (4%)

Query: 243 LIGLISGALGPFSNAPLDTIKTRLQ-KDKSTSKDSGWSRILAIGRQLIREEGFRALYKGI 301
           L G ++GA+     +P + +K  LQ +  +TS + G   I +  RQ+  EEG + L++G 
Sbjct: 27  LAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRG---IFSSIRQVYHEEGTKGLFRGN 83

Query: 302 TPRVMRVAPGQAVTFTVYELIRKKL 326
               +R+ P  AV F VYE  +KKL
Sbjct: 84  GLNCIRIFPYSAVQFVVYEACKKKL 108

>CAGL0H03839g 359987..360835 highly similar to sp|P38921
           Saccharomyces cerevisiae YNL003c PET8, start by
           similarity
          Length = 282

 Score = 97.4 bits (241), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 89/325 (27%), Positives = 137/325 (42%), Gaps = 70/325 (21%)

Query: 12  INLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALY 71
           I+L++G  AG    L   P+DT+K R+Q           A+G  G  R+     G+  +Y
Sbjct: 7   ISLLSGAAAGTSTDLVFFPIDTLKTRLQ-----------AKG--GFFRN----GGYRGVY 49

Query: 72  KGLGAVVIGIIPKMAIRFTSYE--------FFRTLLADRQTGVVSTGNTFVAGVGAGITE 123
           +GLG+ V+   P  ++ F +Y+        FFR LL       V T + F + +G     
Sbjct: 50  RGLGSAVVASAPGASLFFITYDTCKAETRGFFRGLLPSSNVADVVT-HMFSSSMGE--IA 106

Query: 124 AVMVVNPMEVVKIRLQ--AQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRN 181
           A MV  P EVVK R Q  A H  +  L+  L                         K  N
Sbjct: 107 ACMVRVPAEVVKQRSQTHASHSSWETLREIL-------------------------KNEN 141

Query: 182 AIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPSWET 241
                     E   R LYRG S T  R+       F +Y  +K    E  ++D +  W+ 
Sbjct: 142 G---------EGVRRNLYRGWSTTIMREIPFTCIQFPLYEYMKKVWAELDESDRVEPWKG 192

Query: 242 SLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGI 301
           ++ G I+G +   +  PLD +KTRL   K +        +  +   + +EEGF+  + G+
Sbjct: 193 AVCGSIAGGIAAATTTPLDFLKTRLMLCKKSIP------LGTLVSTIYKEEGFKVFFSGV 246

Query: 302 TPRVMRVAPGQAVTFTVYELIRKKL 326
            PR M ++ G A+   +YE +   L
Sbjct: 247 GPRTMWISAGGAIFLGIYETVHSLL 271

 Score = 41.2 bits (95), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 40/91 (43%), Gaps = 20/91 (21%)

Query: 243 LIGLISGALGPFSNA----PLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALY 298
           LI L+SGA    S      P+DT+KTRLQ                      R  G+R +Y
Sbjct: 6   LISLLSGAAAGTSTDLVFFPIDTLKTRLQAKGG----------------FFRNGGYRGVY 49

Query: 299 KGITPRVMRVAPGQAVTFTVYELIRKKLEGL 329
           +G+   V+  APG ++ F  Y+  + +  G 
Sbjct: 50  RGLGSAVVASAPGASLFFITYDTCKAETRGF 80

 Score = 32.0 bits (71), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 25/101 (24%), Positives = 39/101 (38%), Gaps = 7/101 (6%)

Query: 3   NRKNSSHPAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDIS 62
           +  +   P    V G  AG   A    PLD +K R+ +  ++   G            I 
Sbjct: 182 DESDRVEPWKGAVCGSIAGGIAAATTTPLDFLKTRLMLCKKSIPLGT-------LVSTIY 234

Query: 63  TQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQ 103
            +EGF   + G+G   + I    AI    YE   +LL+  +
Sbjct: 235 KEEGFKVFFSGVGPRTMWISAGGAIFLGIYETVHSLLSTNK 275

>YIL006W (YIL006W) [2659] chr9 (344059..345180) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1122 bp, 373 aa]
          Length = 373

 Score = 99.0 bits (245), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 86/326 (26%), Positives = 134/326 (41%), Gaps = 44/326 (13%)

Query: 12  INLVAGGTAGLFEALCCHPLDTIKVRMQIYS-RAREQGQRARGFIGTARDISTQEGFLAL 70
           I  ++G  AG    +   PLD  K R+Q    + R +    RG +GT   I   EG   L
Sbjct: 79  ITALSGAFAGFLSGVAVCPLDVAKTRLQAQGLQTRFENPYYRGIMGTLSTIVRDEGPRGL 138

Query: 71  YKGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNTFVAGVGAGIT---EAVMV 127
           YKGL  +V+G  P   I F+ YEF +        G+    + FVA   A IT    +  +
Sbjct: 139 YKGLVPIVLGYFPTWMIYFSVYEFSKKFFH----GIFPQFD-FVAQSCAAITAGAASTTL 193

Query: 128 VNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATP-KYRNAIQAA 186
            NP+ VVK RL  Q                              N+   P  Y+    A 
Sbjct: 194 TNPIWVVKTRLMLQ-----------------------------SNLGEHPTHYKGTFDAF 224

Query: 187 YVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEY---HQTDMLPSWETSL 243
             +  +EG +ALY G+ + +     +   +F +Y  LK R   Y   + T+ +      +
Sbjct: 225 RKLFYQEGFKALYAGL-VPSLLGLFHVAIHFPIYEDLKVRFHCYSRENNTNSINLQRLIM 283

Query: 244 IGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITP 303
              +S  +      P + ++TR+Q  KS   DS   R+  + +    +EG +  Y G T 
Sbjct: 284 ASSVSKMIASAVTYPHEILRTRMQL-KSDIPDSIQRRLFPLIKATYAQEGLKGFYSGFTT 342

Query: 304 RVMRVAPGQAVTFTVYELIRKKLEGL 329
            ++R  P  A+T   +E  R +LE +
Sbjct: 343 NLVRTIPASAITLVSFEYFRNRLENI 368

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 52/109 (47%), Gaps = 7/109 (6%)

Query: 3   NRKNSSHPAINL----VAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTA 58
           +R+N+++ +INL    +A   + +  +   +P + ++ RMQ+ S   +  QR        
Sbjct: 268 SRENNTN-SINLQRLIMASSVSKMIASAVTYPHEILRTRMQLKSDIPDSIQRR--LFPLI 324

Query: 59  RDISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVV 107
           +    QEG    Y G    ++  IP  AI   S+E+FR  L +  T V+
Sbjct: 325 KATYAQEGLKGFYSGFTTNLVRTIPASAITLVSFEYFRNRLENISTMVI 373

>KLLA0F17864g complement(1634241..1635164) similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 mitochondrial
           carrier protein (MCF), start by similarity
          Length = 307

 Score = 97.8 bits (242), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 80/324 (24%), Positives = 140/324 (43%), Gaps = 52/324 (16%)

Query: 13  NLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYK 72
           ++ +G   G+ + L   P D IKVR+Q         +          D+   EGF+  YK
Sbjct: 27  DVFSGTVGGVAQVLVGQPFDIIKVRLQTMPGNATAWE-------AITDLVKYEGFMGFYK 79

Query: 73  GLGAVVIGIIPKMAIRFTSYE----FFRTLLADRQTGV----VSTGNTFVAGVGAGITEA 124
           G  A ++G+   ++ +F   E    +FR L  +R  G+    +S G  +  G  +G   A
Sbjct: 80  GTMAPLVGVGACVSCQFGINEAMKRYFRDL--NRSRGIYDNTLSLGQYYTCGFVSGSANA 137

Query: 125 VMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQ 184
           ++   P+E V+IRLQ Q                             +   A  +Y++ + 
Sbjct: 138 LLA-TPIEHVRIRLQLQ-----------------------------KEALANAEYKSTLD 167

Query: 185 AAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTL-KSRLQEYHQTDMLPSWETSL 243
               ++K+    +L RG + T  R +   G  F  Y TL  S+L    + + + +W+  +
Sbjct: 168 CTEKLLKQG---SLMRGFTATLMRTSHGFGIYFLTYETLIASQLAHGFRREDISAWKACM 224

Query: 244 IGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITP 303
            G +SGA       P D +K+ +Q DK  +   G + ++ + + + RE G RA  KG  P
Sbjct: 225 FGALSGAFFWAMTYPFDVVKSVMQADKLVNPAYG-TNVVQVAKNIYRERGLRAFTKGFMP 283

Query: 304 RVMRVAPGQAVTFTVYELIRKKLE 327
            ++R  P    TF  +E+  + L+
Sbjct: 284 TMLRSLPVNGATFAAFEVTMQMLK 307

 Score = 33.9 bits (76), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 41/98 (41%), Gaps = 10/98 (10%)

Query: 236 LPSWETSLIGLISGALGPFSNA----PLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIRE 291
           L  +  +L  + SG +G  +      P D IK RLQ     +  + W  I      L++ 
Sbjct: 18  LHGFRKTLKDVFSGTVGGVAQVLVGQPFDIIKVRLQTMPGNA--TAWEAI----TDLVKY 71

Query: 292 EGFRALYKGITPRVMRVAPGQAVTFTVYELIRKKLEGL 329
           EGF   YKG    ++ V    +  F + E +++    L
Sbjct: 72  EGFMGFYKGTMAPLVGVGACVSCQFGINEAMKRYFRDL 109

>CAGL0D01606g complement(169066..169983) highly similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 or sp|P38087
           Saccharomyces cerevisiae YBR104w YMC2, start by
           similarity
          Length = 305

 Score = 95.9 bits (237), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 79/318 (24%), Positives = 132/318 (41%), Gaps = 45/318 (14%)

Query: 13  NLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYK 72
           +L+AG   G+ + L   P DT KVR+Q         +         +++   EG    YK
Sbjct: 28  DLLAGTAGGIAQVLIGQPFDTTKVRLQTSKVPTSAAE-------VVKNLLKNEGPKGFYK 80

Query: 73  GLGAVVIGIIPKMAIRFTSYEFFRTLLADR---QTGVVSTGNTFVAGVGAGITEAVMVVN 129
           G    ++G+   ++I+F   E  +     R       +S    ++ G+  G+T + +  +
Sbjct: 81  GTLTPLVGVGACVSIQFGVNEAMKRFFHARNVDHNATLSLSQYYLCGLTGGMTNSFLA-S 139

Query: 130 PMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAAYVI 189
           P+E V+IRLQ Q            GS                   A  +++  I     I
Sbjct: 140 PIEHVRIRLQTQ-----------TGS------------------GAQAEFKGPIDC---I 167

Query: 190 VKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSR-LQEYHQTDMLPSWETSLIGLIS 248
            K    + L RG+  T  R+    G  F VY  L S+ + +  +   +P W+  L G +S
Sbjct: 168 KKLRSQKGLMRGLIPTMLREGHGCGTYFLVYEALVSKQINQGLKRTEIPPWKLCLYGALS 227

Query: 249 GALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITPRVMRV 308
           G        P+D +K+ +Q D      +G   ++ + R L   EG +A +KG  P ++R 
Sbjct: 228 GTALWLMVYPIDVVKSVMQTDNLNKPQNG-KNMIQVARNLYAREGLKAFFKGFGPTMLRA 286

Query: 309 APGQAVTFTVYELIRKKL 326
           AP    TF  +EL  + L
Sbjct: 287 APANGGTFATFELAMRLL 304

>Sklu_2363.2 YPR011C, Contig c2363 11969-12940
          Length = 323

 Score = 95.5 bits (236), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 87/327 (26%), Positives = 139/327 (42%), Gaps = 38/327 (11%)

Query: 5   KNSSHPAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQ 64
           KN S+ A   +AGG AG        P + +K+ +Q+ +      Q   G +G  R +  +
Sbjct: 19  KNDSNVA--FLAGGLAGAVSRTVVSPFERVKILLQVQNSTTAYNQ---GIVGAVRQVYRE 73

Query: 65  EGFLALYKGLGAVVIGIIPKMAIRFTSYE-----FFRTLLADRQTGVVSTGNTFVAGVGA 119
           EG   L++G G   I I P  A++F  YE     FF    +  +  + +    F   +  
Sbjct: 74  EGTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCG 133

Query: 120 GITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKY 179
           G +  V+   P+++V+ RL  Q      L    A                  N++  P  
Sbjct: 134 GCS--VLATYPLDLVRTRLSIQTANLTKLSKSRA-----------------HNISKPPGV 174

Query: 180 RNAIQAAYVIVKEEGP-RALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPS 238
            + +   Y   KEEG  + LYRGV  T+         NF VY   K  + E     +   
Sbjct: 175 WDLLCRTY---KEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTDNTLANF 231

Query: 239 WETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLI---REEGFR 295
           ++ S IG +SG +      P D ++ R Q       + G+ R  ++   LI   + EGFR
Sbjct: 232 YKLS-IGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGF-RYKSVMDALITIGKTEGFR 289

Query: 296 ALYKGITPRVMRVAPGQAVTFTVYELI 322
             YKG+T  + +V P  AV++ VYE++
Sbjct: 290 GYYKGLTANLFKVIPSTAVSWLVYEVV 316

 Score = 61.2 bits (147), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 59/229 (25%), Positives = 85/229 (37%), Gaps = 52/229 (22%)

Query: 114 VAGVGAGITEAV--MVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXE 171
           VA +  G+  AV   VV+P E VKI LQ Q+                             
Sbjct: 24  VAFLAGGLAGAVSRTVVSPFERVKILLQVQN----------------------------- 54

Query: 172 NVAATPKYRNAIQAAY-VIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEY 230
              +T  Y   I  A   + +EEG   L+RG  L   R        F VY   K      
Sbjct: 55  ---STTAYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHV 111

Query: 231 HQT---DMLPSWETSLIGLISGALGPFSNAPLDTIKTRLQ------------KDKSTSKD 275
             +   + L +W+    G + G     +  PLD ++TRL             +  + SK 
Sbjct: 112 DGSKGREQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKP 171

Query: 276 SGWSRILAIGRQLIREEGFRALYKGITPRVMRVAPGQAVTFTVYELIRK 324
            G   +L   R    E G + LY+G+ P  + V P  A+ F VYE  ++
Sbjct: 172 PGVWDLLC--RTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKE 218

>Scas_667.22
          Length = 306

 Score = 94.7 bits (234), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 84/319 (26%), Positives = 136/319 (42%), Gaps = 46/319 (14%)

Query: 13  NLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYK 72
           +L+AG   G+ + L   P DT KVR+Q  S      +         R +   EG    YK
Sbjct: 28  DLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAME-------VIRKLLKNEGPKGFYK 80

Query: 73  GLGAVVIGIIPKMAIRFTSYE----FFRTLLADRQTGVVSTGNTFVAGVGAGITEAVMVV 128
           G    +IG+   ++++F   E    FF +   D  + ++S    ++ G+  GIT + +  
Sbjct: 81  GTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGLTGGITNSFLA- 139

Query: 129 NPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAAYV 188
           +P+E V+IRLQ Q            GS                NV    +++  +     
Sbjct: 140 SPIEHVRIRLQTQ-----------TGS--------------GPNV----EFKGPLDC--- 167

Query: 189 IVKEEGPRALYRGVSLTAARQATNQGANFTVYSTL-KSRLQEYHQTDMLPSWETSLIGLI 247
           I K        RG++ T  R+    G  F VY  +  + + +  +   +P+W+  L G +
Sbjct: 168 IRKLRAQGGFMRGLTPTMLREGHGCGTYFLVYEAMVANEINKGFKRTEVPAWKLCLFGAL 227

Query: 248 SGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITPRVMR 307
           SG        PLD IK+ +Q D   S   G S I ++ + L  + G  A +KG  P ++R
Sbjct: 228 SGTTLWMMVYPLDVIKSVMQTDNLKSPKYGNS-ISSVAKTLYAKGGLGAFFKGFGPTMLR 286

Query: 308 VAPGQAVTFTVYELIRKKL 326
            AP    TF  +EL  + L
Sbjct: 287 AAPANGATFATFELAMRLL 305

>Scas_718.5
          Length = 324

 Score = 95.1 bits (235), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 80/332 (24%), Positives = 142/332 (42%), Gaps = 52/332 (15%)

Query: 5   KNSSHPAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQ 64
           K+S+    +++AG   G+ + +   P DT KVRMQ  +++        G +   R +   
Sbjct: 34  KDSTRVLKDILAGTCGGISQVIVGQPFDTTKVRMQTSAKSV-------GALDIIRKLVKN 86

Query: 65  EGFLALYKGLGAVVIGIIPKMAIRFTSYE----FFRTLLADRQT----GVVSTGNTFVAG 116
           EG  A YKG    ++G+   ++++F   E    FFR     R T    G +  G  ++ G
Sbjct: 87  EGVWAFYKGSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICG 146

Query: 117 VGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAAT 176
           +  G+  + +  +P+E V+IRLQ Q                                   
Sbjct: 147 LTGGVVNSFLA-SPIEHVRIRLQTQ-----------------------------TGNGNE 176

Query: 177 PKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTL-KSRLQEYHQTDM 235
            +++  +     +VKE   ++L RG+     R     G  F  Y  L  + +++      
Sbjct: 177 REFKGPLDCIRKLVKE---KSLMRGLRPMMLRAGHGLGCYFLTYEALIANEIKKGKDRSE 233

Query: 236 LPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILA-IGRQLIREEGF 294
           + SW+    G +SG +   +  PLD +K+ +Q D  T ++  +   +  +   L RE+G 
Sbjct: 234 IASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQTD--TLRNPRFKNSMKNVINHLYREQGI 291

Query: 295 RALYKGITPRVMRVAPGQAVTFTVYELIRKKL 326
            A +KG  P ++R AP    TF  +EL+ + L
Sbjct: 292 SAFFKGFAPTMLRAAPVNGATFVTFELVMRLL 323

>Kwal_0.232
          Length = 274

 Score = 94.0 bits (232), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 80/327 (24%), Positives = 130/327 (39%), Gaps = 73/327 (22%)

Query: 13  NLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYK 72
           +L+AG  AG    L   P+DT+K R+Q           A GF           G+L +Y+
Sbjct: 9   SLLAGAAAGTSTDLFFFPIDTLKTRLQ----------AAGGFFANG-------GYLGVYR 51

Query: 73  GLGAVVIGIIPKMAIRFTSYE--------FFRTLLADRQTGVVSTGNTFVAGVGAGITEA 124
           GLG+ V+   P  ++ F +Y+         F  L+       V+   T +    AG   A
Sbjct: 52  GLGSAVVASAPSASLFFVTYDGMKSYSRPIFNNLITSSDQ--VAETATHMFSSSAGEIAA 109

Query: 125 VMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQ 184
            MV  P EV+K R Q                                    T K  +++Q
Sbjct: 110 CMVRVPAEVIKQRTQ------------------------------------THKSDSSLQ 133

Query: 185 AAYVIVKEEGP----RALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPSWE 240
               +++ E      R LYRG S T  R+       F +Y  LK +       + +  W+
Sbjct: 134 TLKKLLQNENGEGIRRNLYRGWSTTVMREIPFTCIQFPLYEFLKKQWAISGGREQVAPWQ 193

Query: 241 TSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKG 300
            +  G ++G +   +  PLD +KTRL    ++        +L + RQ+   EG++  + G
Sbjct: 194 GAFCGCVAGGIAAATTTPLDVLKTRLMLSHTSVP------VLHLARQIYATEGWKVFFSG 247

Query: 301 ITPRVMRVAPGQAVTFTVYELIRKKLE 327
           + PR + ++ G A+   VYE +   L 
Sbjct: 248 VGPRTVWISAGGAIFLGVYETVHSILS 274

>Scas_558.2
          Length = 289

 Score = 92.8 bits (229), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 80/333 (24%), Positives = 136/333 (40%), Gaps = 74/333 (22%)

Query: 12  INLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALY 71
           ++L++G  AG    L   P+DT+K R+Q      + G                 G+  +Y
Sbjct: 8   MSLLSGAAAGTSTDLVFFPIDTLKTRLQAKGGFFQNG-----------------GYHGIY 50

Query: 72  KGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTG--------NTFVAGVGAGITE 123
           +GLG+ V+   P  ++ F +Y+  +  +      V+++         +T V  + + + E
Sbjct: 51  RGLGSAVVASAPSASLFFVTYDSMKVRVRPHVERVINSSGTRSPHSVDTIVHMIASSMGE 110

Query: 124 --AVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRN 181
             A +V  P EV+K R Q                                         +
Sbjct: 111 LAACLVRVPAEVIKQRTQVHSTN------------------------------------S 134

Query: 182 AIQAAYVIVKEEGP----RALYRGVSLTAARQATNQGANFTVYSTLKSRLQEY-HQTDML 236
           + Q    I+K E      R LYRG S T  R+       F +Y  +K     Y ++   L
Sbjct: 135 SWQTFRTILKNENQEGIIRNLYRGWSTTIMREIPFTCIQFPLYEFMKKEWALYDNEVGHL 194

Query: 237 PSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRA 296
             W+ ++ G I+G +   +  PLD +KTRL  +K +        I ++ R + +EEGF+ 
Sbjct: 195 KPWKGAICGSIAGGIAAATTTPLDFLKTRLMLNKDSIP------IKSLIRNIYKEEGFKI 248

Query: 297 LYKGITPRVMRVAPGQAVTFTVYELIRKKLEGL 329
            + GI PR M ++ G A+   VYE +   L+ L
Sbjct: 249 FFSGIYPRTMWISAGGAIFLGVYETMHFMLQSL 281

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 21/88 (23%), Positives = 39/88 (44%), Gaps = 20/88 (22%)

Query: 243 LIGLISGALGPFSNA----PLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALY 298
           ++ L+SGA    S      P+DT+KTRLQ                      +  G+  +Y
Sbjct: 7   VMSLLSGAAAGTSTDLVFFPIDTLKTRLQAKGG----------------FFQNGGYHGIY 50

Query: 299 KGITPRVMRVAPGQAVTFTVYELIRKKL 326
           +G+   V+  AP  ++ F  Y+ ++ ++
Sbjct: 51  RGLGSAVVASAPSASLFFVTYDSMKVRV 78

>CAGL0J02002g 198226..199311 similar to sp|P40556 Saccharomyces
           cerevisiae YIL006w or sp|P39953 Saccharomyces cerevisiae
           YEL006w, hypothetical start
          Length = 361

 Score = 94.0 bits (232), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 90/327 (27%), Positives = 137/327 (41%), Gaps = 44/327 (13%)

Query: 12  INLVAGGTAGLFEALCCHPLDTIKVRMQ---IYSRAREQGQRARGFIGTARDISTQEGFL 68
           IN ++G  AGL   +   PLD  K R+Q   + +R  E     RG IGT   I   EG  
Sbjct: 70  INAISGALAGLLSGIVVCPLDVAKTRLQAQGLQTRTTEN-LYYRGSIGTMTTIVRDEGVR 128

Query: 69  ALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNTFVAGVGAGITEAVMVV 128
            LYKGL  +++G  P   I F+ YEF +  L    +      ++F A + AG    V V 
Sbjct: 129 GLYKGLVPIIMGYFPTWMIYFSVYEFCKDNLRTNSSNWSFVSHSFSA-ITAGAVSTV-VT 186

Query: 129 NPMEVVKIRLQAQ-HVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAAY 187
           NP+ VVK RL  Q H+          GS                    T  Y+    A  
Sbjct: 187 NPIWVVKTRLMLQTHI----------GS-------------------NTTHYQGTYDAFK 217

Query: 188 VIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPSWETSLIGLI 247
            I+ +EG +ALY G+ + +     +   +F VY  LK   + Y + +     + +L  LI
Sbjct: 218 KIINQEGVKALYAGL-VPSLLGLLHVAIHFPVYERLKVSFKCYQRDESSNESKINLKRLI 276

Query: 248 -----SGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGIT 302
                S  +    + P + ++TRLQ    +   S   R++ + +    +EG    Y G  
Sbjct: 277 LASSVSKMVASVLSYPHEILRTRLQ--LKSDLPSHQRRLIPLIKITYIQEGIFGFYSGFG 334

Query: 303 PRVMRVAPGQAVTFTVYELIRKKLEGL 329
             + R  P  A+T   +E +R  L  +
Sbjct: 335 TNLFRTLPASAITLVSFEYVRNFLNKI 361

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 44/99 (44%), Gaps = 7/99 (7%)

Query: 5   KNSSHPAINL----VAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARD 60
           ++S+   INL    +A   + +  ++  +P + ++ R+Q+ S      +R    I   + 
Sbjct: 263 ESSNESKINLKRLILASSVSKMVASVLSYPHEILRTRLQLKSDLPSHQRR---LIPLIKI 319

Query: 61  ISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLL 99
              QEG    Y G G  +   +P  AI   S+E+ R  L
Sbjct: 320 TYIQEGIFGFYSGFGTNLFRTLPASAITLVSFEYVRNFL 358

>Scas_582.7
          Length = 329

 Score = 93.2 bits (230), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 83/325 (25%), Positives = 126/325 (38%), Gaps = 58/325 (17%)

Query: 14  LVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYKG 73
           L+AG  AG+ E     P+D +K R+Q  +  +   Q +   I     IST EG LAL+KG
Sbjct: 40  LLAGAFAGIMEHSTMFPIDALKTRIQ-STTTKGTEQTSTSIIKQISKISTMEGSLALWKG 98

Query: 74  LGAVVIGIIPKMAIRFTSYEFFRT-LLADRQTGVVSTGNTFVAGVGAGITEAVMVVNPME 132
           + +V++G  P  A+ F +YEF +  L+ D Q          V+G  A +      +NP +
Sbjct: 99  VQSVILGAGPAHAVYFATYEFTKAHLIPDSQRETHQPIKVAVSGATATVASD-FFMNPFD 157

Query: 133 VVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAAYVIVKE 192
            +K R+Q   +                                  K       A  I   
Sbjct: 158 TIKQRMQISDL----------------------------------KKEKVYNVAKKIYNL 183

Query: 193 EGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPSWETSLIGLISGALG 252
           EG  A Y     T A        NF +Y +        H  + L      L G ISGA+ 
Sbjct: 184 EGLSAFYYSYPTTIAMNIPFAAFNFMIYESASKFFNPLHHYNPLIH---CLCGGISGAIA 240

Query: 253 PFSNAPLDTIKTRLQ-----------KDKSTSKDSGWSRILAIGRQLIREEGFRALYKGI 301
                PLD IKT +Q             K+ +     S IL +        G++  ++G+
Sbjct: 241 AAVTTPLDCIKTVIQIRGSSVVSLEVMKKANTFKKATSAILMV-------YGWKGFWRGL 293

Query: 302 TPRVMRVAPGQAVTFTVYELIRKKL 326
            PR++   P  A+++T YE  +  L
Sbjct: 294 QPRILANMPATAISWTAYECAKHFL 318

 Score = 44.3 bits (103), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 38/143 (26%), Positives = 57/143 (39%), Gaps = 21/143 (14%)

Query: 3   NRKNSSHPAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDIS 62
           +++ +  P    V+G TA +      +P DTIK RMQI    +E+          A+ I 
Sbjct: 128 SQRETHQPIKVAVSGATATVASDFFMNPFDTIKQRMQISDLKKEK------VYNVAKKIY 181

Query: 63  TQEGFLALYKGLGAVVIGIIPKMAIRFTSYE----FFRTLLADRQTGVVSTGNTFVAGVG 118
             EG  A Y      +   IP  A  F  YE    FF  L            N  +  + 
Sbjct: 182 NLEGLSAFYYSYPTTIAMNIPFAAFNFMIYESASKFFNPL---------HHYNPLIHCLC 232

Query: 119 AGITEAV--MVVNPMEVVKIRLQ 139
            GI+ A+   V  P++ +K  +Q
Sbjct: 233 GGISGAIAAAVTTPLDCIKTVIQ 255

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 46/100 (46%), Gaps = 3/100 (3%)

Query: 3   NRKNSSHPAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRA---REQGQRARGFIGTAR 59
           N  +  +P I+ + GG +G   A    PLD IK  +QI   +    E  ++A  F     
Sbjct: 219 NPLHHYNPLIHCLCGGISGAIAAAVTTPLDCIKTVIQIRGSSVVSLEVMKKANTFKKATS 278

Query: 60  DISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLL 99
            I    G+   ++GL   ++  +P  AI +T+YE  +  L
Sbjct: 279 AILMVYGWKGFWRGLQPRILANMPATAISWTAYECAKHFL 318

>Scas_578.3*
          Length = 524

 Score = 94.7 bits (234), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 84/334 (25%), Positives = 140/334 (41%), Gaps = 57/334 (17%)

Query: 14  LVAGGTAGLFEALCCHPLDTIKV---------------RMQIYSRAREQGQRARGFIGTA 58
            +AGG +G+    C  PLD IKV               +M +  +     +     I   
Sbjct: 212 FIAGGLSGVISRTCTAPLDRIKVFLIARTDLSSTLLNPKMHLRIQGLNLAKIRSPIIKAI 271

Query: 59  RDISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLA----DRQTGVVSTGNTFV 114
           R +  Q G  A Y G G  V  I P+ +I+F ++E  + L+A    D+    +S   T+V
Sbjct: 272 RSLYRQGGLRAFYVGNGLSVFKICPESSIKFGTFELAKRLMANLSGDKLVNDLSKLQTYV 331

Query: 115 AGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVA 174
           AG  AG+  A + + P++ +K R+Q       PL+  L G+                   
Sbjct: 332 AGGIAGVM-AQISIYPIDTLKFRIQC-----APLEGNLKGNALL---------------- 369

Query: 175 ATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLK-------SRL 227
                   I  A  + KE G R  YRGV L A         +   +S LK       S+ 
Sbjct: 370 --------ISTAKEMYKEGGIRVFYRGVLLGALGIFPYAALDLGTFSALKKWYIKRQSKK 421

Query: 228 QEYHQTDMLPSWETSL-IGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGR 286
               + D++ S+   L +G  SG +G  +  P++ ++TRLQ   + +    ++    +  
Sbjct: 422 LNIPEKDVMLSYLLVLPMGAFSGTVGATAVYPINLLRTRLQAQGTYAHPYTYTGFRDVFM 481

Query: 287 QLIREEGFRALYKGITPRVMRVAPGQAVTFTVYE 320
           Q ++ EG    YKG+ P +++V P  ++ +  YE
Sbjct: 482 QTLKREGVPGFYKGLVPTLVKVCPAVSIGYLCYE 515

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/145 (22%), Positives = 68/145 (46%), Gaps = 3/145 (2%)

Query: 183 IQAAYVIVKEEGPRALYRGVSLTAAR---QATNQGANFTVYSTLKSRLQEYHQTDMLPSW 239
           I+A   + ++ G RA Y G  L+  +   +++ +   F +   L + L      + L   
Sbjct: 268 IKAIRSLYRQGGLRAFYVGNGLSVFKICPESSIKFGTFELAKRLMANLSGDKLVNDLSKL 327

Query: 240 ETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYK 299
           +T + G I+G +   S  P+DT+K R+Q         G + +++  +++ +E G R  Y+
Sbjct: 328 QTYVAGGIAGVMAQISIYPIDTLKFRIQCAPLEGNLKGNALLISTAKEMYKEGGIRVFYR 387

Query: 300 GITPRVMRVAPGQAVTFTVYELIRK 324
           G+    + + P  A+    +  ++K
Sbjct: 388 GVLLGALGIFPYAALDLGTFSALKK 412

 Score = 36.2 bits (82), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 43/92 (46%), Gaps = 11/92 (11%)

Query: 14  LVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTA-RDISTQ----EGFL 68
           L  G  +G   A   +P++ ++ R+Q       QG  A  +  T  RD+  Q    EG  
Sbjct: 437 LPMGAFSGTVGATAVYPINLLRTRLQ------AQGTYAHPYTYTGFRDVFMQTLKREGVP 490

Query: 69  ALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLA 100
             YKGL   ++ + P ++I +  YE F+  ++
Sbjct: 491 GFYKGLVPTLVKVCPAVSIGYLCYEKFKAAMS 522

 Score = 34.7 bits (78), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 49/113 (43%), Gaps = 16/113 (14%)

Query: 233 TDMLPSWETSLIGLISGALGPFSNAPLDTIKTRL--QKDKSTS--------KDSGW---- 278
            D +  +   + G +SG +     APLD IK  L  + D S++        +  G     
Sbjct: 203 NDFIKGFGYFIAGGLSGVISRTCTAPLDRIKVFLIARTDLSSTLLNPKMHLRIQGLNLAK 262

Query: 279 --SRILAIGRQLIREEGFRALYKGITPRVMRVAPGQAVTFTVYELIRKKLEGL 329
             S I+   R L R+ G RA Y G    V ++ P  ++ F  +EL ++ +  L
Sbjct: 263 IRSPIIKAIRSLYRQGGLRAFYVGNGLSVFKICPESSIKFGTFELAKRLMANL 315

>YJL133W (MRS3) [2785] chr10 (160537..161481) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses mitochondrial
           splicing defects [945 bp, 314 aa]
          Length = 314

 Score = 90.9 bits (224), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 84/321 (26%), Positives = 132/321 (41%), Gaps = 54/321 (16%)

Query: 14  LVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYKG 73
           L+AG  AG+ E     P+D +K R+Q    A  +   A+  +     IST EG LAL+KG
Sbjct: 37  LIAGAFAGIMEHSVMFPIDALKTRIQ---SANAKSLSAKNMLSQISHISTSEGTLALWKG 93

Query: 74  LGAVVIGIIPKMAIRFTSYEFFRTLLAD-RQTGVVSTGNTFVAGVGAGITEAVMVVNPME 132
           + +V++G  P  A+ F +YEF +  L D   T       T ++G  A  T +  ++NP +
Sbjct: 94  VQSVILGAGPAHAVYFGTYEFCKKNLIDSSDTQTHHPFKTAISGACA-TTASDALMNPFD 152

Query: 133 VVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAAYVIVKE 192
            +K R+Q                                N +A+       Q    I + 
Sbjct: 153 TIKQRIQL-------------------------------NTSAS-----VWQTTKQIYQS 176

Query: 193 EGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPSWETSLIGLISGALG 252
           EG  A Y     T          NF +Y +    L   ++ + L      L G ISG+  
Sbjct: 177 EGLAAFYYSYPTTLVMNIPFAAFNFVIYESSTKFLNPSNEYNPLIH---CLCGSISGSTC 233

Query: 253 PFSNAPLDTIKTRLQKDKSTS-------KDSGWSRILAIGRQLIREEGFRALYKGITPRV 305
                PLD IKT LQ   S +       K   +S+  +   Q+    G++  ++G  PR+
Sbjct: 234 AAITTPLDCIKTVLQIRGSQTVSLEIMRKADTFSKAASAIYQVY---GWKGFWRGWKPRI 290

Query: 306 MRVAPGQAVTFTVYELIRKKL 326
           +   P  A+++T YE  +  L
Sbjct: 291 VANMPATAISWTAYECAKHFL 311

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 46/107 (42%), Gaps = 11/107 (10%)

Query: 220 YSTLKSRLQEYHQTDMLPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWS 279
           Y  L +    YHQ          + G  +G +      P+D +KTR+Q   + S  +   
Sbjct: 24  YEALPTHAPLYHQL---------IAGAFAGIMEHSVMFPIDALKTRIQSANAKSLSA--K 72

Query: 280 RILAIGRQLIREEGFRALYKGITPRVMRVAPGQAVTFTVYELIRKKL 326
            +L+    +   EG  AL+KG+   ++   P  AV F  YE  +K L
Sbjct: 73  NMLSQISHISTSEGTLALWKGVQSVILGAGPAHAVYFGTYEFCKKNL 119

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 46/100 (46%), Gaps = 3/100 (3%)

Query: 3   NRKNSSHPAINLVAGGTAGLFEALCCHPLDTIKVRMQI---YSRAREQGQRARGFIGTAR 59
           N  N  +P I+ + G  +G   A    PLD IK  +QI    + + E  ++A  F   A 
Sbjct: 212 NPSNEYNPLIHCLCGSISGSTCAAITTPLDCIKTVLQIRGSQTVSLEIMRKADTFSKAAS 271

Query: 60  DISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLL 99
            I    G+   ++G    ++  +P  AI +T+YE  +  L
Sbjct: 272 AIYQVYGWKGFWRGWKPRIVANMPATAISWTAYECAKHFL 311

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 37/154 (24%), Positives = 60/154 (38%), Gaps = 23/154 (14%)

Query: 2   SNRKNSSHPAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDI 61
           S+   + HP    ++G  A        +P DTIK R+Q+ + A            T + I
Sbjct: 122 SSDTQTHHPFKTAISGACATTASDALMNPFDTIKQRIQLNTSA--------SVWQTTKQI 173

Query: 62  STQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNTF------VA 115
              EG  A Y      ++  IP  A  F  YE          T  ++  N +      + 
Sbjct: 174 YQSEGLAAFYYSYPTTLVMNIPFAAFNFVIYE--------SSTKFLNPSNEYNPLIHCLC 225

Query: 116 GVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLK 149
           G  +G T A  +  P++ +K  LQ +  + V L+
Sbjct: 226 GSISGSTCAA-ITTPLDCIKTVLQIRGSQTVSLE 258

>KLLA0B08503g complement(753498..754409) similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 mitochondrial
           carrier protein (MCF), start by similarity
          Length = 303

 Score = 90.5 bits (223), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 79/300 (26%), Positives = 132/300 (44%), Gaps = 47/300 (15%)

Query: 13  NLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYK 72
           +L+AG   G+ + L   P DT KVR+Q         + +   +   +D+   EG +  YK
Sbjct: 26  DLLAGTAGGIAQVLVGQPFDTTKVRLQ-------TSETSTNAVKVIKDLIKNEGPMGFYK 78

Query: 73  GLGAVVIGIIPKMAIRFTSYE----FFRTLLADRQTGVVSTGNTFVAGVGAGITEAVMVV 128
           G    ++G+   ++++F   E    FF T   +  +  +S    ++ GV  G T + +  
Sbjct: 79  GTLTPLVGVGACVSLQFGVNEAMKRFFHT-FDEAASQHLSLLQYYICGVAGGFTNSFL-A 136

Query: 129 NPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAAYV 188
           +P+E ++IRLQ Q            GS                   AT +++  I     
Sbjct: 137 SPIEHIRIRLQTQ-----------TGS------------------GATAEFKGPIDC--- 164

Query: 189 IVKEEGPRALYRGVSLTAARQATNQGANFTVYSTL-KSRLQEYHQTDMLPSWETSLIGLI 247
           I K      L RG++ T  R++   G  F  Y  L   +++   Q   +P+W+  L G  
Sbjct: 165 IKKLRVNGQLMRGLTPTMLRESHGCGVYFLTYEALIGHQVKSGIQRKDIPAWKLCLFGAA 224

Query: 248 SGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITPRVMR 307
           SG L      PLD IK+ +Q D   +  +G + IL +GR +I  +G   L+KG  P ++R
Sbjct: 225 SGTLLWTMVYPLDVIKSVMQTDNLKTPKNG-NNILTVGRTIIARQGVSGLFKGFAPTMLR 283

>YPR058W (YMC1) [5488] chr16 (673746..674669) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [924 bp, 307 aa]
          Length = 307

 Score = 90.1 bits (222), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 83/321 (25%), Positives = 132/321 (41%), Gaps = 49/321 (15%)

Query: 13  NLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYK 72
           +L+AG   G+ + L   P DT KVR+Q  S            +   R +   EG    YK
Sbjct: 28  DLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTA-------MEVVRKLLANEGPRGFYK 80

Query: 73  GLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVST---GNTFVAGVGAGITEAVMVVN 129
           G    +IG+   ++++F   E  +     R   + ST      +  GV  GI  + +  +
Sbjct: 81  GTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYACGVTGGIVNSFLA-S 139

Query: 130 PMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAAYVI 189
           P+E V+IRLQ Q            GS                      +++  ++    I
Sbjct: 140 PIEHVRIRLQTQ-----------TGS------------------GTNAEFKGPLEC---I 167

Query: 190 VKEEGPRALYRGVSLTAARQATNQGANFTVYSTL----KSRLQEYHQTDMLPSWETSLIG 245
            K    +AL RG++ T  R+    G  F VY  L     ++ +   + D +P+W+  + G
Sbjct: 168 KKLRHNKALLRGLTPTILREGHGCGTYFLVYEALIANQMNKRRGLERKD-IPAWKLCIFG 226

Query: 246 LISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITPRV 305
            +SG        PLD IK+ +Q D       G S I ++ + L    G  A +KG  P +
Sbjct: 227 ALSGTALWLMVYPLDVIKSVMQTDNLQKPKFGNS-ISSVAKTLYANGGIGAFFKGFGPTM 285

Query: 306 MRVAPGQAVTFTVYELIRKKL 326
           +R AP    TF  +EL  + L
Sbjct: 286 LRAAPANGATFATFELAMRLL 306

 Score = 35.0 bits (79), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 43/102 (42%), Gaps = 6/102 (5%)

Query: 223 LKSRLQEYHQTDMLPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRIL 282
           L   L+E+ Q D     +  L G   G        P DT K RLQ   + +        +
Sbjct: 10  LIDDLEEHPQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTT------AM 63

Query: 283 AIGRQLIREEGFRALYKGITPRVMRVAPGQAVTFTVYELIRK 324
            + R+L+  EG R  YKG    ++ V    ++ F V E +++
Sbjct: 64  EVVRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKR 105

>ACR260W [1307] [Homologous to ScYJL133W (MRS3) - SH; ScYKR052C
           (MRS4) - SH] complement(823895..824830) [936 bp, 311 aa]
          Length = 311

 Score = 89.7 bits (221), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 84/322 (26%), Positives = 131/322 (40%), Gaps = 51/322 (15%)

Query: 14  LVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQG--QRARGFIGTARDISTQEGFLALY 71
           L AG  AG+ E     P+D IK RMQ  S        +     +     IST EG LAL+
Sbjct: 21  LAAGAFAGIMEHSIMFPIDAIKTRMQAVSTTGSSAATRLPSNMLAQIAKISTTEGSLALW 80

Query: 72  KGLGAVVIGIIPKMAIRFTSYEFFRTLL---ADRQTGVVSTGNTFVAGVGAGITEAVMVV 128
           KG+ +VV+G  P  A+ F +YE  ++ L    DRQT       T ++G  A +  A  ++
Sbjct: 81  KGVQSVVLGAGPAHAVYFATYEMCKSRLIDPEDRQTH--QPLKTALSGTLATVA-ADALM 137

Query: 129 NPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAAYV 188
           NP + +K RLQ                                         +  + A  
Sbjct: 138 NPFDTIKQRLQLH------------------------------------PSDSMTKCAVR 161

Query: 189 IVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPSWETSLIGLIS 248
           + + EG  A +     T A        NF +Y   +S  + ++ ++    W   L G IS
Sbjct: 162 MYQREGIAAFFYSYPTTIAMNIPFAALNFVIY---ESSTKIFNPSNNYNPWIHCLCGGIS 218

Query: 249 GALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQ----LIREEGFRALYKGITPR 304
           GA       PLD +KT LQ   + S  S   +     R+    + +  G+   ++G+ PR
Sbjct: 219 GATCAAITTPLDCVKTVLQIRGADSVQSQLFKEADTFRKAASAIHKTYGWSGFFRGLKPR 278

Query: 305 VMRVAPGQAVTFTVYELIRKKL 326
           ++   P  A+++T YE  +  L
Sbjct: 279 IISNMPATAISWTSYEFAKHLL 300

 Score = 54.3 bits (129), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 48/100 (48%), Gaps = 3/100 (3%)

Query: 3   NRKNSSHPAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQ---RARGFIGTAR 59
           N  N+ +P I+ + GG +G   A    PLD +K  +QI      Q Q    A  F   A 
Sbjct: 201 NPSNNYNPWIHCLCGGISGATCAAITTPLDCVKTVLQIRGADSVQSQLFKEADTFRKAAS 260

Query: 60  DISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLL 99
            I    G+   ++GL   +I  +P  AI +TSYEF + LL
Sbjct: 261 AIHKTYGWSGFFRGLKPRIISNMPATAISWTSYEFAKHLL 300

>Sklu_2442.8 YNL003C, Contig c2442 12309-13136
          Length = 275

 Score = 89.0 bits (219), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 83/335 (24%), Positives = 135/335 (40%), Gaps = 73/335 (21%)

Query: 6   NSSHPAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQE 65
           +SS   ++L +G  AG    L   P+DT+K R+Q      + G  A G            
Sbjct: 2   DSSSFLVSLASGAAAGTSTDLAFFPIDTLKTRLQ-----AKGGFFANG------------ 44

Query: 66  GFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGN--------TFVAGV 117
           G+  +Y+GLG+ VI   P  ++ F SY+  +       +  V++ N         F + +
Sbjct: 45  GYKGVYRGLGSAVIASAPSASLFFVSYDSMKVYSKPVISKYVTSNNQMADTLSHMFSSSI 104

Query: 118 GAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATP 177
           G     A +V  P EV+K R Q                                    T 
Sbjct: 105 GE--VSACLVRVPAEVIKQRTQ------------------------------------TH 126

Query: 178 KYRNAIQAAYVIVKEEGP----RALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQT 233
           K  ++ Q    I++ E      R LYRG + T  R+       F +Y  LK    + +  
Sbjct: 127 KTNSSWQTFTKILQNENGEGVLRNLYRGWNTTIMREIPFTCIQFPLYEFLKKTWAKRNGQ 186

Query: 234 DMLPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEG 293
           D +  W+ S+ G ++GA+   +  PLD +KTRL     +        +  + + +  EEG
Sbjct: 187 DHVAPWQGSVCGSVAGAIAAATTTPLDVLKTRLMLSHKSIP------VAQLAKNIYAEEG 240

Query: 294 FRALYKGITPRVMRVAPGQAVTFTVYELIRKKLEG 328
           F+  + G+ PR M ++ G A+   VYE +   L G
Sbjct: 241 FKVFFSGVGPRTMWISAGGAIFLGVYETVHSILSG 275

>AAL014C [173] [Homologous to ScYNL003C (PET8) - SH]
           (317388..318203) [816 bp, 271 aa]
          Length = 271

 Score = 88.2 bits (217), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 78/320 (24%), Positives = 131/320 (40%), Gaps = 68/320 (21%)

Query: 13  NLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYK 72
           +LV+G  AG    +   P+DT+K R+Q             GF           G+  +Y+
Sbjct: 8   SLVSGAAAGTSTDVVFFPIDTLKTRLQAKG----------GFFHNG-------GYRGIYR 50

Query: 73  GLGAVVIGIIPKMAIRFTSYEFFRTLL---ADRQTGVVSTGNTFVAGVGAGITE--AVMV 127
           GLG+ V+   P  ++ F +Y+  +  L     R T            + + + E  A +V
Sbjct: 51  GLGSAVVASAPGASLFFVTYDSMKQQLRPVMGRWTASEQLAEVLTHMLSSSLGEMSACLV 110

Query: 128 VNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAAY 187
             P EV+K R Q  H                                      +++Q   
Sbjct: 111 RVPAEVIKQRTQTHHTN------------------------------------SSLQTLR 134

Query: 188 VIVKE---EGP-RALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPSWETSL 243
           +I+++   EG  R LYRG   T  R+       F +Y  LK +   Y + + + +W+ ++
Sbjct: 135 LILRDPTGEGVVRGLYRGWWTTIMREIPFTCIQFPLYEYLKKKWAAYAEIERVSAWQGAV 194

Query: 244 IGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITP 303
            G ++G +   +  PLD +KTR+   +          +L + R L REEG R  ++GI P
Sbjct: 195 CGSLAGGIAAAATTPLDVLKTRMMLHERRVP------MLHLARTLFREEGARVFFRGIGP 248

Query: 304 RVMRVAPGQAVTFTVYELIR 323
           R M ++ G A+   VYE + 
Sbjct: 249 RTMWISAGGAIFLGVYEAVH 268

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/156 (26%), Positives = 62/156 (39%), Gaps = 18/156 (11%)

Query: 180 RNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPSW 239
           +  +QA        G R +YRG+       A      F  Y ++K +L+      ++  W
Sbjct: 30  KTRLQAKGGFFHNGGYRGIYRGLGSAVVASAPGASLFFVTYDSMKQQLR-----PVMGRW 84

Query: 240 ETS------LIGLISGALGPFS----NAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLI 289
             S      L  ++S +LG  S      P + IK R Q   + S       IL   R   
Sbjct: 85  TASEQLAEVLTHMLSSSLGEMSACLVRVPAEVIKQRTQTHHTNSSLQTLRLIL---RDPT 141

Query: 290 REEGFRALYKGITPRVMRVAPGQAVTFTVYELIRKK 325
            E   R LY+G    +MR  P   + F +YE ++KK
Sbjct: 142 GEGVVRGLYRGWWTTIMREIPFTCIQFPLYEYLKKK 177

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 41/90 (45%), Gaps = 20/90 (22%)

Query: 241 TSLIGLISGALGPFSNA----PLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRA 296
           T L  L+SGA    S      P+DT+KTRLQ                         G+R 
Sbjct: 4   TFLASLVSGAAAGTSTDVVFFPIDTLKTRLQAKGG----------------FFHNGGYRG 47

Query: 297 LYKGITPRVMRVAPGQAVTFTVYELIRKKL 326
           +Y+G+   V+  APG ++ F  Y+ ++++L
Sbjct: 48  IYRGLGSAVVASAPGASLFFVTYDSMKQQL 77

 Score = 28.5 bits (62), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 31/70 (44%), Gaps = 7/70 (10%)

Query: 30  PLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYKGLGAVVIGIIPKMAIRF 89
           PLD +K RM ++       +R    +  AR +  +EG    ++G+G   + I    AI  
Sbjct: 209 PLDVLKTRMMLH-------ERRVPMLHLARTLFREEGARVFFRGIGPRTMWISAGGAIFL 261

Query: 90  TSYEFFRTLL 99
             YE   +L 
Sbjct: 262 GVYEAVHSLF 271

>CAGL0K08250g complement(820185..821078) highly similar to sp|P23500
           Saccharomyces cerevisiae YKR052c Mitochondrial RNA
           splicing protein, hypothetical start
          Length = 297

 Score = 88.2 bits (217), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 83/318 (26%), Positives = 132/318 (41%), Gaps = 49/318 (15%)

Query: 14  LVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYKG 73
           L+AG  AG+ E     P+D IK R+Q    +   G   +G I     I+T EG LAL+KG
Sbjct: 20  LLAGAFAGIMEHSVLFPVDAIKTRIQ----SSSSGAATQGLIKQISKITTAEGSLALWKG 75

Query: 74  LGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTG-NTFVAGVGAGITEAVMVVNPME 132
           + +V++G  P  A+ F +YEF ++ L D Q         T ++G+ A  T A  ++NP +
Sbjct: 76  VQSVILGAGPAHAVYFATYEFSKSKLIDPQDMHTHQPIKTAISGM-AATTVADALMNPFD 134

Query: 133 VVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAAYVIVKE 192
           V+K R+Q                               E+V    K          I  +
Sbjct: 135 VIKQRMQLN---------------------------TRESVWHVTKN---------IYHK 158

Query: 193 EGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPSWETSLIGLISGALG 252
           EG  A Y     T          NF +Y +    +   ++ +    +   + G +SGA  
Sbjct: 159 EGFAAFYYSYPTTLVMNIPFAAFNFAIYESATKFMNPSNEYN---PFIHCISGGLSGATC 215

Query: 253 PFSNAPLDTIKTRLQ-KDKSTSKDSGWSRILAIGR---QLIREEGFRALYKGITPRVMRV 308
                PLD IKT LQ +   T  +    +     R    + +  G++   +G+ PRV+  
Sbjct: 216 AAITTPLDCIKTVLQVRGSETVSNEIMKQANTFQRAASAIYKIHGWKGFLRGLKPRVIAN 275

Query: 309 APGQAVTFTVYELIRKKL 326
            P  A+++T YE  +  L
Sbjct: 276 MPATAISWTSYECAKHFL 293

 Score = 48.1 bits (113), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 49/102 (48%), Gaps = 3/102 (2%)

Query: 3   NRKNSSHPAINLVAGGTAGLFEALCCHPLDTIKVRMQI---YSRAREQGQRARGFIGTAR 59
           N  N  +P I+ ++GG +G   A    PLD IK  +Q+    + + E  ++A  F   A 
Sbjct: 194 NPSNEYNPFIHCISGGLSGATCAAITTPLDCIKTVLQVRGSETVSNEIMKQANTFQRAAS 253

Query: 60  DISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLAD 101
            I    G+    +GL   VI  +P  AI +TSYE  +  L +
Sbjct: 254 AIYKIHGWKGFLRGLKPRVIANMPATAISWTSYECAKHFLVN 295

>CAGL0C02013g complement(209930..210919) weakly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1, hypothetical
           start
          Length = 329

 Score = 89.0 bits (219), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 84/330 (25%), Positives = 146/330 (44%), Gaps = 33/330 (10%)

Query: 5   KNSSHPAINLV-AGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDIST 63
           +N  +  + L+ AG  +GLF A   +P + +K  +Q++         A+ F      + T
Sbjct: 3   QNKVNDNVTLITAGSVSGLFSATITYPFEFLKTGLQLHRNVVA----AKPFEVLGYQVRT 58

Query: 64  QEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLL---ADRQTGVVSTGNTFVAGVGAG 120
                  + G  AV IG++ K ++RF +++     L   A  +   +S     +AG   G
Sbjct: 59  ------YFAGCSAVNIGVVMKTSLRFLAFDKASEWLRPPALAKDAPLSGVQLLMAGALTG 112

Query: 121 ITEAVMVVNPMEVVKIRL----QAQHVRY----VPLKAQLAGSVXXXXXXXXXXXXXXEN 172
             E++ ++ P E VK+ +       H R       ++ Q+A  V              E 
Sbjct: 113 TMESLCII-PFENVKVAMIQNSLLSHERLNTTTSNVQGQVANEVKKTFHKKPTLRSSYEA 171

Query: 173 VAATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQ 232
           +       N +  A  + ++ G RA ++G   T  RQ  N    FT ++ LK    + +Q
Sbjct: 172 LFPEKLPTNVLTTAAELYRQHGLRAYFKGTMPTLMRQVGNSVVRFTTFTMLKQFAPKEYQ 231

Query: 233 TDMLPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSG--WSRILAIGRQLIR 290
            +    +  +L+GLIS      +  PLD IKTR+Q     +KDS   +   +    ++  
Sbjct: 232 NN---EYFATLLGLISSCAVVGATQPLDVIKTRMQ-----AKDSVLLYRNSINCAYRIFV 283

Query: 291 EEGFRALYKGITPRVMRVAPGQAVTFTVYE 320
           EEGF  L+KG  PR+M+V    +V+F +Y+
Sbjct: 284 EEGFAMLWKGWLPRLMKVGLSGSVSFGIYQ 313

 Score = 35.8 bits (81), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 25/46 (54%)

Query: 279 SRILAIGRQLIREEGFRALYKGITPRVMRVAPGQAVTFTVYELIRK 324
           + +L    +L R+ G RA +KG  P +MR      V FT + ++++
Sbjct: 179 TNVLTTAAELYRQHGLRAYFKGTMPTLMRQVGNSVVRFTTFTMLKQ 224

>YKR052C (MRS4) [3303] chr11 complement(532192..533106) Member of
           the mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses defects in
           splicing of mitochondrial introns [915 bp, 304 aa]
          Length = 304

 Score = 88.2 bits (217), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 86/321 (26%), Positives = 133/321 (41%), Gaps = 54/321 (16%)

Query: 14  LVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYKG 73
           L+AG  AG+ E     P+D +K R+Q    A      + G I     IST EG +AL+KG
Sbjct: 27  LLAGAFAGIMEHSLMFPIDALKTRVQ---AAGLNKAASTGMISQISKISTMEGSMALWKG 83

Query: 74  LGAVVIGIIPKMAIRFTSYEFFRT-LLADRQTGVVSTGNTFVAGVGAGITEAVMVVNPME 132
           + +V++G  P  A+ F +YEF +  L++           T ++G  A I  A  ++NP +
Sbjct: 84  VQSVILGAGPAHAVYFGTYEFCKARLISPEDMQTHQPMKTALSGTIATIA-ADALMNPFD 142

Query: 133 VVKIRLQAQ-HVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAAYVIVK 191
            VK RLQ   ++R   +  Q+                          Y+N          
Sbjct: 143 TVKQRLQLDTNLRVWNVTKQI--------------------------YQN---------- 166

Query: 192 EEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPSWETSLIGLISGAL 251
            EG  A Y     T A        NF +Y +        +  + L      L G ISGA 
Sbjct: 167 -EGFAAFYYSYPTTLAMNIPFAAFNFMIYESASKFFNPQNSYNPLIH---CLCGGISGAT 222

Query: 252 GPFSNAPLDTIKTRLQKDKSTS------KDSGWSRILAIGRQLIREEGFRALYKGITPRV 305
                 PLD IKT LQ   S +      KD+  +      R ++   G++  ++G+ PR+
Sbjct: 223 CAALTTPLDCIKTVLQVRGSETVSIEIMKDA--NTFGRASRAILEVHGWKGFWRGLKPRI 280

Query: 306 MRVAPGQAVTFTVYELIRKKL 326
           +   P  A+++T YE  +  L
Sbjct: 281 VANIPATAISWTAYECAKHFL 301

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 50/100 (50%), Gaps = 3/100 (3%)

Query: 3   NRKNSSHPAINLVAGGTAGLFEALCCHPLDTIKVRMQI---YSRAREQGQRARGFIGTAR 59
           N +NS +P I+ + GG +G   A    PLD IK  +Q+    + + E  + A  F   +R
Sbjct: 202 NPQNSYNPLIHCLCGGISGATCAALTTPLDCIKTVLQVRGSETVSIEIMKDANTFGRASR 261

Query: 60  DISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLL 99
            I    G+   ++GL   ++  IP  AI +T+YE  +  L
Sbjct: 262 AILEVHGWKGFWRGLKPRIVANIPATAISWTAYECAKHFL 301

>YNL003C (PET8) [4582] chr14 complement(624974..625828) Protein of
           the mitochondrial carrier (MCF) family of membrane
           transporters, has similarity to Mrs4p and Mrs3p [855 bp,
           284 aa]
          Length = 284

 Score = 87.4 bits (215), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 81/324 (25%), Positives = 134/324 (41%), Gaps = 64/324 (19%)

Query: 12  INLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALY 71
           ++L++G  AG    L   P+DTIK R+Q      + G  A G            G+  +Y
Sbjct: 6   LSLLSGAAAGTSTDLVFFPIDTIKTRLQ-----AKGGFFANG------------GYKGIY 48

Query: 72  KGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGN-------TFVAGVGAGITEA 124
           +GLG+ V+   P  ++ F SY++ +       + + S G+       T +     G   A
Sbjct: 49  RGLGSAVVASAPGASLFFISYDYMKVKSRPYISKLYSQGSEQLIDTTTHMLSSSIGEICA 108

Query: 125 VMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQ 184
            +V  P EVVK R Q                                 V +T      +Q
Sbjct: 109 CLVRVPAEVVKQRTQ---------------------------------VHSTNSSWQTLQ 135

Query: 185 AAYVIVKEEGPRA-LYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPSWETSL 243
           +      +EG R  LYRG S T  R+       F +Y  LK    + +    +  W+ ++
Sbjct: 136 SILRNDNKEGLRKNLYRGWSTTIMREIPFTCIQFPLYEYLKKTWAKANGQSQVEPWKGAI 195

Query: 244 IGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITP 303
            G I+G +   +  PLD +KTRL  +K+T+       + ++  ++ REEG    + G+ P
Sbjct: 196 CGSIAGGIAAATTTPLDFLKTRLMLNKTTAS------LGSVIIRIYREEGPAVFFSGVGP 249

Query: 304 RVMRVAPGQAVTFTVYELIRKKLE 327
           R M ++ G A+   +YE +   L 
Sbjct: 250 RTMWISAGGAIFLGMYETVHSLLS 273

 Score = 36.6 bits (83), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 39/90 (43%), Gaps = 20/90 (22%)

Query: 240 ETSLIGLISGALGPFSNA----PLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFR 295
            T  + L+SGA    S      P+DTIKTRLQ                         G++
Sbjct: 2   NTFFLSLLSGAAAGTSTDLVFFPIDTIKTRLQAKGG----------------FFANGGYK 45

Query: 296 ALYKGITPRVMRVAPGQAVTFTVYELIRKK 325
            +Y+G+   V+  APG ++ F  Y+ ++ K
Sbjct: 46  GIYRGLGSAVVASAPGASLFFISYDYMKVK 75

>Kwal_27.12599
          Length = 304

 Score = 87.4 bits (215), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 78/319 (24%), Positives = 135/319 (42%), Gaps = 47/319 (14%)

Query: 13  NLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYK 72
           +L+AG   G+ + L   P DT KVR+Q  +            +   + +   EG    YK
Sbjct: 27  DLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTTA-------VEVVKKLVKNEGLRGFYK 79

Query: 73  GLGAVVIGIIPKMAIRFTSYE----FFRTLLADRQTGVVSTGNTFVAGVGAGITEAVMVV 128
           G    ++G+   ++ +F   E    FFR   AD     ++    ++ G   G+  + +  
Sbjct: 80  GTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHK-TLTLPQYYICGFVGGVANSFLA- 137

Query: 129 NPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAAYV 188
           +P+E V+IRLQ Q           +G+V                     +++  +     
Sbjct: 138 SPIEHVRIRLQTQTA---------SGTVA--------------------EFKGPLDC--- 165

Query: 189 IVKEEGPRALYRGVSLTAARQATNQGANFTVYSTL-KSRLQEYHQTDMLPSWETSLIGLI 247
           I K     AL RG+S T  R+A      F  Y  L  +++ +      +P+W+  L G +
Sbjct: 166 INKLRANGALMRGLSPTILREAQGCATYFLTYEALVANQIGKGIARSDVPAWKLCLFGAV 225

Query: 248 SGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITPRVMR 307
           SG     +  PLD IK+ +Q D   +   G   I+ + R +  + G+++ +KG  P ++R
Sbjct: 226 SGVTLWLTVYPLDVIKSLMQTDNLKNPVRG-KNIIQVARLVNAKYGWKSFFKGFGPTMLR 284

Query: 308 VAPGQAVTFTVYELIRKKL 326
            AP    TF  +EL  + L
Sbjct: 285 AAPANGATFATFELAMRFL 303

 Score = 34.3 bits (77), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 33/71 (46%), Gaps = 6/71 (8%)

Query: 258 PLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITPRVMRVAPGQAVTFT 317
           P DT K RLQ   + +        + + ++L++ EG R  YKG    ++ V    +  F 
Sbjct: 44  PFDTTKVRLQTSTTPTT------AVEVVKKLVKNEGLRGFYKGTLTPLVGVGACVSCQFG 97

Query: 318 VYELIRKKLEG 328
           V E +++   G
Sbjct: 98  VNEAMKRFFRG 108

>Scas_662.12
          Length = 308

 Score = 87.0 bits (214), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 77/334 (23%), Positives = 144/334 (43%), Gaps = 57/334 (17%)

Query: 14  LVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGF-------IGTARDISTQEG 66
           +++G +AG    L  HPLD IKVR+Q+ +    Q Q  +G+       I  ++ + +Q  
Sbjct: 11  IISGLSAGSLTTLIVHPLDLIKVRLQLLATTTTQ-QHQKGYTYLINELINNSKKMGSQGP 69

Query: 67  FLAL----YKGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNT---FVAGVGA 119
              L    Y+GL   ++G     ++ FT Y   +  +   Q   +   NT     +G+ +
Sbjct: 70  IYNLIKESYRGLPINLLGNAVAWSLYFTIYNSTKDYMF--QNNYLHNNNTTIFLTSGLIS 127

Query: 120 GITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKY 179
           GI+   ++ NP+ V+K R+ +    +                                 Y
Sbjct: 128 GIS-TTLLTNPLWVIKTRIMSTSRHH------------------------------KDSY 156

Query: 180 RNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGA-NFTVYSTLK----SRLQEYHQTD 234
           ++       ++ +EGP+A++ G  L  +    +QGA  F +Y  LK      L +  + +
Sbjct: 157 KSIRHGFKSLLTKEGPKAIWMG--LLPSLLGVSQGAIYFMIYDNLKLHFNVNLNKSKKDN 214

Query: 235 MLPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKD--SGWSRILAIGRQLIREE 292
              + +  LI  +S  L   S  P   +K+ LQ  +S + +        + + R++ R+ 
Sbjct: 215 ANANLKIVLISSLSKMLSVMSVYPFQLLKSNLQTFRSVTNNIPQNDYHFITLIRKIYRDN 274

Query: 293 GFRALYKGITPRVMRVAPGQAVTFTVYELIRKKL 326
           G + LYKG++  ++R  P   +TF +YE  + KL
Sbjct: 275 GIKGLYKGLSANLLRAIPSTCITFCIYENFKSKL 308

>CAGL0K12210g 1193771..1194706 similar to sp|P38087 Saccharomyces
           cerevisiae YBR104w YMC2 or sp|P32331 Saccharomyces
           cerevisiae YPR058w YMC1, start by similarity
          Length = 311

 Score = 87.0 bits (214), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 82/323 (25%), Positives = 135/323 (41%), Gaps = 50/323 (15%)

Query: 13  NLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYK 72
           ++ AG   G+ + L   P DT KVR+Q         +   G I   +++   EG LA YK
Sbjct: 29  DIFAGTMGGVAQVLVGQPFDTTKVRLQT-------SKTKIGVIEVVQNLLRNEGALAFYK 81

Query: 73  GLGAVVIGIIPKMAIRFTSYE----FFRTLLADR---QTGV-VSTGNTFVAGVGAGITEA 124
           G+   ++G+   ++++F   E    FF    ADR   Q  V +     ++ G+  G+  +
Sbjct: 82  GMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNS 141

Query: 125 VMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQ 184
            +   P+E V+IRLQ Q  +    + Q  G                              
Sbjct: 142 FLAA-PIEHVRIRLQTQTSQGN--ERQFKGPFD--------------------------- 171

Query: 185 AAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSR-LQEYHQTDMLPSWETSL 243
               I K    +AL RG+  T  R     G  F  Y  L  +  ++    + +P+W+   
Sbjct: 172 ---CIKKLAKAKALMRGLLPTMIRAGHGLGTYFAAYEALVVKEFEKGTPRNQIPAWKLCS 228

Query: 244 IGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITP 303
            G +SG +   +  P+D +K+ LQ D S       + I+   R L ++ G  A +KG  P
Sbjct: 229 FGALSGTILWLTVYPVDVVKSVLQTD-SIENPKYKNSIIKATRALYKQHGIPAFFKGFVP 287

Query: 304 RVMRVAPGQAVTFTVYELIRKKL 326
            ++R AP  A TF  +E+  + L
Sbjct: 288 TMIRAAPANAATFVSFEMTMRVL 310

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 36/153 (23%), Positives = 64/153 (41%), Gaps = 11/153 (7%)

Query: 183 IQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDM------- 235
           I+    +++ EG  A Y+G+              F V  ++K     Y+   +       
Sbjct: 64  IEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVP 123

Query: 236 LPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFR 295
           LP  +  L GL  G +  F  AP++ ++ RLQ   S   +  +       ++L +    +
Sbjct: 124 LPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKA---K 180

Query: 296 ALYKGITPRVMRVAPGQAVTFTVYE-LIRKKLE 327
           AL +G+ P ++R   G    F  YE L+ K+ E
Sbjct: 181 ALMRGLLPTMIRAGHGLGTYFAAYEALVVKEFE 213

>Kwal_56.23011
          Length = 303

 Score = 87.0 bits (214), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 77/314 (24%), Positives = 126/314 (40%), Gaps = 47/314 (14%)

Query: 13  NLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYK 72
           ++  G   G+ + L   P D  KVR+Q         Q  +  +         EG LA YK
Sbjct: 26  DVFCGTVGGVAQVLVGQPFDITKVRLQTSPVPTTAAQVIKSLV-------KNEGLLAFYK 78

Query: 73  GLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGV---VSTGNTFVAGVGAGITEAVMVVN 129
           G  A + G+   ++ +F   E  +     +       ++    +  G  +G   A +   
Sbjct: 79  GTLAPLAGVGACVSCQFGVNEALKKWFRKKDGNFDQPLALRQYYACGFVSGTANAFLA-T 137

Query: 130 PMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAAYVI 189
           P+E V+IRLQ Q                                ++  +Y  ++  A  +
Sbjct: 138 PIEHVRIRLQLQTAS-----------------------------SSAAEYHGSLDCARKL 168

Query: 190 VKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQT--DMLPSWETSLIGLI 247
           +K+    AL RG + T  R +   G  F  Y TL +  Q +H    + +P+W+  + G  
Sbjct: 169 LKQG---ALMRGFTATTLRTSHGFGIYFLTYETLIAN-QAHHGVLRENIPAWKVCVYGAF 224

Query: 248 SGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITPRVMR 307
           SGA       P D +K+ +Q DK  +   G    LA+ + + RE G RA  KG TP ++R
Sbjct: 225 SGAFFWAMTYPFDVVKSVMQADKLKNPVYG-RNPLAVAKAIYRERGPRAFTKGFTPTMLR 283

Query: 308 VAPGQAVTFTVYEL 321
             P    TF  +E+
Sbjct: 284 SLPVNGATFAAFEI 297

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 38/149 (25%), Positives = 63/149 (42%), Gaps = 5/149 (3%)

Query: 176 TPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKS--RLQEYHQT 233
           +P    A Q    +VK EG  A Y+G     A         F V   LK   R ++ +  
Sbjct: 54  SPVPTTAAQVIKSLVKNEGLLAFYKGTLAPLAGVGACVSCQFGVNEALKKWFRKKDGNFD 113

Query: 234 DMLPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEG 293
             L   +    G +SG    F   P++ ++ RLQ   ++S  + +   L   R+L+++  
Sbjct: 114 QPLALRQYYACGFVSGTANAFLATPIEHVRIRLQLQTASSSAAEYHGSLDCARKLLKQG- 172

Query: 294 FRALYKGITPRVMRVAPGQAVTFTVYELI 322
             AL +G T   +R + G  + F  YE +
Sbjct: 173 --ALMRGFTATTLRTSHGFGIYFLTYETL 199

 Score = 29.3 bits (64), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 21/91 (23%), Positives = 34/91 (37%), Gaps = 6/91 (6%)

Query: 234 DMLPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEG 293
           D   + +    G + G        P D  K RLQ     +  +       + + L++ EG
Sbjct: 19  DFKQALKDVFCGTVGGVAQVLVGQPFDITKVRLQTSPVPTTAA------QVIKSLVKNEG 72

Query: 294 FRALYKGITPRVMRVAPGQAVTFTVYELIRK 324
             A YKG    +  V    +  F V E ++K
Sbjct: 73  LLAFYKGTLAPLAGVGACVSCQFGVNEALKK 103

>Kwal_33.14050
          Length = 314

 Score = 87.0 bits (214), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 86/322 (26%), Positives = 132/322 (40%), Gaps = 47/322 (14%)

Query: 14  LVAGGTAGLFEALCCHPLDTIKVRMQIYS----RAREQGQRARGFIGTARDISTQEGFLA 69
           L AG  AG+ E     P+D IK RMQ  S     A    +     +     IST EG +A
Sbjct: 20  LAAGAFAGIMEHSIMFPIDAIKTRMQALSATIGSANAAAKLPSNIVQQIARISTTEGSMA 79

Query: 70  LYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTG-NTFVAGVGAGITEAVMVV 128
           L+KG+ +V++G  P  A+ F +YE  ++ L D Q         T  +G+ A +  A +++
Sbjct: 80  LWKGVQSVILGAGPAHAVYFATYEMCKSYLIDPQDFQTHQPLKTAASGIAATVA-ADLLM 138

Query: 129 NPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAAYV 188
           NP + +K R+Q +             SV                  A+  YRN       
Sbjct: 139 NPFDTIKQRMQLRT-----FSKDRMWSV------------------ASRIYRN------- 168

Query: 189 IVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPSWETSLIGLIS 248
               EG  A +     T A        NF +Y   +S  + ++  +        L G IS
Sbjct: 169 ----EGLAAFFYSYPTTIAMNIPFAAFNFAIY---ESATKFFNPENTYNPLIHCLCGGIS 221

Query: 249 GALGPFSNAPLDTIKTRLQKDKSTS-KDSGWSRILAIGR---QLIREEGFRALYKGITPR 304
           GA       PLD IKT LQ   S S  D  + +     R    + +  G+   ++G+ PR
Sbjct: 222 GATCAAITTPLDCIKTVLQVRGSESVVDPLFRQADTFSRAASAISKVYGWSGFWRGLKPR 281

Query: 305 VMRVAPGQAVTFTVYELIRKKL 326
           ++   P  A+++T YE  +  L
Sbjct: 282 IISNMPATAISWTAYECAKHTL 303

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 48/96 (50%), Gaps = 7/96 (7%)

Query: 3   NRKNSSHPAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQ-----GQRARGFIGT 57
           N +N+ +P I+ + GG +G   A    PLD IK  +Q+  R  E       ++A  F   
Sbjct: 204 NPENTYNPLIHCLCGGISGATCAAITTPLDCIKTVLQV--RGSESVVDPLFRQADTFSRA 261

Query: 58  ARDISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYE 93
           A  IS   G+   ++GL   +I  +P  AI +T+YE
Sbjct: 262 ASAISKVYGWSGFWRGLKPRIISNMPATAISWTAYE 297

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 35/135 (25%), Positives = 55/135 (40%), Gaps = 14/135 (10%)

Query: 8   SHPAINLVAGGTAGLFEA-LCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEG 66
           +H  +   A G A    A L  +P DTIK RMQ+ + ++++          A  I   EG
Sbjct: 117 THQPLKTAASGIAATVAADLLMNPFDTIKQRMQLRTFSKDR------MWSVASRIYRNEG 170

Query: 67  FLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNTFVAGVGAGITEAVM 126
             A +      +   IP  A  F  YE      A +     +T N  +  +  GI+ A  
Sbjct: 171 LAAFFYSYPTTIAMNIPFAAFNFAIYE-----SATKFFNPENTYNPLIHCLCGGISGATC 225

Query: 127 --VVNPMEVVKIRLQ 139
             +  P++ +K  LQ
Sbjct: 226 AAITTPLDCIKTVLQ 240

>CAGL0L05742g complement(630844..631761) similar to sp|P10566
           Saccharomyces cerevisiae YJL133w MRS3 or sp|P23500
           Saccharomyces cerevisiae YKR052c MRS4, start by
           similarity
          Length = 305

 Score = 86.7 bits (213), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 86/331 (25%), Positives = 133/331 (40%), Gaps = 62/331 (18%)

Query: 11  AINLVAGGTAGLFEALCCHPLDTIKVRMQ-IYSRAREQGQR-ARGFIGTARDISTQEGFL 68
           A  L+AG  AG+ E     PLD +K R+Q +++ +   GQ      +     IS QEG +
Sbjct: 19  AHQLMAGAFAGIAEHSVIFPLDALKTRLQAMHAISTTGGQPIPSTMLRQLSSISAQEGSM 78

Query: 69  ALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNTFVAGVGAGITEAV-MV 127
            L+KG+ +V++G  P  A+ F +YE  ++ L D  T          A  GA  T A   +
Sbjct: 79  VLWKGVQSVLLGAGPAHAVYFATYEMVKSFLIDEATSTSKYHFFKTAFSGATATIAADAL 138

Query: 128 VNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAAY 187
           +NP +V+K R+Q                                N+       +    A 
Sbjct: 139 MNPFDVIKQRIQLN-----------------------------TNI-------SVWDTAK 162

Query: 188 VIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPSWETSLIGLI 247
            I  +EG +A Y     T A        NF +Y T     + ++ + +   +   L G I
Sbjct: 163 RIYSKEGFQAFYSSYPTTLAINIPFAAFNFGIYDTAT---RYFNPSGVYNPFIHCLCGGI 219

Query: 248 SGALGPFSNAPLDTIKTRLQ------------KDKSTSKDSGWSRILAIGRQLIREEGFR 295
           SGA       PLD IKT LQ            K   T K +         R + +  G+R
Sbjct: 220 SGAACAGLTTPLDCIKTALQVRGSEKVSMEVFKQADTFKKA--------TRAIYQVYGWR 271

Query: 296 ALYKGITPRVMRVAPGQAVTFTVYELIRKKL 326
             + G+ PR++   P  A+++T YE  +  L
Sbjct: 272 GFWSGVKPRILANMPATAISWTAYEFAKHFL 302

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 46/100 (46%), Gaps = 3/100 (3%)

Query: 3   NRKNSSHPAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAR---EQGQRARGFIGTAR 59
           N     +P I+ + GG +G   A    PLD IK  +Q+    +   E  ++A  F    R
Sbjct: 203 NPSGVYNPFIHCLCGGISGAACAGLTTPLDCIKTALQVRGSEKVSMEVFKQADTFKKATR 262

Query: 60  DISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLL 99
            I    G+   + G+   ++  +P  AI +T+YEF +  L
Sbjct: 263 AIYQVYGWRGFWSGVKPRILANMPATAISWTAYEFAKHFL 302

>Kwal_14.2210
          Length = 315

 Score = 86.7 bits (213), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 89/333 (26%), Positives = 133/333 (39%), Gaps = 43/333 (12%)

Query: 8   SHPAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGF 67
           S   I   AGG AG        P + +K+ +Q+ S          G     + +  +EG 
Sbjct: 15  SDAGIAFCAGGIAGAVSRTVVSPFERVKILLQVQSSTHAYNH---GLFRAVKQVYLEEGV 71

Query: 68  LALYKGLGAVVIGIIPKMAIRFTSYEFFRT-LLADRQTGVVSTGNTFVAGVGAGITEAVM 126
             L +G G   I I P  A++F  YEF +          VV   +  V+G   G   +V+
Sbjct: 72  PGLLRGNGLNCIRIFPYSAVQFLVYEFCKKQWFQQNPDTVVLNWHRLVSGALCGGC-SVL 130

Query: 127 VVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAA 186
              P+++V+ RL  Q        A LA                  + A  P     ++  
Sbjct: 131 ATYPLDLVRTRLSIQ-------TANLA----------RLHKAKAASAAKPPGVWELLRKT 173

Query: 187 YVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPSWETSL--- 243
           Y   +E G   LYRGV  T+         NF VY     +L+EY      P+   SL   
Sbjct: 174 YT--QEGGIFGLYRGVWPTSIGVVPYVALNFAVYE----QLREYIPASFDPA-SASLYKL 226

Query: 244 -IGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGW------SRILAIGRQLIREEGFRA 296
            IG ISG +      P D ++ R Q       + G+        ++ IGR     EGF+ 
Sbjct: 227 SIGAISGGVAQTITYPFDLLRRRFQVLAMGQSELGFHYKSVPDALITIGR----TEGFKG 282

Query: 297 LYKGITPRVMRVAPGQAVTFTVYELIRKKLEGL 329
            YKG+T  + +V P  AV++ VYE +R  ++ L
Sbjct: 283 YYKGLTANLFKVVPSTAVSWVVYETVRDYMQLL 315

>AFR131C [3323] [Homologous to ScYGR257C - SH] (672999..674033)
           [1035 bp, 344 aa]
          Length = 344

 Score = 86.7 bits (213), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 80/310 (25%), Positives = 126/310 (40%), Gaps = 71/310 (22%)

Query: 44  AREQGQRARGFIGTARDISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFR--TLLAD 101
            RE   R +G +   R I+  EG   L++GLG  ++  +P   + F+ YE  R  + LA 
Sbjct: 73  CREPAARLQGTLEGLRKIAQLEGLPTLWRGLGITLVMAVPANVVYFSGYEALRDNSPLAS 132

Query: 102 RQTGVVSTGNTFVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXX 161
           R    +   N  V G  A I  A  +  P+E+++ RLQ+                     
Sbjct: 133 R----LPVANPLVCGAFARILAATTIA-PLELLRTRLQS--------------------- 166

Query: 162 XXXXXXXXXENVAATPKYRNAIQAAYVI----------VKEEGPRALYRGVSLTAARQAT 211
                          P+ R+  +  Y+I          V   G RAL++G+ +T  R   
Sbjct: 167 --------------VPRARDTERTIYLIGDLLREMRHEVSVMGYRALFKGLEITLWRDVP 212

Query: 212 NQGANFTVYSTLKSRLQEYHQ-TDMLPSWETSL----IGLISGALGPFSNAPLDTIKTRL 266
                +  Y   K++    H  T    +W+  +     G + GA+      P D  KTR+
Sbjct: 213 FSAIYWGTYEFCKTQFWARHAATHNASNWDHFIGSFACGSMGGAVAALLTHPFDVGKTRM 272

Query: 267 Q-----------KDKSTSKDSGWSR-ILAIGRQLIREEGFRALYKGITPRVMRVAPGQAV 314
           Q             K+T  D   SR + +    + + EG RALY G+ PRVM++AP  A+
Sbjct: 273 QIAIASPQQLTVGGKATKTDD--SRGMFSFLNAIRKSEGIRALYTGLLPRVMKIAPSCAI 330

Query: 315 TFTVYELIRK 324
             + YEL +K
Sbjct: 331 MISTYELSKK 340

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 42/141 (29%), Positives = 64/141 (45%), Gaps = 13/141 (9%)

Query: 10  PAIN-LVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGT----ARDISTQ 64
           P  N LV G  A +  A    PL+ ++ R+Q   RAR+  +R    IG      R   + 
Sbjct: 135 PVANPLVCGAFARILAATTIAPLELLRTRLQSVPRARDT-ERTIYLIGDLLREMRHEVSV 193

Query: 65  EGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGN------TFVAGVG 118
            G+ AL+KGL   +   +P  AI + +YEF +T    R     +  N      +F  G  
Sbjct: 194 MGYRALFKGLEITLWRDVPFSAIYWGTYEFCKTQFWARHAATHNASNWDHFIGSFACGSM 253

Query: 119 AGITEAVMVVNPMEVVKIRLQ 139
            G   A ++ +P +V K R+Q
Sbjct: 254 GGAV-AALLTHPFDVGKTRMQ 273

 Score = 48.1 bits (113), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 35/101 (34%), Positives = 42/101 (41%), Gaps = 9/101 (8%)

Query: 3   NRKNSSHPAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQ---GQRA------RG 53
           N  N  H   +   G   G   AL  HP D  K RMQI   + +Q   G +A      RG
Sbjct: 237 NASNWDHFIGSFACGSMGGAVAALLTHPFDVGKTRMQIAIASPQQLTVGGKATKTDDSRG 296

Query: 54  FIGTARDISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYEF 94
                  I   EG  ALY GL   V+ I P  AI  ++YE 
Sbjct: 297 MFSFLNAIRKSEGIRALYTGLLPRVMKIAPSCAIMISTYEL 337

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 49/218 (22%), Positives = 86/218 (39%), Gaps = 19/218 (8%)

Query: 119 AGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAA--- 175
           AG     + + P++VV++RL  Q +  +P      G +               NV     
Sbjct: 20  AGSLVTSLFLTPLDVVRVRLHQQEM--LP-SCTCTGQLSKPAGKVFWQDECFANVGCREP 76

Query: 176 TPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDM 235
             + +  ++    I + EG   L+RG+ +T           F+ Y  L+           
Sbjct: 77  AARLQGTLEGLRKIAQLEGLPTLWRGLGITLVMAVPANVVYFSGYEALR---DNSPLASR 133

Query: 236 LPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIRE---- 291
           LP     + G  +  L   + APL+ ++TRLQ   S  +     R + +   L+RE    
Sbjct: 134 LPVANPLVCGAFARILAATTIAPLELLRTRLQ---SVPRARDTERTIYLIGDLLREMRHE 190

Query: 292 ---EGFRALYKGITPRVMRVAPGQAVTFTVYELIRKKL 326
               G+RAL+KG+   + R  P  A+ +  YE  + + 
Sbjct: 191 VSVMGYRALFKGLEITLWRDVPFSAIYWGTYEFCKTQF 228

>Sklu_2398.4 , Contig c2398 9476-10405
          Length = 309

 Score = 85.9 bits (211), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 81/325 (24%), Positives = 134/325 (41%), Gaps = 57/325 (17%)

Query: 13  NLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDIST----QEGFL 68
           ++++G   G+ + L   P D  KVRMQ  + +            TA D+ T     EG L
Sbjct: 26  DILSGTAGGIAQVLVGQPFDITKVRMQTSAGS-----------ATAVDVVTSLIKNEGIL 74

Query: 69  ALYKGLGAVVIGIIPKMAIRFTSYEF----FRTLLADRQTGVVSTGNTFVAGVGAGITEA 124
             YKG  A ++G+   ++ +F   E     FR +  D  +  +S    +V GV +G   A
Sbjct: 75  GFYKGTLAPLVGVGACVSCQFGVNEAMKRRFRRMNGD-PSKPLSLKQYYVCGVASGCANA 133

Query: 125 VMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQ 184
            +   P+E V+IRLQ Q                                 A  +Y+ ++ 
Sbjct: 134 FLA-TPIEHVRIRLQLQ-----------------------------TKSLANAEYQGSLD 163

Query: 185 AAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQE--YHQTDMLPSWETS 242
               ++K+    AL RG + T  R     G  F+ Y  L +   +    + D+ P W+  
Sbjct: 164 CMRKLLKQG---ALMRGFTATLMRTCHGFGIYFSTYEALIANQHKKGIPRKDIAP-WKVC 219

Query: 243 LIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGIT 302
           + G  SGA       P+D +K+ +Q D+  S   G + +  + + +    G RA  KG  
Sbjct: 220 IFGAFSGACYWAMAYPIDVVKSIMQSDRLVSPVHG-TNVWQVAKSIYTTRGKRAFIKGFM 278

Query: 303 PRVMRVAPGQAVTFTVYELIRKKLE 327
           P ++R  P    TF  +E+  + LE
Sbjct: 279 PAMLRSLPVNGATFATFEMTMRLLE 303

>Sklu_1926.2 YPR058W, Contig c1926 347-1264 reverse complement
          Length = 305

 Score = 85.9 bits (211), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 77/326 (23%), Positives = 125/326 (38%), Gaps = 59/326 (18%)

Query: 13  NLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYK 72
           +L+AG   G+ + L   P DT KVR+Q  S            +   + +   EGF   YK
Sbjct: 26  DLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTA-------LDVVKKLVKNEGFRGFYK 78

Query: 73  GLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNT-----------FVAGVGAGI 121
           G    ++G+   ++++F   E  +     R       GN+           ++ G  AG 
Sbjct: 79  GTLTPLVGVGACVSVQFGVNEAMKRFFHSRN------GNSGPNETLGLLQYYLCGF-AGG 131

Query: 122 TEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRN 181
           T    + +P+E V+IRLQ Q                                 A  ++  
Sbjct: 132 TANSFLASPIEHVRIRLQTQ-----------------------------TGTGAAAQFHG 162

Query: 182 AIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTL-KSRLQEYHQTDMLPSWE 240
            +     I K     +L RG++ T  R++   G  F  Y  L  + L +      +P+W+
Sbjct: 163 PLDC---IKKLTANNSLMRGLTPTMLRESHGCGVYFLTYEALIANELHKGVSRSEIPTWK 219

Query: 241 TSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKG 300
             L G  SG        PLD IK+ +Q D       G   +L + + +    G  + +KG
Sbjct: 220 LCLFGATSGTTLWLMIYPLDVIKSVMQTDSLLQPKQG-KNMLQVAKTIYSTRGLSSFFKG 278

Query: 301 ITPRVMRVAPGQAVTFTVYELIRKKL 326
             P ++R AP    TF  +EL  + L
Sbjct: 279 FGPTMLRAAPANGATFATFELAMRVL 304

>CAGL0G08910g complement(853693..854562) similar to sp|P40464
           Saccharomyces cerevisiae YIL134w FLX1, hypothetical
           start
          Length = 289

 Score = 85.1 bits (209), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 76/316 (24%), Positives = 138/316 (43%), Gaps = 53/316 (16%)

Query: 14  LVAGGTAGLFEALCCHPLDTIKVRMQIY-SRAREQGQRARGFIGTARDIS-TQEGFLALY 71
           +++G TAG    L  HPLD  KVR+Q+  +   ++G R         D+S T+E    LY
Sbjct: 12  VISGLTAGSVTTLIVHPLDLFKVRLQLLITSTTKKGYRNLWSEIVGSDLSLTRE----LY 67

Query: 72  KGLGAVVIGIIPKMAIRFTSYEFFRTLLAD-----RQTGVVSTGNTFVAGVGAGITEAVM 126
           +GL   ++G      + F SY   +  L +     R    +S+     A   +G+   V+
Sbjct: 68  RGLTVNLVGNTIAWGLYFASYRVAKDYLINYNHRIRNDKDLSSWMYLSASASSGMLTTVL 127

Query: 127 VVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAA 186
             NP+ V+K R+ ++                              ++ +    R+     
Sbjct: 128 T-NPLWVIKTRMMSK---------------------------ANSDLTSMKVLRD----- 154

Query: 187 YVIVKEEGPRALYRGVSLTAARQATNQGA-NFTVYSTLKSRL-QEYHQTDMLPSWETSLI 244
             ++K +G + L++G  L  A    +QGA +FT Y TLK +L  +   +D + + ET  +
Sbjct: 155 --LIKNDGVQGLWKG--LVPALVGVSQGALHFTCYDTLKHKLVLKNRDSDEITNLETIAV 210

Query: 245 GLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITPR 304
             +S  L   +  P   +K+ LQ  +++  D    ++L + + +    G    YKG++  
Sbjct: 211 TSVSKMLSTSAVYPFQLLKSNLQSFQASENDF---KLLPLSKMIYSRSGLLGFYKGLSAN 267

Query: 305 VMRVAPGQAVTFTVYE 320
           ++R  P   +TF +YE
Sbjct: 268 LLRSVPSTCITFCIYE 283

 Score = 31.2 bits (69), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 38/86 (44%), Gaps = 9/86 (10%)

Query: 245 GLISGALGPFSNAPLDTIKTRLQKDKSTSKDSG----WSRILAIGRQLIREEGFRALYKG 300
           GL +G++      PLD  K RLQ   +++   G    WS I+     L RE     LY+G
Sbjct: 15  GLTAGSVTTLIVHPLDLFKVRLQLLITSTTKKGYRNLWSEIVGSDLSLTRE-----LYRG 69

Query: 301 ITPRVMRVAPGQAVTFTVYELIRKKL 326
           +T  ++       + F  Y + +  L
Sbjct: 70  LTVNLVGNTIAWGLYFASYRVAKDYL 95

>KLLA0C11363g complement(975442..976995) similar to sp|P48233
           Saccharomyces cerevisiae YNL083w singleton, start by
           similarity
          Length = 517

 Score = 86.3 bits (212), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 83/345 (24%), Positives = 145/345 (42%), Gaps = 61/345 (17%)

Query: 14  LVAGGTAGLFEALCCHPLDTIKV----RMQIYSR-------------AREQGQRARGFIG 56
            +AGG +G+    C  P D IKV    R  + S                +  +     I 
Sbjct: 203 FIAGGCSGVVSRTCTAPFDRIKVFLIARTDLSSTLLNSKDTLLAKNPNADLSKIKSPLIK 262

Query: 57  TARDISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLAD----RQTGVVSTGNT 112
            A  +  Q G  A Y G G  V+ + P+ AI+F S+E  + ++A     + T  +S  +T
Sbjct: 263 AATTLYRQGGLRAFYVGNGLNVVKVFPESAIKFGSFEMAKRIMARLENVKDTSELSRLST 322

Query: 113 FVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXEN 172
           ++AG G G   A   V P++ +K R+Q       PL   L  S                 
Sbjct: 323 YIAG-GLGGVAAQFSVYPIDTLKYRIQC-----APLNTNLKKSSIL-------------- 362

Query: 173 VAATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKS-RLQEYH 231
                     +Q A  + ++ G R  YRGV +           +   +S LK   +++  
Sbjct: 363 ----------LQTAKEMYQQGGIRLFYRGVHIGVMGIFPYAALDLGTFSALKKWYIKKEA 412

Query: 232 QTDMLPSWETSLIGLISGALGPFSNA-------PLDTIKTRLQKDKSTSKDSGWSRILAI 284
           +   LP  E  +  LI   +G FS         P++ ++TRLQ   + +    ++    +
Sbjct: 413 KKTGLPEDEVIISNLIVLPMGAFSGTVGATLVYPINLLRTRLQAQGTYAHPHTYNGFSDV 472

Query: 285 GRQLIREEGFRALYKGITPRVMRVAPGQAVTFTVYELIRK--KLE 327
            ++ I+ EG++ L+KG+ P + +V P  ++++  YE +++  KLE
Sbjct: 473 LKKTIQREGYQGLFKGLVPNLAKVCPAVSISYLCYENLKRLMKLE 517

>CAGL0J01661g 154646..155629 highly similar to tr|Q12251
           Saccharomyces cerevisiae YPR011c, start by similarity
          Length = 327

 Score = 84.7 bits (208), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 78/323 (24%), Positives = 126/323 (39%), Gaps = 41/323 (12%)

Query: 12  INLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALY 71
           +  +AGG AG        P + +K+ +Q+ S         +G       +  +E    L+
Sbjct: 25  VAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYN---KGLFDAIGQVYKEENIKGLF 81

Query: 72  KGLGAVVIGIIPKMAIRFTSYE-----FFRTLLADRQTGVVSTGNTFVAGVGAGITEAVM 126
           +G G   I + P  A++F  +E      F      +   + +    F   +  G +  V+
Sbjct: 82  RGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCS--VV 139

Query: 127 VVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAA 186
              P+++V+ RL  Q      L    A                  ++A  P     +  A
Sbjct: 140 ATYPLDLVRTRLSVQTANLSKLSKSRA-----------------SDIAKPPGVWKLLSKA 182

Query: 187 YVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRL--QEYHQTDMLPSWETSLI 244
           Y   +E G   LYRGV  T+         NF VY  LK  +   E   + M  S     +
Sbjct: 183 YA--EEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSM 240

Query: 245 GLISGALGPFSNAPLDTIKTRLQ------KDKSTSKDSGWSRILAIGRQLIREEGFRALY 298
           G ISG +      P D ++ R Q       +     +S W  ++ IG+     EGF+  Y
Sbjct: 241 GAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKT----EGFKGYY 296

Query: 299 KGITPRVMRVAPGQAVTFTVYEL 321
           KG+T  + +V P  AV++ VYEL
Sbjct: 297 KGLTANLFKVVPSTAVSWLVYEL 319

 Score = 57.4 bits (137), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 55/233 (23%), Positives = 89/233 (38%), Gaps = 54/233 (23%)

Query: 111 NTFVAGVGAGITEAV--MVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXX 168
           +T VA +  GI  A+   VV+P E VKI LQ Q                           
Sbjct: 22  DTNVAFLAGGIAGAISRTVVSPFERVKILLQVQS-------------------------- 55

Query: 169 XXENVAATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQ 228
                + T   +    A   + KEE  + L+RG  L   R        F V+   K  + 
Sbjct: 56  -----STTAYNKGLFDAIGQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHI- 109

Query: 229 EYH-----QTDMLPSWETSLIGLISGALGPFSNAPLDTIKTRLQ------------KDKS 271
            +H     + + L +W+    G + G     +  PLD ++TRL             +   
Sbjct: 110 -FHVDTKGKGEQLNNWQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASD 168

Query: 272 TSKDSGWSRILAIGRQLIREEGFRALYKGITPRVMRVAPGQAVTFTVYELIRK 324
            +K  G  ++L+  +    E G   LY+G+ P  + + P  A+ F VYE +++
Sbjct: 169 IAKPPGVWKLLS--KAYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKE 219

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 44/84 (52%), Gaps = 2/84 (2%)

Query: 243 LIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGIT 302
           L G I+GA+     +P + +K  LQ   ST+  +      AIG Q+ +EE  + L++G  
Sbjct: 28  LAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNK-GLFDAIG-QVYKEENIKGLFRGNG 85

Query: 303 PRVMRVAPGQAVTFTVYELIRKKL 326
              +RV P  AV F V+E  +K +
Sbjct: 86  LNCIRVFPYSAVQFVVFEGCKKHI 109

>KLLA0D15015g 1267803..1268756 similar to sp|P53257 Saccharomyces
           cerevisiae YGR096w, start by similarity
          Length = 317

 Score = 84.3 bits (207), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 73/320 (22%), Positives = 136/320 (42%), Gaps = 51/320 (15%)

Query: 13  NLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYK 72
           +++AG  +G+F  +   P+DT+K+R Q+      Q  + +G   T R I  +EG  AL+K
Sbjct: 21  SVIAGSVSGVFARMATAPMDTVKIRYQLQP---VQEDKYKGIASTVRTIMKEEGLRALWK 77

Query: 73  GLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNTFVAGVGAGITEAVMVVNPME 132
           G        +   A++F SY +F  + + +       G T   G  AG+T +V V  P++
Sbjct: 78  GNIPATAMYVVYGAVQFGSYSWFNNVWSAKFPRFSQQGQTLTVGALAGMTSSV-VSYPLD 136

Query: 133 VVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAI-QAAYVIVK 191
           +++ RL                                  +A    +R ++ +    +  
Sbjct: 137 LLRTRL----------------------------------IANRTSHRTSVAEECRQMWL 162

Query: 192 EEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPSWETSLIGLISGAL 251
            EG R  + G+S        +    F  Y T+   + E H+ +      ++  G+I+G +
Sbjct: 163 NEGVRGFFTGISTAMTTVTLSTAIMFLTYETVNI-VCENHEKEFWSRPVSASSGIIAGFV 221

Query: 252 GPFSNAPLDTIKTRLQ-----------KDKSTSKDSGWSRILAIGRQLIREEGFRALYKG 300
                 P+DT++ R+Q           K  +   +  +    AI  +++R+EG  ALY+G
Sbjct: 222 SKTMVFPIDTLRRRMQVMNSKRTVHFTKFPAVYHEYRYKSSTAIIYKILRQEGVSALYRG 281

Query: 301 ITPRVMRVAPGQAVTFTVYE 320
           +T  + +  P  A++  VYE
Sbjct: 282 LTMGLCKSVPTTAISLFVYE 301

 Score = 59.3 bits (142), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 56/225 (24%), Positives = 89/225 (39%), Gaps = 45/225 (20%)

Query: 102 RQTGVVSTGNTFVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXX 161
           R+   VS  N+ +AG  +G+  A M   PM+ VKIR Q Q V+                 
Sbjct: 11  RKGETVSWYNSVIAGSVSGVF-ARMATAPMDTVKIRYQLQPVQ----------------- 52

Query: 162 XXXXXXXXXENVAATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYS 221
                           KY+        I+KEEG RAL++G     A         F  YS
Sbjct: 53  --------------EDKYKGIASTVRTIMKEEGLRALWKGNIPATAMYVVYGAVQFGSYS 98

Query: 222 TLK----SRLQEYHQTDMLPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSG 277
                  ++   + Q       +T  +G ++G      + PLD ++TRL  ++++ + S 
Sbjct: 99  WFNNVWSAKFPRFSQQG-----QTLTVGALAGMTSSVVSYPLDLLRTRLIANRTSHRTS- 152

Query: 278 WSRILAIGRQLIREEGFRALYKGITPRVMRVAPGQAVTFTVYELI 322
              +    RQ+   EG R  + GI+  +  V    A+ F  YE +
Sbjct: 153 ---VAEECRQMWLNEGVRGFFTGISTAMTTVTLSTAIMFLTYETV 194

>Sklu_1275.1 , Contig c1275 314-1249
          Length = 311

 Score = 84.0 bits (206), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 82/336 (24%), Positives = 132/336 (39%), Gaps = 75/336 (22%)

Query: 13  NLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYK 72
           ++++G + G+ + L   P D  KVRMQ  S +          I   +++   EG LA YK
Sbjct: 26  DIISGTSGGIAQVLVGQPFDITKVRMQTSSGSPTA-------IEVIKNLVKNEGLLAFYK 78

Query: 73  GLGAVVIGIIPKMAIRFTSYE-----FFR---------TLLADRQTGVVS-TGNTFVAGV 117
           G    +IG+   ++ +F   E     F R         +LL     G VS + N F+A  
Sbjct: 79  GTLVPLIGVGACVSCQFGVNEAMKRYFLRVNGYKDQHLSLLQYYTCGFVSGSANAFLA-- 136

Query: 118 GAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATP 177
                       P+E V+IRLQ Q                                 A  
Sbjct: 137 -----------TPIEHVRIRLQLQ-----------------------------TKALAKA 156

Query: 178 KYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDML- 236
           +YR ++     ++K+   +AL RG + T  R +   G  F  Y  L   +   ++  +L 
Sbjct: 157 EYRGSLDCMKKLLKQ---KALMRGFTATLMRTSHGFGVYFLTYEAL---IMNQNKNGVLR 210

Query: 237 ---PSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEG 293
              P W+  + G  SGA       P D +K+ +Q D+  S   G   +  + + +    G
Sbjct: 211 KDIPPWKVCVFGAFSGAFFWAMTYPFDVVKSIMQADRLVSPVHG-KNVFQVAKSIHATRG 269

Query: 294 FRALYKGITPRVMRVAPGQAVTFTVYELIRKKLEGL 329
           + A  KG  P ++R  P    TF  +E+  + LE L
Sbjct: 270 WGAFVKGFVPTMLRSLPVNGATFATFEVTMRLLESL 305

 Score = 33.1 bits (74), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 23/92 (25%), Positives = 40/92 (43%), Gaps = 10/92 (10%)

Query: 237 PSWETSLIGLISGALGPFSNA----PLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREE 292
           P +  ++  +ISG  G  +      P D  K R+Q        SG    + + + L++ E
Sbjct: 18  PEFRKAIKDIISGTSGGIAQVLVGQPFDITKVRMQTS------SGSPTAIEVIKNLVKNE 71

Query: 293 GFRALYKGITPRVMRVAPGQAVTFTVYELIRK 324
           G  A YKG    ++ V    +  F V E +++
Sbjct: 72  GLLAFYKGTLVPLIGVGACVSCQFGVNEAMKR 103

>KLLA0E23705g complement(2099965..2101071) highly similar to
           sp|P38127 Saccharomyces cerevisiae YBR192w RIM2
           mitochondrial carrier protein (MCF), start by similarity
          Length = 368

 Score = 84.3 bits (207), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 90/368 (24%), Positives = 159/368 (43%), Gaps = 87/368 (23%)

Query: 5   KNSSHPAI----NLVAGGTAGLFEALCCHPLDTIKVRMQ--------------------- 39
           K+ S PA+    + VAGG  G+  A+   P D +K R+Q                     
Sbjct: 41  KDDSQPAVKPWVHFVAGGIGGMAGAIVTCPFDVVKTRLQSDVFRTQYKSAAMQNNGSSTL 100

Query: 40  -IYSRAREQGQRARGFIGTARDISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYE----- 93
              SR+    +   G IG   ++  QEGF +L+KGLG  ++G+IP  +I F +Y      
Sbjct: 101 HFVSRSLLHFKETFGIIG---NVYRQEGFRSLFKGLGPNLVGVIPARSINFLTYGTTKDI 157

Query: 94  FFRTLLADRQTGVVSTGNTFVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLA 153
           + RTL   ++   +      +A   AG   +  V NP+ +VK RLQ              
Sbjct: 158 YSRTLNNGQEAPWIH----LLAAATAGWATST-VTNPIWLVKTRLQL------------- 199

Query: 154 GSVXXXXXXXXXXXXXXENVAATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQ 213
                             + A T  Y+N++     +VK EG   LY+G  L+A+   + +
Sbjct: 200 ------------------DKAGTKTYKNSLDCIKSVVKNEGVLGLYKG--LSASYLGSVE 239

Query: 214 GA-NFTVYSTLKSRLQE--------YHQ-----TDMLPSW-ETSLIGLISGALGPFSNAP 258
           G   + +Y  +K  ++E         H+     +D +  W + S    ++  +      P
Sbjct: 240 GILQWILYEQMKRIIKERSIEKFGHIHEDAKSTSDKVKEWCQRSGSAGLAKFVASIVTYP 299

Query: 259 LDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITPRVMRVAPGQAVTFTV 318
            + ++TRL++  + +    ++ ++   R +I+EEG  ++Y G+TP ++R  P   + F  
Sbjct: 300 HEVVRTRLRQAPTENGKLKYTGLVQSFRVIIKEEGLVSMYSGLTPHLLRTVPNSIIMFGT 359

Query: 319 YELIRKKL 326
           +EL+ K L
Sbjct: 360 WELVIKLL 367

 Score = 35.8 bits (81), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 20/86 (23%), Positives = 43/86 (50%), Gaps = 3/86 (3%)

Query: 16  AGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQ-RARGFIGTARDISTQEGFLALYKGL 74
           + G A    ++  +P + ++ R++      E G+ +  G + + R I  +EG +++Y GL
Sbjct: 285 SAGLAKFVASIVTYPHEVVRTRLR--QAPTENGKLKYTGLVQSFRVIIKEEGLVSMYSGL 342

Query: 75  GAVVIGIIPKMAIRFTSYEFFRTLLA 100
              ++  +P   I F ++E    LL+
Sbjct: 343 TPHLLRTVPNSIIMFGTWELVIKLLS 368

>Scas_697.47
          Length = 328

 Score = 84.0 bits (206), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 84/321 (26%), Positives = 131/321 (40%), Gaps = 53/321 (16%)

Query: 13  NLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFL---- 68
           +LVAGG  G+   L  HP D IKVR Q   +A       +  +  AR I T    +    
Sbjct: 39  SLVAGGVGGVCAVLTGHPFDLIKVRCQ-SGQASSTIHAIKIILKDARAIPTSNMLVNSVK 97

Query: 69  ALYKGLGAVVIGIIPKMAIRFTSYEFFRTLL--ADRQTGVVSTGNTFVAGVGAGITEAVM 126
             YKG+   ++G+ P  A+ F  Y+  + ++  +D  +  ++ G    AG  + I    +
Sbjct: 98  GFYKGVIPPLLGVTPIFAVSFWGYDVGKKIVTRSDSSSAQLTMGQMAAAGFISAI-PTTL 156

Query: 127 VVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAA 186
           V  P E +K+ LQ                                  A      + I AA
Sbjct: 157 VTAPTERIKVVLQ---------------------------------TAGANSKTSFIGAA 183

Query: 187 YVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPSWETS---- 242
             IVK+ G ++L++G   T AR        F  Y   K  L + + T    + E +    
Sbjct: 184 KNIVKDGGVKSLFKGSLATLARDGPGSALYFASYEISKKFLNDRNATAESKTGEVNIANV 243

Query: 243 -LIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQL-IREEGFRALYKG 300
            L G I+G        P+DTIKT+LQ        SG   ++A  R++ ++  G +  + G
Sbjct: 244 CLAGGIAGMSMWLVVFPIDTIKTKLQ------SSSGSQSMVAATREIYVKRGGIKGFFPG 297

Query: 301 ITPRVMRVAPGQAVTFTVYEL 321
           + P ++R  P  A TF   EL
Sbjct: 298 LGPALLRSFPANAATFLGVEL 318

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 46/149 (30%), Positives = 71/149 (47%), Gaps = 18/149 (12%)

Query: 4   RKNSSHPAINLVAGGTAGLFEA----LCCHPLDTIKVRMQIYSRAREQGQRAR-GFIGTA 58
           R +SS   + +     AG   A    L   P + IKV +Q        G  ++  FIG A
Sbjct: 130 RSDSSSAQLTMGQMAAAGFISAIPTTLVTAPTERIKVVLQ------TAGANSKTSFIGAA 183

Query: 59  RDISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADR------QTGVVSTGNT 112
           ++I    G  +L+KG  A +    P  A+ F SYE  +  L DR      +TG V+  N 
Sbjct: 184 KNIVKDGGVKSLFKGSLATLARDGPGSALYFASYEISKKFLNDRNATAESKTGEVNIANV 243

Query: 113 FVAGVGAGITEAVMVVNPMEVVKIRLQAQ 141
            +AG  AG++   +VV P++ +K +LQ+ 
Sbjct: 244 CLAGGIAGMS-MWLVVFPIDTIKTKLQSS 271

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 40/83 (48%), Gaps = 4/83 (4%)

Query: 245 GLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITPR 304
           G IS        AP + IK  LQ   + SK S     +   + ++++ G ++L+KG    
Sbjct: 147 GFISAIPTTLVTAPTERIKVVLQTAGANSKTS----FIGAAKNIVKDGGVKSLFKGSLAT 202

Query: 305 VMRVAPGQAVTFTVYELIRKKLE 327
           + R  PG A+ F  YE+ +K L 
Sbjct: 203 LARDGPGSALYFASYEISKKFLN 225

 Score = 35.8 bits (81), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 38/84 (45%), Gaps = 4/84 (4%)

Query: 245 GLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQL----IREEGFRALYKG 300
           G + G     +  P D IK R Q  +++S       IL   R +    +     +  YKG
Sbjct: 43  GGVGGVCAVLTGHPFDLIKVRCQSGQASSTIHAIKIILKDARAIPTSNMLVNSVKGFYKG 102

Query: 301 ITPRVMRVAPGQAVTFTVYELIRK 324
           + P ++ V P  AV+F  Y++ +K
Sbjct: 103 VIPPLLGVTPIFAVSFWGYDVGKK 126

>YBR104W (YMC2) [293] chr2 (449624..450613) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [990 bp, 329 aa]
          Length = 329

 Score = 83.6 bits (205), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 83/334 (24%), Positives = 135/334 (40%), Gaps = 64/334 (19%)

Query: 13  NLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYK 72
           ++ AG   G+ + L   P DT KVR+Q  +            +   R++   EG  A YK
Sbjct: 37  DIFAGTIGGIAQVLVGQPFDTTKVRLQTATTRTTT-------LEVLRNLVKNEGVFAFYK 89

Query: 73  GLGAVVIGIIPKMAIRFTSYE----FFRTLLADRQTGV------VSTGNT------FVAG 116
           G    ++G+   ++++F   E    FF+   A +   +      +S  NT      +V G
Sbjct: 90  GALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTLPLSQYYVCG 149

Query: 117 VGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAAT 176
           +  G+  + +  +P+E ++IRLQ Q                                 + 
Sbjct: 150 LTGGVVNSFLA-SPIEQIRIRLQTQ--------------------------------TSN 176

Query: 177 PKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQT-DM 235
              R        I K +    L RG+  T  R     G  F VY  L +R      T + 
Sbjct: 177 GGDREFKGPWDCIKKLKAQGGLMRGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNE 236

Query: 236 LPSWETSLIGLISGALGPFSNAPLDTIKTRLQKD---KSTSKDSGWSRILAIGRQLIREE 292
           +P W+  L G  SG +   +  PLD +K+ +Q D   K   K+S    I  + + +  +E
Sbjct: 237 IPPWKLCLFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNS----ISYVAKTIYAKE 292

Query: 293 GFRALYKGITPRVMRVAPGQAVTFTVYELIRKKL 326
           G RA +KG  P ++R AP    TF  +EL+ + L
Sbjct: 293 GIRAFFKGFGPTMVRSAPVNGATFLTFELVMRFL 326

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 57/235 (24%), Positives = 90/235 (38%), Gaps = 49/235 (20%)

Query: 3   NRKNSSHPAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRA-RGFIGTARDI 61
           +R N+   +   V G T G+  +    P++ I++R+Q  ++    G R  +G     + +
Sbjct: 135 SRSNTLPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQ--TQTSNGGDREFKGPWDCIKKL 192

Query: 62  STQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNTF------VA 115
             Q G   L +GL   +I     +   F  YE     L  R+ G   T N        + 
Sbjct: 193 KAQGG---LMRGLFPTMIRAGHGLGTYFLVYE----ALVAREIGTGLTRNEIPPWKLCLF 245

Query: 116 GVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAA 175
           G  +G T   + V P++VVK  +Q   +R                               
Sbjct: 246 GAFSG-TMLWLTVYPLDVVKSIIQNDDLR------------------------------- 273

Query: 176 TPKYRNAIQ-AAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQE 229
            PKY+N+I   A  I  +EG RA ++G   T  R A   GA F  +  +   L E
Sbjct: 274 KPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATFLTFELVMRFLGE 328

>YNL083W (YNL083W) [4507] chr14 (471377..473014) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1638 bp, 545 aa]
          Length = 545

 Score = 84.7 bits (208), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 78/340 (22%), Positives = 143/340 (42%), Gaps = 59/340 (17%)

Query: 14  LVAGGTAGLFEALCCHPLDTIKV---------RMQIYSRAREQGQRARGFIG-------- 56
            +AGG +G+    C  P D +KV          + + S+     +     I         
Sbjct: 231 FIAGGISGVISRTCTAPFDRLKVFLIARTDLSSILLNSKTDLLAKNPNADINKISSPLAK 290

Query: 57  TARDISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLAD----RQTGVVSTGNT 112
             + +  Q G  A Y G G  VI + P+ +I+F S+E  + ++      R T  +S  +T
Sbjct: 291 AVKSLYRQGGIKAFYVGNGLNVIKVFPESSIKFGSFEVTKKIMTKLEGCRDTKDLSKFST 350

Query: 113 FVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXEN 172
           ++AG  AG+  A   V P++ +K R+Q       PL  +L G+                 
Sbjct: 351 YIAGGLAGMA-AQFSVYPIDTLKFRVQC-----APLDTKLKGNNLL-------------- 390

Query: 173 VAATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKS-RLQEYH 231
                      Q A  + +E G R  YRGV++           +   +S LK   + +  
Sbjct: 391 ----------FQTAKDMFREGGLRLFYRGVTVGIVGIFPYAALDLGTFSALKKWYIAKQA 440

Query: 232 QTDMLPSWETSLIGLISGALGPFSNA-------PLDTIKTRLQKDKSTSKDSGWSRILAI 284
           +T  LP  + +L  L+   +G FS         P++ ++TRLQ   + +    ++    +
Sbjct: 441 KTLNLPQDQVTLSNLVVLPMGAFSGTVGASVVYPINLLRTRLQAQGTYAHPYVYNGFKDV 500

Query: 285 GRQLIREEGFRALYKGITPRVMRVAPGQAVTFTVYELIRK 324
             + +  EG++ L+KG+ P + +V P  ++++  YE ++K
Sbjct: 501 LLKTLEREGYQGLFKGLVPTLAKVCPAVSISYLCYENLKK 540

>AGL047C [4264] [Homologous to ScYPR011C - NSH] (616853..617803)
           [951 bp, 316 aa]
          Length = 316

 Score = 83.2 bits (204), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 84/331 (25%), Positives = 138/331 (41%), Gaps = 45/331 (13%)

Query: 12  INLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALY 71
           I  VAGG  G        P++ +K+ +Q+ S          G +   + +  +EG   L+
Sbjct: 18  IAFVAGGVGGAVSRTVVSPVERVKILLQVQSSTTAYNG---GLVHAVKQVYKEEGVKGLF 74

Query: 72  KGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNTFV------AGVGAGITEAV 125
           +G G   + I P  A+++  YEF +T    R   V  +G+  +       G   G   +V
Sbjct: 75  RGNGINCLRIFPYSAVQYAVYEFCKT----RVFHVGQSGHEQLRSWERLVGGALGGGASV 130

Query: 126 MVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQA 185
           +V  P+++V+ RL  Q      L    A                  ++   P     ++ 
Sbjct: 131 LVTYPLDLVRTRLSIQTANLAKLHRSKA-----------------HDIRRPP---GIVEL 170

Query: 186 AYVIVKEEGP-RALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPSWETSLI 244
              I +EEG  R  YRGV  T+         NF +Y  LK+ +   +    + + + + I
Sbjct: 171 LRRIFREEGGLRGWYRGVYPTSLGVVPFVALNFALYERLKALIPHDYDAGSVAAAKLA-I 229

Query: 245 GLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGW------SRILAIGRQLIREEGFRALY 298
           G +SG +      P D ++ R Q       + G+        +  IGRQ    EG R  Y
Sbjct: 230 GAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQ----EGLRGYY 285

Query: 299 KGITPRVMRVAPGQAVTFTVYELIRKKLEGL 329
           KG+T  +++V P  AV + VYELI + + GL
Sbjct: 286 KGLTANLVKVVPAMAVQWFVYELISENMHGL 316

>KLLA0D04950g 424550..425374 similar to sp|P38921 Saccharomyces
           cerevisiae YNL003c PET8 member of the mitochondrial
           carrier (MCF) family, start by similarity
          Length = 274

 Score = 82.4 bits (202), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 80/324 (24%), Positives = 129/324 (39%), Gaps = 74/324 (22%)

Query: 13  NLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYK 72
           +LV+G  AG    L   P+DT+K R+Q             GF           G+  +Y+
Sbjct: 9   SLVSGAAAGTSTDLAFFPIDTLKTRLQAKG----------GFFANG-------GYKGVYR 51

Query: 73  GLGAVVIGIIPKMAIRFTSYEFFRT--------LLADRQTGVVSTGNTFVAGVGAGITEA 124
           GLG+ V+   P  ++ F +Y+  +         LL   +     T +  V+    G   A
Sbjct: 52  GLGSAVVASAPSASLFFVAYDSMKCWSRPVIGQLLPKGEDQTADTLSHMVSS-SFGEISA 110

Query: 125 VMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQ 184
            MV  P EV+K R Q                                    T +  +++Q
Sbjct: 111 CMVRVPAEVIKQRTQ------------------------------------THRTNSSLQ 134

Query: 185 AAYVIVKEEGP----RALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPSWE 240
               +++ E      R LYRG S T  R+       F +Y  +K R  E    +    W+
Sbjct: 135 TLQALLRNENGEGLRRNLYRGWSTTIMREIPFTCIQFPLYEYMKKRWAEVQGKERAAPWQ 194

Query: 241 TSLIGLISGALGPFSNAPLDTIKTRLQ-KDKSTSKDSGWSRILAIGRQLIREEGFRALYK 299
            S+ G I+G +   +  PLD +KTR+    KS S        L + + +++EEG +  + 
Sbjct: 195 GSVCGCIAGGIAAAATTPLDVLKTRIMLHHKSVSA-------LHLAKTMLQEEGVKVFFS 247

Query: 300 GITPRVMRVAPGQAVTFTVYELIR 323
           G+ PR M ++ G A+   VYE + 
Sbjct: 248 GVGPRTMWISAGGAIFLGVYETVH 271

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/146 (24%), Positives = 58/146 (39%), Gaps = 24/146 (16%)

Query: 194 GPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQ----------EYHQTDMLPSWETSL 243
           G + +YRG+       A +    F  Y ++K   +          E    D L    +S 
Sbjct: 45  GYKGVYRGLGSAVVASAPSASLFFVAYDSMKCWSRPVIGQLLPKGEDQTADTLSHMVSSS 104

Query: 244 IGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEG----FRALYK 299
            G IS  +      P + IK R Q  ++ S        L   + L+R E      R LY+
Sbjct: 105 FGEISACM---VRVPAEVIKQRTQTHRTNSS-------LQTLQALLRNENGEGLRRNLYR 154

Query: 300 GITPRVMRVAPGQAVTFTVYELIRKK 325
           G +  +MR  P   + F +YE ++K+
Sbjct: 155 GWSTTIMREIPFTCIQFPLYEYMKKR 180

>AEL253W [2253] [Homologous to ScYBR192W (RIM2) - SH]
           complement(164665..165762) [1098 bp, 365 aa]
          Length = 365

 Score = 83.2 bits (204), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 87/360 (24%), Positives = 158/360 (43%), Gaps = 69/360 (19%)

Query: 2   SNRKNSSH--PAINLVAGGTAGLFEALCCHPLDTIKVRMQ--IYSRAREQGQRARG---- 53
           + ++N  H  P ++ VAGG  G+  A+   P D +K R+Q  ++  A +    AR     
Sbjct: 39  NKKENHPHVAPWVHFVAGGIGGMAGAIITCPFDVVKTRLQSDVFHGAYKTQATARTNVVY 98

Query: 54  --------FIGTARDISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTG 105
                    +G  +++ TQEGF +L+KGLG  ++G+IP  +I F +Y     +  D  + 
Sbjct: 99  QGLMHFRETVGIIQNVYTQEGFRSLFKGLGPNLVGVIPARSINFFTY----GVTKDTASR 154

Query: 106 VVSTGNT-----FVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXX 160
           +++ G       F+AG  AG   +    NP+ +VK RLQ        L     G      
Sbjct: 155 LLNDGQEAPWIHFLAGATAGWATST-ATNPIWLVKTRLQ--------LDKAADGR----- 200

Query: 161 XXXXXXXXXXENVAATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVY 220
                          + +Y+N+      +++ EG   LY+G+S  +   +      + +Y
Sbjct: 201 ---------------SRRYKNSWDCLKGVMRNEGILGLYKGLS-ASYLGSVESILQWVLY 244

Query: 221 STLKS-----------RLQEYHQTDMLPSWETSLIGLISGALGPFSNA---PLDTIKTRL 266
             +K             + E ++T  +   E       +GA   F++    P + ++TRL
Sbjct: 245 EQMKHIIRQRSIEEFGDISEENKTTYMKVKEWCQRSGSAGAAKLFASILTYPHEVVRTRL 304

Query: 267 QKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITPRVMRVAPGQAVTFTVYELIRKKL 326
           ++    +    ++ +      +I+EEGF ++Y G+TP +MR  P   + F  +EL+ K L
Sbjct: 305 RQAPKENGKLKYTGLFQSFSLIIKEEGFASMYSGLTPHLMRTVPNSIIMFGTWELVIKLL 364

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 44/86 (51%), Gaps = 3/86 (3%)

Query: 16  AGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQ-RARGFIGTARDISTQEGFLALYKGL 74
           + G A LF ++  +P + ++ R++     +E G+ +  G   +   I  +EGF ++Y GL
Sbjct: 282 SAGAAKLFASILTYPHEVVRTRLR--QAPKENGKLKYTGLFQSFSLIIKEEGFASMYSGL 339

Query: 75  GAVVIGIIPKMAIRFTSYEFFRTLLA 100
              ++  +P   I F ++E    LLA
Sbjct: 340 TPHLMRTVPNSIIMFGTWELVIKLLA 365

>Scas_379.2
          Length = 301

 Score = 82.4 bits (202), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 84/322 (26%), Positives = 128/322 (39%), Gaps = 54/322 (16%)

Query: 14  LVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYKG 73
           L+AG  AG+ E     P+D +K R+Q  S      +     +     IST EG LAL+KG
Sbjct: 27  LLAGAFAGIMEHSVMFPIDALKTRIQSTS-----AKSTSNMLSQMAKISTAEGSLALWKG 81

Query: 74  LGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTG-NTFVAGVGAGITEAVMVVNPME 132
           + +V++G  P  A+ F +YE+ +  L D +         T ++G  A I  A  ++NP +
Sbjct: 82  VQSVILGAGPAHAVYFATYEYTKKYLIDEKDMQTHQPLKTALSGTVATIA-ADALMNPFD 140

Query: 133 VVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAAYVIVKE 192
            +K R+Q                                NV               I K 
Sbjct: 141 TLKQRMQLN------------------------TNTTVWNVTKQ------------IYKN 164

Query: 193 EGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPSWETSLIGLISGALG 252
           EG  A Y     T A        NF +Y   +S  + ++ T+        L G +SGA  
Sbjct: 165 EGFSAFYYSYPTTLAMNIPFAAFNFMIY---ESATKFFNPTNDYNPLVHCLSGGLSGATC 221

Query: 253 PFSNAPLDTIKTRLQKDKSTS------KDSGWSRILAIGRQLIREEGFRALYKGITPRVM 306
                PLD IKT LQ   S S      K++  +      + + +  G +  ++G+ PRV 
Sbjct: 222 AAITTPLDCIKTVLQVRGSESVSLQVMKEA--NTFQKATKAIYQVHGAKGFWRGLQPRVF 279

Query: 307 RVAPGQAVTFTVYELIRKKLEG 328
              P  A+ +T YE  +  L G
Sbjct: 280 ANMPATAIAWTAYECAKHFLLG 301

 Score = 44.3 bits (103), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 45/93 (48%), Gaps = 4/93 (4%)

Query: 234 DMLPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEG 293
           D  P     L G  +G +      P+D +KTR+Q   STS  S  S +L+   ++   EG
Sbjct: 19  DSAPLSHQLLAGAFAGIMEHSVMFPIDALKTRIQ---STSAKST-SNMLSQMAKISTAEG 74

Query: 294 FRALYKGITPRVMRVAPGQAVTFTVYELIRKKL 326
             AL+KG+   ++   P  AV F  YE  +K L
Sbjct: 75  SLALWKGVQSVILGAGPAHAVYFATYEYTKKYL 107

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 46/100 (46%), Gaps = 3/100 (3%)

Query: 3   NRKNSSHPAINLVAGGTAGLFEALCCHPLDTIKVRMQI---YSRAREQGQRARGFIGTAR 59
           N  N  +P ++ ++GG +G   A    PLD IK  +Q+    S + +  + A  F    +
Sbjct: 200 NPTNDYNPLVHCLSGGLSGATCAAITTPLDCIKTVLQVRGSESVSLQVMKEANTFQKATK 259

Query: 60  DISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLL 99
            I    G    ++GL   V   +P  AI +T+YE  +  L
Sbjct: 260 AIYQVHGAKGFWRGLQPRVFANMPATAIAWTAYECAKHFL 299

 Score = 35.0 bits (79), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 33/145 (22%), Positives = 54/145 (37%), Gaps = 15/145 (10%)

Query: 7   SSHPAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEG 66
           +  P    ++G  A +      +P DT+K RMQ+ +                + I   EG
Sbjct: 115 THQPLKTALSGTVATIAADALMNPFDTLKQRMQLNTNTT--------VWNVTKQIYKNEG 166

Query: 67  FLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNTFVAGVGAGITEAVM 126
           F A Y      +   IP  A  F  YE      A +     +  N  V  +  G++ A  
Sbjct: 167 FSAFYYSYPTTLAMNIPFAAFNFMIYE-----SATKFFNPTNDYNPLVHCLSGGLSGATC 221

Query: 127 --VVNPMEVVKIRLQAQHVRYVPLK 149
             +  P++ +K  LQ +    V L+
Sbjct: 222 AAITTPLDCIKTVLQVRGSESVSLQ 246

>CAGL0K10362g complement(1009155..1010060) similar to sp|Q12375
           Saccharomyces cerevisiae YOR130c ARG11, start by
           similarity
          Length = 301

 Score = 82.0 bits (201), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 83/322 (25%), Positives = 138/322 (42%), Gaps = 47/322 (14%)

Query: 13  NLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDIS---TQEGFL- 68
           +++ G  AG    +  +P DT+KVR+Q       QG+    F  T   I+     EG + 
Sbjct: 16  DILYGSIAGALGKVIEYPFDTVKVRLQ------TQGRHV--FPDTWSCITYTYKNEGIIK 67

Query: 69  ALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNTFVAGVGAGITEAVMVV 128
             ++G+ + + G   + A  F SY      L    T V    N  ++G  AG + A  V+
Sbjct: 68  GFFQGIASPLAGAAIENAALFLSYNQCSKFL-QHYTNVSDLTNILISGAFAG-SCASFVL 125

Query: 129 NPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAAYV 188
            P+E++K +LQ  +++ +PL      +V                   T ++   I     
Sbjct: 126 TPVELIKCKLQVSNLQSLPLGVAGGNTV-------------------TERHTRIIPTIQA 166

Query: 189 IVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTD--MLP----SWETS 242
           ++K  G   L++G S T  R++    A F  Y  +K  L+  H  +   LP    +WE  
Sbjct: 167 VIKNRGFIGLWQGQSGTFIRESFGGVAWFATYELMKKYLKSRHNIEDPSLPNDNKTWELL 226

Query: 243 LIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGIT 302
             G  +G     S  P DT+K+ +Q +    K        AI +++  E+G R  Y+G+ 
Sbjct: 227 ASGASAGLAFNASIFPADTVKSMMQTEHLGLKT-------AI-KKIFVEKGLRGFYRGLG 278

Query: 303 PRVMRVAPGQAVTFTVYELIRK 324
             ++R  P  A  F VYE + K
Sbjct: 279 ITLIRAIPANATVFYVYETLSK 300

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 39/148 (26%), Positives = 64/148 (43%), Gaps = 13/148 (8%)

Query: 191 KEEGP-RALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPSWETSLIGLISG 249
           K EG  +  ++G++   A  A    A F  Y+     LQ Y     L +   S  G  +G
Sbjct: 61  KNEGIIKGFFQGIASPLAGAAIENAALFLSYNQCSKFLQHYTNVSDLTNILIS--GAFAG 118

Query: 250 ALGPFSNAPLDTIKTRLQKDKSTSKDSG----------WSRILAIGRQLIREEGFRALYK 299
           +   F   P++ IK +LQ     S   G           +RI+   + +I+  GF  L++
Sbjct: 119 SCASFVLTPVELIKCKLQVSNLQSLPLGVAGGNTVTERHTRIIPTIQAVIKNRGFIGLWQ 178

Query: 300 GITPRVMRVAPGQAVTFTVYELIRKKLE 327
           G +   +R + G    F  YEL++K L+
Sbjct: 179 GQSGTFIRESFGGVAWFATYELMKKYLK 206

>Scas_632.9
          Length = 292

 Score = 80.9 bits (198), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 79/326 (24%), Positives = 142/326 (43%), Gaps = 49/326 (15%)

Query: 4   RKNSSHPAI-NLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDIS 62
            K+S   A+ ++V G  AG F  +  +P DT+KVR+Q         Q +  F  T   I 
Sbjct: 10  EKSSVQNALSDIVNGSIAGAFGKIIEYPFDTVKVRLQT--------QGSHIFPTTWSCIK 61

Query: 63  ---TQEG-FLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNTFVAGVG 118
                EG +   ++G+G+ + G   + A  F SY     +L ++ T V    N  ++G  
Sbjct: 62  YTYHNEGVWRGFFQGIGSPLFGAALENATLFVSYNQCSNVL-EKFTNVSPLSNILLSGAF 120

Query: 119 AGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPK 178
           AG + A  V+ P+E++K +LQ  +     L+  + G +                     K
Sbjct: 121 AG-SCASFVLTPVELIKCKLQVSN-----LQTAVEGQI---------------------K 153

Query: 179 YRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPS 238
           +   I     +++E+G   L++G S T  R++    A F  Y  +K  L++  +     +
Sbjct: 154 HTKIIPTLMYVLREKGILGLWQGQSSTFIRESLGGVAWFATYEVMKQGLKDRRKDTENKT 213

Query: 239 WETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALY 298
           WE  + G  +G     S  P DT+K+ +Q +  T        ++   ++++   G    Y
Sbjct: 214 WELLVSGASAGLAFNASIFPADTVKSMMQTEHIT--------LINAVKKVLTTYGITGFY 265

Query: 299 KGITPRVMRVAPGQAVTFTVYELIRK 324
           +G+   ++R  P  A  F +YE + K
Sbjct: 266 RGLGITLIRAVPANATVFYMYETLSK 291

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 30/135 (22%), Positives = 62/135 (45%), Gaps = 5/135 (3%)

Query: 196 RALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPSWETSLIGLISGALGPFS 255
           R  ++G+       A      F  Y+   + L+++  T++ P     L G  +G+   F 
Sbjct: 71  RGFFQGIGSPLFGAALENATLFVSYNQCSNVLEKF--TNVSPLSNILLSGAFAGSCASFV 128

Query: 256 NAPLDTIKTRLQKDKSTSKDSG---WSRILAIGRQLIREEGFRALYKGITPRVMRVAPGQ 312
             P++ IK +LQ     +   G    ++I+     ++RE+G   L++G +   +R + G 
Sbjct: 129 LTPVELIKCKLQVSNLQTAVEGQIKHTKIIPTLMYVLREKGILGLWQGQSSTFIRESLGG 188

Query: 313 AVTFTVYELIRKKLE 327
              F  YE++++ L+
Sbjct: 189 VAWFATYEVMKQGLK 203

>Kwal_23.3529
          Length = 395

 Score = 81.6 bits (200), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 84/312 (26%), Positives = 124/312 (39%), Gaps = 45/312 (14%)

Query: 29  HPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGF-LALYKGLGAVVIGIIPKMAI 87
           H LDT+K R Q          + R  I   + I  +EG    LY G  A ++G  P  AI
Sbjct: 104 HSLDTVKTRQQ----GAPNAPKYRNMISAYQKIFMEEGIRRGLYGGYTAAMLGSFPSAAI 159

Query: 88  RFTSYEFFRTLLADRQTGVVSTGNTFVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVP 147
            F +YE  +  L D   GV  T +   AG+   +  +V+ V P EV+K RLQ Q     P
Sbjct: 160 FFGTYELTKRKLID-DWGVNETLSHLTAGLSGDLVSSVVYV-PSEVLKTRLQLQGCYNNP 217

Query: 148 LKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAA 207
                                   +  +   YRN   A   IV+ EG + L+ G   T  
Sbjct: 218 ------------------------HFHSGYNYRNLRDAITAIVRLEGWQTLFFGYKATLC 253

Query: 208 RQATNQGANFTVYSTLKSRLQEYHQTDMLPSWETSLIG-----LISGALGPFSNAPLDTI 262
           R        F  Y   K R   +      PS + SL+        +G L      P+D I
Sbjct: 254 RDLPFSAFQFAFYE--KFRQWAFTLEGKTPSQDLSLLNELLTGAAAGGLAGIITTPMDVI 311

Query: 263 KTRLQKDKSTSKDSGWSRILAIGRQLI-------REEGFRALYKGITPRVMRVAPGQAVT 315
           KTR+Q    ++  S  +R++ I   LI       R EG    + G+ PR +  +   ++ 
Sbjct: 312 KTRIQTQMPSTVASDSTRLVRIENSLIKGLTAVYRSEGTLGFFSGVGPRFIWTSIQSSIM 371

Query: 316 FTVYELIRKKLE 327
             +Y++  K L+
Sbjct: 372 LLLYQVTLKSLD 383

 Score = 37.4 bits (85), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 38/137 (27%), Positives = 60/137 (43%), Gaps = 9/137 (6%)

Query: 13  NLVAGGTAGLFEALCCHPLDTIKVRMQI---YSRAR-EQGQRARGFIGTARDISTQEGFL 68
           +L AG +  L  ++   P + +K R+Q+   Y+      G   R        I   EG+ 
Sbjct: 183 HLTAGLSGDLVSSVVYVPSEVLKTRLQLQGCYNNPHFHSGYNYRNLRDAITAIVRLEGWQ 242

Query: 69  ALYKGLGAVVIGIIPKMAIRFTSYEFFR----TLLADRQTGVVSTGNTFVAGVGAGITEA 124
            L+ G  A +   +P  A +F  YE FR    TL     +  +S  N  + G  AG    
Sbjct: 243 TLFFGYKATLCRDLPFSAFQFAFYEKFRQWAFTLEGKTPSQDLSLLNELLTGAAAGGLAG 302

Query: 125 VMVVNPMEVVKIRLQAQ 141
           + +  PM+V+K R+Q Q
Sbjct: 303 I-ITTPMDVIKTRIQTQ 318

>KLLA0E02772g complement(261895..262749) similar to sp|Q12375
           Saccharomyces cerevisiae YOR130c ARG11 ornithine
           transport protein of mitochondria involved in arginine
           metabolism, member of the mitochondrial carrier family
           (MCF), start by similarity
          Length = 284

 Score = 80.1 bits (196), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 74/317 (23%), Positives = 130/317 (41%), Gaps = 49/317 (15%)

Query: 13  NLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTA---RDISTQEGFL- 68
           ++  G  AG    +  +P DT+KVR+Q         Q A  +  T    R   T EG   
Sbjct: 10  DIAYGSVAGAIGKVIEYPFDTVKVRLQT--------QPAHLYPTTWSCIRSTYTDEGIWK 61

Query: 69  ALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNTFVAGVGAGITEAVMVV 128
             Y+G+ + + G   + A+ F S+      L D  T +     T  +G  AG   A  ++
Sbjct: 62  GFYQGIASPLFGAALENAVLFVSFNQCTNFL-DEFTQLKPLTKTIYSGAFAGAC-ASFIL 119

Query: 129 NPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAAYV 188
            P+E+VK +LQ  ++                            +++ T ++ +       
Sbjct: 120 TPVELVKCKLQVSNIS--------------------------NSLSQTTRHTSVWPTIKS 153

Query: 189 IVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDML-PSWETSLIGLI 247
           ++KE+G   L++G   T  R+       FT Y  +K +    H  +    +WE  + G  
Sbjct: 154 VIKEKGLLGLWQGQLSTFVRECLGGAVWFTTYEIMKMKFASLHPAEKENHTWELLVSGAS 213

Query: 248 SGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITPRVMR 307
           +G L   S  P DT+K+  Q +  +        I+   ++++R  G    Y+G+   ++R
Sbjct: 214 AGVLFNASVFPADTVKSVCQTEHVS--------IVNALKKVLRTHGITGFYRGLGITLIR 265

Query: 308 VAPGQAVTFTVYELIRK 324
            AP  A  F  YE ++K
Sbjct: 266 AAPANATVFYTYETLKK 282

 Score = 51.6 bits (122), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 41/161 (25%), Positives = 72/161 (44%), Gaps = 17/161 (10%)

Query: 177 PKYRNAIQAAYVIVKEEG-PRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDM 235
           P   + I++ Y    +EG  +  Y+G++      A      F  ++   + L E+  T +
Sbjct: 44  PTTWSCIRSTYT---DEGIWKGFYQGIASPLFGAALENAVLFVSFNQCTNFLDEF--TQL 98

Query: 236 LPSWETSLIGLISGALGPFSNAPLDTIKTRLQKD-------KSTSKDSGWSRILAIGRQL 288
            P  +T   G  +GA   F   P++ +K +LQ         ++T   S W  I    + +
Sbjct: 99  KPLTKTIYSGAFAGACASFILTPVELVKCKLQVSNISNSLSQTTRHTSVWPTI----KSV 154

Query: 289 IREEGFRALYKGITPRVMRVAPGQAVTFTVYELIRKKLEGL 329
           I+E+G   L++G     +R   G AV FT YE+++ K   L
Sbjct: 155 IKEKGLLGLWQGQLSTFVRECLGGAVWFTTYEIMKMKFASL 195

 Score = 32.0 bits (71), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 26/106 (24%), Positives = 39/106 (36%), Gaps = 16/106 (15%)

Query: 1   MSNRKNSSHPAIN-------LVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARG 53
           M  +  S HPA         LV+G +AG+       P DT+K   Q              
Sbjct: 188 MKMKFASLHPAEKENHTWELLVSGASAGVLFNASVFPADTVKSVCQ---------TEHVS 238

Query: 54  FIGTARDISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLL 99
            +   + +    G    Y+GLG  +I   P  A  F +YE  + + 
Sbjct: 239 IVNALKKVLRTHGITGFYRGLGITLIRAAPANATVFYTYETLKKMF 284

>Kwal_33.12988
          Length = 303

 Score = 80.1 bits (196), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 78/320 (24%), Positives = 127/320 (39%), Gaps = 47/320 (14%)

Query: 13  NLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYK 72
           ++ AG T G+ + L   P D  KVR+Q  S            +   +D+   EG    YK
Sbjct: 26  DITAGTTGGIAQVLVGQPFDITKVRLQTSSTPTTA-------LRVVQDLVKNEGLRGFYK 78

Query: 73  GLGAVVIGIIPKMAIRFTSYEFFRTLLADR---QTGVVSTGNTFVAGVGAGITEAVMVVN 129
           G    +IG+   ++ +F + E  +     R   Q+  +     +  G  +G   A +   
Sbjct: 79  GTTLPLIGVGLCVSSQFGTNEAMKRYFHKRNNFQSTSLRLPEYYACGFVSGCANAFLA-T 137

Query: 130 PMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAAYVI 189
           P+E V+I LQ Q                                 A  +Y+ A+     +
Sbjct: 138 PIEHVRILLQVQ-----------------------------TKSRADAEYQGAMDCIKKL 168

Query: 190 VKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQE--YHQTDMLPSWETSLIGLI 247
           +KE     L RG + T  R +   G  FT Y  +    Q     + D +P+W+  L G  
Sbjct: 169 LKEG---KLMRGFTPTILRTSHGFGVYFTSYEAMICSEQRKGIARKD-IPAWKLCLYGAF 224

Query: 248 SGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITPRVMR 307
           SG+L      P D IK+ +Q DK  +   G + +  + + +  E G +A  KG  P ++R
Sbjct: 225 SGSLLWAMVYPFDVIKSVMQSDKLRTPVYG-TNVFQVAKNIYNERGPKAFVKGFGPTMLR 283

Query: 308 VAPGQAVTFTVYELIRKKLE 327
             P    TFT +E+  + L 
Sbjct: 284 SLPVNGATFTAFEMAMRILN 303

>Sklu_2374.7 YNL083W, Contig c2374 13874-15415 reverse complement
          Length = 513

 Score = 80.9 bits (198), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 81/346 (23%), Positives = 141/346 (40%), Gaps = 63/346 (18%)

Query: 14  LVAGGTAGLFEALCCHPLDTIKV----RMQIYSRAREQGQRA-------------RGFIG 56
            +AGG +G+    C  P D IKV    R  + S       +                 I 
Sbjct: 199 FIAGGCSGVISRTCTAPFDRIKVFLIARTDLSSTLLNSKDKVLMKNPNADISKIKSPLIK 258

Query: 57  TARDISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLAD----RQTGVVSTGNT 112
            A  +  Q G  A Y G G  VI + P+ A++F S+E  + L+A       T  +S  +T
Sbjct: 259 AATTLYRQGGIRAFYVGNGLNVIKVFPESAMKFGSFELAKQLMAHLEGVHHTSELSKFST 318

Query: 113 FVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXEN 172
           ++AG G G   A   V P++ +K R+Q       PL   L G+                 
Sbjct: 319 YIAG-GMGGVVAQFSVYPIDTLKYRVQC-----APLDTALKGNELL-------------- 358

Query: 173 VAATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQ 232
                     I  A  + ++ G +  YRGV++           +   +S LK +     Q
Sbjct: 359 ----------ISTARQMYRDGGLKLFYRGVTVGVMGIFPYAALDLGTFSALK-KWYIARQ 407

Query: 233 TDM--LPSWETSLIGLISGALGPFSNA-------PLDTIKTRLQKDKSTSKDSGWSRILA 283
             M  +P  + ++   I   +G FS         P++ ++TRLQ   + +    ++    
Sbjct: 408 AKMTGVPVDQVTISNFIVLPMGAFSGTVGATVVYPINLLRTRLQAQGTYAHPHTYTGFRD 467

Query: 284 IGRQLIREEGFRALYKGITPRVMRVAPGQAVTFTVYELIRK--KLE 327
           +  + ++ EG++ L+KG+ P + +V P  ++++  YE  ++  KLE
Sbjct: 468 VLWKTVQREGYQGLFKGLVPNLAKVCPAVSISYLCYENFKRLMKLE 513

 Score = 32.3 bits (72), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 47/118 (39%), Gaps = 21/118 (17%)

Query: 233 TDMLPSWETSLIGLISGALGPFSNAPLDTIKTRL------------QKDKSTSKDSGW-- 278
            D +  +   + G  SG +     AP D IK  L             KDK   K+     
Sbjct: 190 NDFIRGFGFFIAGGCSGVISRTCTAPFDRIKVFLIARTDLSSTLLNSKDKVLMKNPNADI 249

Query: 279 ----SRILAIGRQLIREEGFRALYKGITPRVMRVAPGQAVTFTVYELIRK---KLEGL 329
               S ++     L R+ G RA Y G    V++V P  A+ F  +EL ++    LEG+
Sbjct: 250 SKIKSPLIKAATTLYRQGGIRAFYVGNGLNVIKVFPESAMKFGSFELAKQLMAHLEGV 307

>CAGL0J05522g complement(524930..526489) highly similar to sp|P48233
           Saccharomyces cerevisiae YNL083w, hypothetical start
          Length = 519

 Score = 80.9 bits (198), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 80/344 (23%), Positives = 140/344 (40%), Gaps = 67/344 (19%)

Query: 14  LVAGGTAGLFEALCCHPLDTIKV----RMQIYS--------------RAREQGQRA---R 52
            +AGG +G+    C  P D +KV    R  + S               A+    R+   +
Sbjct: 204 FIAGGISGVISRTCTAPFDRLKVFLIARTDLSSTLLNSTEDVLAKNPHAKPNKLRSPLVK 263

Query: 53  GFIGTARDISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLAD----RQTGVVS 108
             I   R    Q G  + Y G G   + + P+ +I+F S+E  + L+      + T  +S
Sbjct: 264 AIISLYR----QGGIKSFYVGNGLNALKVFPESSIKFGSFEITKKLMTKVENCKDTKDLS 319

Query: 109 TGNTFVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXX 168
             +TF+AG  AG+  A   V P++ +K R+Q       PL A+L G              
Sbjct: 320 KLSTFIAGGLAGVC-AQFSVYPIDTLKFRMQC-----APLNAELKGR------------- 360

Query: 169 XXENVAATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKS--- 225
                      +  IQ A  +  E G +  YRGV++           +   +S LK    
Sbjct: 361 -----------KLMIQTAKEMYTEGGLKLFYRGVTVGVLGIFPYAALDLGTFSMLKKWYI 409

Query: 226 -----RLQEYHQTDMLPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSR 280
                +L +  +   L +     +G  SG  G     P++ ++TRLQ   + +    +  
Sbjct: 410 SSKAKKLNKKEEDVELSNLVVLPMGAFSGTFGATVVYPINLLRTRLQAQGTFAHPYRYDG 469

Query: 281 ILAIGRQLIREEGFRALYKGITPRVMRVAPGQAVTFTVYELIRK 324
              +  + I+ EG+  L+KG+ P + +V P  ++++  YE ++K
Sbjct: 470 FRDVLLKTIQREGYPGLFKGLVPTLAKVCPAVSISYLCYENLKK 513

 Score = 38.1 bits (87), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 44/100 (44%), Gaps = 4/100 (4%)

Query: 3   NRKNSSHPAINLVA---GGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTAR 59
           N+K       NLV    G  +G F A   +P++ ++ R+Q          R  GF     
Sbjct: 417 NKKEEDVELSNLVVLPMGAFSGTFGATVVYPINLLRTRLQAQG-TFAHPYRYDGFRDVLL 475

Query: 60  DISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLL 99
               +EG+  L+KGL   +  + P ++I +  YE  + L+
Sbjct: 476 KTIQREGYPGLFKGLVPTLAKVCPAVSISYLCYENLKKLM 515

>Sklu_2431.5 YBR192W, Contig c2431 8526-9638
          Length = 370

 Score = 80.1 bits (196), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 84/350 (24%), Positives = 148/350 (42%), Gaps = 73/350 (20%)

Query: 10  PAINLVAGGTAGLFEALCCHPLDTIKVRMQ-------IYSRAREQG--------QRARGF 54
           P ++ VAGG  G+  A+   P D +K R+Q         S A+  G        Q  R F
Sbjct: 52  PWVHFVAGGIGGMAGAVVTCPFDVVKTRLQSDVFQAAYKSHAKSIGPNQANVIAQGVRHF 111

Query: 55  ---IGTARDISTQEGFLALYKGLGAVVIGIIPKMAIRFTSY----EFFRTLLADRQTGVV 107
               G   ++   EGF +L+KGLG  ++G+IP  +I F +Y    E +   L + Q  V 
Sbjct: 112 KETFGIISNVYRNEGFRSLFKGLGPNLVGVIPARSINFFTYGTTKEIYSKTLNNGQEAVW 171

Query: 108 STGNTFVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXX 167
                 +A   AG   +    NP+ +VK RLQ                            
Sbjct: 172 I---HLMAAATAGWATST-ATNPIWLVKTRLQ---------------------------- 199

Query: 168 XXXENVAATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGA-NFTVYSTLKSR 226
              +    T KY+N+      +V++EG   LY+G  L+A+   + +G   + +Y  +K  
Sbjct: 200 --LDKAGTTKKYKNSWDCLKNVVQKEGILGLYKG--LSASYLGSVEGILQWVLYEQMKHI 255

Query: 227 LQ-------------EYHQTDMLPSW-ETSLIGLISGALGPFSNAPLDTIKTRLQKDKST 272
           ++             E   +D +  W + S    ++  +      P + ++TRL++    
Sbjct: 256 IKQRSMEKFGNISEVEKSTSDKIKEWCQRSGSAGLAKFVASIITYPHEVVRTRLRQAPLE 315

Query: 273 SKDSGWSRILAIGRQLIREEGFRALYKGITPRVMRVAPGQAVTFTVYELI 322
           +    ++ ++   R +I+EEG  ++Y G+TP ++R  P   + F  +EL+
Sbjct: 316 NGKLKYTGLVQSIRVIIKEEGLASMYGGLTPHLLRTVPNSIIMFGTWELV 365

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 35/142 (24%), Positives = 68/142 (47%), Gaps = 16/142 (11%)

Query: 189 IVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPSWETSLIGLIS 248
           + + EG R+L++G+          +  NF  Y T K    E +   +    E   I L++
Sbjct: 121 VYRNEGFRSLFKGLGPNLVGVIPARSINFFTYGTTK----EIYSKTLNNGQEAVWIHLMA 176

Query: 249 GALGPFSNA----PLDTIKTRLQKDKS-TSK--DSGWSRILAIGRQLIREEGFRALYKGI 301
            A   ++ +    P+  +KTRLQ DK+ T+K   + W  +    + ++++EG   LYKG+
Sbjct: 177 AATAGWATSTATNPIWLVKTRLQLDKAGTTKKYKNSWDCL----KNVVQKEGILGLYKGL 232

Query: 302 TPRVMRVAPGQAVTFTVYELIR 323
           +   +    G  + + +YE ++
Sbjct: 233 SASYLGSVEG-ILQWVLYEQMK 253

 Score = 33.9 bits (76), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 20/86 (23%), Positives = 42/86 (48%), Gaps = 3/86 (3%)

Query: 16  AGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQ-RARGFIGTARDISTQEGFLALYKGL 74
           + G A    ++  +P + ++ R++      E G+ +  G + + R I  +EG  ++Y GL
Sbjct: 287 SAGLAKFVASIITYPHEVVRTRLR--QAPLENGKLKYTGLVQSIRVIIKEEGLASMYGGL 344

Query: 75  GAVVIGIIPKMAIRFTSYEFFRTLLA 100
              ++  +P   I F ++E    LL+
Sbjct: 345 TPHLLRTVPNSIIMFGTWELVIRLLS 370

>CAGL0B04543g 441599..442552 highly similar to tr|Q12289
           Saccharomyces cerevisiae YOR100c CRC1, start by
           similarity
          Length = 317

 Score = 79.3 bits (194), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 87/324 (26%), Positives = 126/324 (38%), Gaps = 57/324 (17%)

Query: 14  LVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFL----- 68
           LVAGG  G+   L  HP D IKVR Q  ++A+         +  AR +ST  G L     
Sbjct: 25  LVAGGVGGVCAVLTGHPFDLIKVRCQ-SNQAKSTMDAVSIILKEARSLSTVNGSLTTSLF 83

Query: 69  ------ALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQT--GVVSTGNTFVAGVGAG 120
                   YKG+   +IG+ P  A+ F  Y+  + L+  +Q     ++T     AG  + 
Sbjct: 84  FKNSVKGFYKGVIPPLIGVTPIFAVSFWGYDIGKRLVTWKQASDAPLTTAQMATAGFISA 143

Query: 121 ITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYR 180
           I    +V  P E +K+ LQ          ++  GS                         
Sbjct: 144 I-PTTLVTAPTERIKVVLQTN--------SEFKGSF------------------------ 170

Query: 181 NAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEY---HQTDMLP 237
             I+AA  IV   G ++L+ G   T AR        F  Y   K+ L +       D + 
Sbjct: 171 --IKAAKHIVSTGGVKSLFNGSLATLARDGPGSALYFASYELSKAFLNKSVAKKDKDEVN 228

Query: 238 SWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRAL 297
                L G I+G        P+DTIKTRLQ        +  S + A     I+  G +  
Sbjct: 229 LANVCLAGGIAGMSMWLVVFPIDTIKTRLQ-----VATTPISMVQATKDIYIQRGGIKGF 283

Query: 298 YKGITPRVMRVAPGQAVTFTVYEL 321
           + G+ P ++R  P  A TF   EL
Sbjct: 284 FPGLGPALLRSFPANAATFLGVEL 307

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 44/103 (42%), Gaps = 12/103 (11%)

Query: 231 HQTDMLPSWETSLI-GLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLI 289
           H+TD       +L+ G + G     +  P D IK R Q +++ S     S IL   R L 
Sbjct: 13  HKTDAFRENMKALVAGGVGGVCAVLTGHPFDLIKVRCQSNQAKSTMDAVSIILKEARSLS 72

Query: 290 REEG-----------FRALYKGITPRVMRVAPGQAVTFTVYEL 321
              G            +  YKG+ P ++ V P  AV+F  Y++
Sbjct: 73  TVNGSLTTSLFFKNSVKGFYKGVIPPLIGVTPIFAVSFWGYDI 115

>Kwal_23.3042
          Length = 542

 Score = 80.1 bits (196), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 79/345 (22%), Positives = 146/345 (42%), Gaps = 61/345 (17%)

Query: 14  LVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFI-----------------G 56
            +AGG +G+    C  P D IKV +   +       +++  I                  
Sbjct: 228 FIAGGVSGVVSRTCTAPFDRIKVFLIARTDLSSTFLKSKDIILEKNPNADLSKIKSPLVK 287

Query: 57  TARDISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLAD----RQTGVVSTGNT 112
            A  +  Q G  A Y G G   + + P+ AI+F S+E  + L+A     + T  +S  +T
Sbjct: 288 AATTLYRQGGIRAFYVGNGLNAMKVFPESAIKFGSFELAKRLMAQLEGVQDTAGLSRFST 347

Query: 113 FVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXEN 172
           ++AG G G   A + V P++ +K R+Q       PL  +  G                  
Sbjct: 348 YLAG-GLGGVMAQLSVYPIDTLKYRVQC-----APLNTESKGR----------------- 384

Query: 173 VAATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLK-------S 225
                  +  I  A  + KE G R  YRG+++           +   +S LK       +
Sbjct: 385 -------QLLISTAKDMYKEGGLRIFYRGITVGIMGIFPYAAMDLGTFSALKKWYIARQA 437

Query: 226 RLQEYHQTDM-LPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAI 284
           RL    +  + + +    L+G  SG +G  +  P++ ++TRLQ   + +    ++    +
Sbjct: 438 RLTGLPEDQVTMSNMFVLLMGAFSGTVGATAVYPVNLLRTRLQAQGTFAHPHRYNGFRDV 497

Query: 285 GRQLIREEGFRALYKGITPRVMRVAPGQAVTFTVYELIRK--KLE 327
             + ++ EG++ L+KG+ P + +V P  ++++  YE +++  KLE
Sbjct: 498 LLKTVQREGYQGLFKGLVPNLAKVCPAVSISYLCYENLKRGMKLE 542

 Score = 32.3 bits (72), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 34/118 (28%), Positives = 52/118 (44%), Gaps = 21/118 (17%)

Query: 233 TDMLPSWETSLIGLISGALGPFSNAPLDTIKTRL--QKDKST----SKD--------SGW 278
            D +  +   + G +SG +     AP D IK  L  + D S+    SKD        +  
Sbjct: 219 NDFIRGFGFFIAGGVSGVVSRTCTAPFDRIKVFLIARTDLSSTFLKSKDIILEKNPNADL 278

Query: 279 SRI----LAIGRQLIREEGFRALYKGITPRVMRVAPGQAVTFTVYELIRK---KLEGL 329
           S+I    +     L R+ G RA Y G     M+V P  A+ F  +EL ++   +LEG+
Sbjct: 279 SKIKSPLVKAATTLYRQGGIRAFYVGNGLNAMKVFPESAIKFGSFELAKRLMAQLEGV 336

>YMR166C (YMR166C) [4121] chr13 complement(593366..594472) Member of
           the mitochondrial carrier (MCF) protein family of
           membrane transporters [1107 bp, 368 aa]
          Length = 368

 Score = 79.3 bits (194), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 86/339 (25%), Positives = 133/339 (39%), Gaps = 60/339 (17%)

Query: 14  LVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGF-LALYK 72
           +V+GG  G       H LDT+K R Q         ++ R  I   R I  +EG    LY 
Sbjct: 57  VVSGGIGGKIGDSAMHSLDTVKTRQQ----GAPNVKKYRNMISAYRTIWLEEGVRRGLYG 112

Query: 73  GLGAVVIGIIPKMAIRFTSYEFF-RTLLADRQTGVVSTGNTFVAG-VGAGITEAVMVVNP 130
           G  A ++G  P  AI F +YE+  RT++ D Q  +  T     AG +G  I+  V V  P
Sbjct: 113 GYMAAMLGSFPSAAIFFGTYEYTKRTMIEDWQ--INDTITHLSAGFLGDFISSFVYV--P 168

Query: 131 MEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAAYVIV 190
            EV+K RLQ Q     P                           +   Y N   A   ++
Sbjct: 169 SEVLKTRLQLQGRFNNPF------------------------FQSGYNYSNLRNAIKTVI 204

Query: 191 KEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTD------MLPSWETSLI 244
           KEEG R+L+ G   T AR        F  Y   +    +  Q D       +P+    L 
Sbjct: 205 KEEGFRSLFFGYKATLARDLPFSALQFAFYEKFRQLAFKIEQKDGRDGELSIPN--EILT 262

Query: 245 GLISGALGPFSNAPLDTIKTRLQKDKSTSKDS----------------GWSRILAIG-RQ 287
           G  +G L      P+D +KTR+Q  +  S+ +                  S  +++  R 
Sbjct: 263 GACAGGLAGIITTPMDVVKTRVQTQQPPSQSNKSYSVTHPHVTNGRPAALSNSISLSLRT 322

Query: 288 LIREEGFRALYKGITPRVMRVAPGQAVTFTVYELIRKKL 326
           + + EG    + G+ PR +  +   ++   +Y++  + L
Sbjct: 323 VYQSEGVLGFFSGVGPRFVWTSVQSSIMLLLYQMTLRGL 361

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 62/138 (44%), Gaps = 10/138 (7%)

Query: 13  NLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAR----EQGQRARGFIGTARDISTQEGFL 68
           +L AG       +    P + +K R+Q+  R      + G          + +  +EGF 
Sbjct: 151 HLSAGFLGDFISSFVYVPSEVLKTRLQLQGRFNNPFFQSGYNYSNLRNAIKTVIKEEGFR 210

Query: 69  ALYKGLGAVVIGIIPKMAIRFTSYEFFRTLL-----ADRQTGVVSTGNTFVAGVGAGITE 123
           +L+ G  A +   +P  A++F  YE FR L       D + G +S  N  + G  AG   
Sbjct: 211 SLFFGYKATLARDLPFSALQFAFYEKFRQLAFKIEQKDGRDGELSIPNEILTGACAG-GL 269

Query: 124 AVMVVNPMEVVKIRLQAQ 141
           A ++  PM+VVK R+Q Q
Sbjct: 270 AGIITTPMDVVKTRVQTQ 287

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 45/94 (47%), Gaps = 4/94 (4%)

Query: 234 DMLPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEG 293
           D+ P W   + G I G +G  +   LDT+KTR Q   +  K   +  +++  R +  EEG
Sbjct: 49  DLSPIWHCVVSGGIGGKIGDSAMHSLDTVKTRQQGAPNVKK---YRNMISAYRTIWLEEG 105

Query: 294 F-RALYKGITPRVMRVAPGQAVTFTVYELIRKKL 326
             R LY G    ++   P  A+ F  YE  ++ +
Sbjct: 106 VRRGLYGGYMAAMLGSFPSAAIFFGTYEYTKRTM 139

>AFR146W [3338] [Homologous to ScYOR130C (ORT1) - SH]
           complement(702404..703249) [846 bp, 281 aa]
          Length = 281

 Score = 77.8 bits (190), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 81/315 (25%), Positives = 127/315 (40%), Gaps = 56/315 (17%)

Query: 13  NLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDIS---TQEGFL- 68
           +L+ GG AG    L  +P DT+KVR+Q         Q A  F  T   +S    QEG   
Sbjct: 11  DLLYGGVAGSLGKLVEYPFDTVKVRLQT--------QSAALFPTTWSCVSHTYKQEGLWR 62

Query: 69  ALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNTFVAGVGAGITEAVMVV 128
             Y+G+ + V G   + A+ F S+   + +L +  +        F   +    T  V+  
Sbjct: 63  GFYQGMASPVFGAFLEHAVLFVSFNRAQAVLENCYSCGPLEKVVFAGAIAGACTSYVL-- 120

Query: 129 NPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAAYV 188
            P+E+VK +LQ  ++  V                            + P+Y   +     
Sbjct: 121 TPVELVKCKLQVSNLTGV----------------------------SGPRYTAVLPTLRA 152

Query: 189 IVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPSWETSLIGLIS 248
           IVK+ G   L++G S T  R++      FT Y  LK  L     +     WE    G  +
Sbjct: 153 IVKQNGLGGLWQGQSGTFIRESAGGAVWFTAYEVLKGWLARRRGSTENTVWELLASGAGA 212

Query: 249 GALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIG---RQLIREEGFRALYKGITPRV 305
           GA    S  P DT+K+ +Q +            L +G   R ++++ G    Y+G+   +
Sbjct: 213 GAAFHASIFPADTVKSTMQTEH-----------LGLGPAVRTVLKKHGPTGFYRGVGITL 261

Query: 306 MRVAPGQAVTFTVYE 320
           +R  P  AV F VYE
Sbjct: 262 LRALPANAVIFYVYE 276

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 47/210 (22%), Positives = 75/210 (35%), Gaps = 37/210 (17%)

Query: 14  LVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYKG 73
           + AG  AG   +    P++ +K ++Q+ +     G R    + T R I  Q G   L++G
Sbjct: 106 VFAGAIAGACTSYVLTPVELVKCKLQVSNLTGVSGPRYTAVLPTLRAIVKQNGLGGLWQG 165

Query: 74  LGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNTFVAGVGAGITEAVMVVNPMEV 133
                I      A+ FT+YE  +  LA R+    +T    +A            + P + 
Sbjct: 166 QSGTFIRESAGGAVWFTAYEVLKGWLARRRGSTENTVWELLASGAGAGAAFHASIFPADT 225

Query: 134 VKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAAYVIVKEE 193
           VK  +Q +H+   P                                     A   ++K+ 
Sbjct: 226 VKSTMQTEHLGLGP-------------------------------------AVRTVLKKH 248

Query: 194 GPRALYRGVSLTAARQATNQGANFTVYSTL 223
           GP   YRGV +T  R        F VY +L
Sbjct: 249 GPTGFYRGVGITLLRALPANAVIFYVYESL 278

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 43/203 (21%), Positives = 81/203 (39%), Gaps = 37/203 (18%)

Query: 126 MVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQA 185
           +V  P + VK+RLQ Q                              + A  P   + +  
Sbjct: 24  LVEYPFDTVKVRLQTQ------------------------------SAALFPTTWSCVSH 53

Query: 186 AYVIVKEEG-PRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPSWETSLI 244
            Y   K+EG  R  Y+G++             F  ++  ++ L+  +    L   +    
Sbjct: 54  TY---KQEGLWRGFYQGMASPVFGAFLEHAVLFVSFNRAQAVLENCYSCGPLE--KVVFA 108

Query: 245 GLISGALGPFSNAPLDTIKTRLQKDKSTSKDSG-WSRILAIGRQLIREEGFRALYKGITP 303
           G I+GA   +   P++ +K +LQ    T      ++ +L   R ++++ G   L++G + 
Sbjct: 109 GAIAGACTSYVLTPVELVKCKLQVSNLTGVSGPRYTAVLPTLRAIVKQNGLGGLWQGQSG 168

Query: 304 RVMRVAPGQAVTFTVYELIRKKL 326
             +R + G AV FT YE+++  L
Sbjct: 169 TFIRESAGGAVWFTAYEVLKGWL 191

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 43/95 (45%), Gaps = 5/95 (5%)

Query: 234 DMLPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEG 293
           D   +++  L G ++G+LG     P DT+K RLQ   +    + WS +        ++EG
Sbjct: 4   DADKAYKDLLYGGVAGSLGKLVEYPFDTVKVRLQTQSAALFPTTWSCV----SHTYKQEG 59

Query: 294 -FRALYKGITPRVMRVAPGQAVTFTVYELIRKKLE 327
            +R  Y+G+   V       AV F  +   +  LE
Sbjct: 60  LWRGFYQGMASPVFGAFLEHAVLFVSFNRAQAVLE 94

>AAR036W [222] [Homologous to ScYGR096W - SH]
           complement(406887..407840) [954 bp, 317 aa]
          Length = 317

 Score = 77.8 bits (190), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 79/326 (24%), Positives = 135/326 (41%), Gaps = 57/326 (17%)

Query: 14  LVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYKG 73
           +VAG  +GL       P+DT+K+R Q+   A E   +  G + T R ++ +EG  AL+KG
Sbjct: 28  VVAGSVSGLVARSVTAPMDTVKIRRQL-QLASEH--KYHGILHTFRTVAREEGVRALWKG 84

Query: 74  LGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNTFVAGVGAGITEAVMVVNPMEV 133
                   +   +++F +Y +  T  A    G+    ++   G  AG+  +++   P+++
Sbjct: 85  NVPASAMYVLYGSLQFGTYAWLNT--AAASAGLPPQAHSLAVGALAGLVSSLLTY-PLDL 141

Query: 134 VKIRLQA-QHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAAYVIVKE 192
           ++ RL A +   +  L+ Q                                  A VI   
Sbjct: 142 LRTRLVANRSAHFFSLRRQ----------------------------------ARVIWDT 167

Query: 193 EGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPSWETSLIGLISGALG 252
           EGP   +RG +   A      G  F +Y T       Y     LP W  +     +G + 
Sbjct: 168 EGPAGFFRGGAWAIAATTLTTGLIFGIYETCTIAADTYG----LP-WLAAAASPTAGLVS 222

Query: 253 PFSNAPLDTIKTRLQKDKST-----SKDSGW------SRILAIGRQLIREEGFRALYKGI 301
             +  PLDT++ RLQ   +      ++D G       +R L +   ++R EG  +LYKG+
Sbjct: 223 KAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKGL 282

Query: 302 TPRVMRVAPGQAVTFTVYELIRKKLE 327
           T  + +  P   +T  VY+   + LE
Sbjct: 283 TMALCKSTPTTVITLWVYQRCLRLLE 308

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 39/94 (41%), Gaps = 10/94 (10%)

Query: 10  PAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSR------AREQGQ----RARGFIGTAR 59
           P +   A  TAGL       PLDT++ R+QI          R+ G     R   F+G A 
Sbjct: 208 PWLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAV 267

Query: 60  DISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYE 93
            +   EG  +LYKGL   +    P   I    Y+
Sbjct: 268 HMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQ 301

 Score = 32.7 bits (73), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 51/231 (22%), Positives = 87/231 (37%), Gaps = 35/231 (15%)

Query: 11  AINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLAL 70
           A +L  G  AGL  +L  +PLD ++ R+     A     R +     AR I   EG    
Sbjct: 119 AHSLAVGALAGLVSSLLTYPLDLLRTRLVANRSAHFFSLRRQ-----ARVIWDTEGPAGF 173

Query: 71  YKGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNTFVAGVG---AGITEAVMV 127
           ++G    +        + F  YE   T+ AD      + G  ++A      AG+     V
Sbjct: 174 FRGGAWAIAATTLTTGLIFGIYETC-TIAAD------TYGLPWLAAAASPTAGLVSKAAV 226

Query: 128 VNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAAY 187
             P++ V+ RLQ    +++P   +  G+                      +    +  A 
Sbjct: 227 F-PLDTVRRRLQIVDAKHIPFFTRDPGAYSAL------------------RGTRFLGLAV 267

Query: 188 VIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPS 238
            +V+ EG  +LY+G+++   +          VY     RL E  +   LP+
Sbjct: 268 HMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQRCL-RLLEPTRAPQLPA 317

>Kwal_47.19228
          Length = 281

 Score = 77.0 bits (188), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 67/274 (24%), Positives = 113/274 (41%), Gaps = 25/274 (9%)

Query: 71  YKGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQT--GVVSTGNTFVAGVGAGITEAVMVV 128
           + G  A+ +G + K A RFT+++    LL D +   G +S      AGV  G  E+++V+
Sbjct: 9   FAGCSALNVGTLLKTATRFTTFDRACQLLHDPENPNGTISGPRLLAAGVITGFMESLLVI 68

Query: 129 NPMEVVKIRL-------------QAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAA 175
            P E +K  +             + Q  + V ++ +                    +   
Sbjct: 69  -PFENIKTTMIENALLLSERANAEPQEKKKVTVQPRATFHSQKKALHPRQKWALYYDEHP 127

Query: 176 TPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDM 235
           + ++   +Q  Y   +  G R   +G   T  RQ +N    FT Y++LK   Q       
Sbjct: 128 SRQFLTTVQEIY---RSRGIRGFLQGTMPTIIRQTSNSAVRFTTYTSLK---QMISPNKP 181

Query: 236 LPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFR 295
           L  +    +G IS         P+D IKTR+Q   S    S +   L    ++  EEGF 
Sbjct: 182 LNEYYAFALGFISSCAVVAVTQPIDVIKTRMQ---SKYTWSNYKNSLNCAYRIFVEEGFT 238

Query: 296 ALYKGITPRVMRVAPGQAVTFTVYELIRKKLEGL 329
             +KG  PR+M+V     V+F VY+ +   ++ +
Sbjct: 239 KFWKGWAPRLMKVGLSGGVSFGVYQYVDNLMKAV 272

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/178 (19%), Positives = 70/178 (39%), Gaps = 35/178 (19%)

Query: 51  ARGFIGTARDISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTG 110
           +R F+ T ++I    G     +G    +I      A+RFT+Y   + +++  +   ++  
Sbjct: 128 SRQFLTTVQEIYRSRGIRGFLQGTMPTIIRQTSNSAVRFTTYTSLKQMISPNKP--LNEY 185

Query: 111 NTFVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXX 170
             F  G  +     V V  P++V+K R+Q+++                            
Sbjct: 186 YAFALGFISSCA-VVAVTQPIDVIKTRMQSKYT--------------------------- 217

Query: 171 ENVAATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQ 228
                   Y+N++  AY I  EEG    ++G +    +   + G +F VY  + + ++
Sbjct: 218 -----WSNYKNSLNCAYRIFVEEGFTKFWKGWAPRLMKVGLSGGVSFGVYQYVDNLMK 270

>CAGL0J09790g complement(957759..958661) highly similar to sp|P38988
           Saccharomyces cerevisiae YDL198c YHM1, start by
           similarity
          Length = 300

 Score = 76.3 bits (186), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 88/325 (27%), Positives = 132/325 (40%), Gaps = 72/325 (22%)

Query: 14  LVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGF----LA 69
           L+   +AG+ E    HP+DTI  R+         G +    I   RD    E F      
Sbjct: 14  LLGSASAGILEIGVFHPVDTISKRLMSNHTKITSGAQLNSVI--FRD-HAAEAFGKRVFT 70

Query: 70  LYKGLG-AVVIGIIPK--------MAIRFTSYEF---FRTLLADRQTGVVSTGNTFVAGV 117
           L+ GLG A V  I+ +         A  F +  F   F +   D+    + +     AG 
Sbjct: 71  LFPGLGYAAVYKILQRVYKYGGQPFANEFLNKHFKKDFDSAFGDKTGKALRSA---TAGS 127

Query: 118 GAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATP 177
             GI E V++  P++V+KI+ Q     +                                
Sbjct: 128 LIGIGEIVLL--PLDVLKIKRQTNPEAF-------------------------------- 153

Query: 178 KYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSR---LQEYHQTD 234
           K R  ++    I+K+EG   LYRG   TAAR A    A F   +  K     LQ+Y Q  
Sbjct: 154 KGRGFLK----ILKDEGIFNLYRGWGWTAARNAPGSFALFGGNAFAKEYILGLQDYSQA- 208

Query: 235 MLPSWETSLIGLISGALGPF-SNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEG 293
              +W  + I  I GA      +APLD IKTR+Q     + +SG+     I +  ++ EG
Sbjct: 209 ---TWSQNFISSIVGASASLIVSAPLDVIKTRIQNRNFDNPESGFK----IVKNTLKNEG 261

Query: 294 FRALYKGITPRVMRVAPGQAVTFTV 318
           F A +KG+TP+++   P    +F +
Sbjct: 262 FTAFFKGLTPKLLTTGPKLVFSFAL 286

 Score = 33.5 bits (75), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 36/82 (43%), Gaps = 8/82 (9%)

Query: 8   SHPAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGF 67
           S   I+ + G +A L   +   PLD IK R+Q     R       GF    ++    EGF
Sbjct: 211 SQNFISSIVGASASL---IVSAPLDVIKTRIQ----NRNFDNPESGF-KIVKNTLKNEGF 262

Query: 68  LALYKGLGAVVIGIIPKMAIRF 89
            A +KGL   ++   PK+   F
Sbjct: 263 TAFFKGLTPKLLTTGPKLVFSF 284

 Score = 32.0 bits (71), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 32/72 (44%), Gaps = 7/72 (9%)

Query: 258 PLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITPRVMRVAPGQAVTFT 317
           PLD +K + Q +    K  G+ +IL       ++EG   LY+G      R APG    F 
Sbjct: 138 PLDVLKIKRQTNPEAFKGRGFLKIL-------KDEGIFNLYRGWGWTAARNAPGSFALFG 190

Query: 318 VYELIRKKLEGL 329
                ++ + GL
Sbjct: 191 GNAFAKEYILGL 202

>CAGL0G03135g 290834..291757 similar to sp|P53257 Saccharomyces
           cerevisiae YGR096w, hypothetical start
          Length = 307

 Score = 76.3 bits (186), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 87/344 (25%), Positives = 138/344 (40%), Gaps = 66/344 (19%)

Query: 4   RKNSSHPAIN-LVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDIS 62
           RK+      N LVAG  +GLF   C  PLDT+K+++Q+        + A   I    +I 
Sbjct: 8   RKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQV----TPHNKNANVLI----NIL 59

Query: 63  TQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLL-ADRQTGVVSTGNTFVAGVGAGI 121
            +EG    +KG     I  I     +F SY +  + L       +     + + G  AG+
Sbjct: 60  KREGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGM 119

Query: 122 TEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRN 181
           T + +   P +V++ R  A        + QL                         K R+
Sbjct: 120 TSS-LASYPFDVLRTRFAANS------QGQLI------------------------KLRD 148

Query: 182 AIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLK------SRLQEYHQTDM 235
            I A   I   EG    + G   +      N    F VY ++K      S+L +      
Sbjct: 149 EIMA---IWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFT 205

Query: 236 LPSWETSLIGLISGALGPFSNAPLDTIKTRLQ---------KDKSTSKDSGWS----RIL 282
           L +    L G ISG     +  PLDT++ R+Q          D+  +KD   S    R L
Sbjct: 206 LLN---ELAGPISGFTSKLATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFL 262

Query: 283 AIGRQLIREEGFRALYKGITPRVMRVAPGQAVTFTVYELIRKKL 326
            +G  ++++EG  +LY+G+T  +++  P  A++   YEL   KL
Sbjct: 263 GVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISLWSYELFMNKL 306

 Score = 30.4 bits (67), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 48/103 (46%), Gaps = 10/103 (9%)

Query: 228 QEYHQTDMLPSWETSLI-GLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGR 286
           +++ + D   S   SL+ G +SG       APLDT+K +LQ    T  +   + ++ I  
Sbjct: 4   KDHLRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQ---VTPHNKNANVLINI-- 58

Query: 287 QLIREEGFRALYKGITP-RVMRVAPGQAVTFTVYELIRKKLEG 328
             ++ EG R  +KG  P  +M +  G A  F  Y  I   L G
Sbjct: 59  --LKREGIRGFWKGNVPGSIMYIIYGGA-QFGSYTYIGSFLRG 98

>Scas_721.27
          Length = 374

 Score = 76.3 bits (186), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 80/355 (22%), Positives = 151/355 (42%), Gaps = 79/355 (22%)

Query: 10  PAINLVAGGTAGLFEALCCHPLDTIKVRMQ--IY-----SRAR---------------EQ 47
           P ++ VAGG  G+  A+   P D +K R+Q  IY     S+A                + 
Sbjct: 52  PWVHFVAGGIGGMAGAVVTCPFDLVKTRLQSDIYQSVYKSKAATVTAAHNSKIANSLVQA 111

Query: 48  GQRARGFIGTARDISTQEGFLALYKGLGAVVIGIIPKMAIRFTSY----EFFRTLLAD-R 102
           G   +   G   ++  +EGF +L+KGLG  ++G+IP  +I F +Y    E +     + +
Sbjct: 112 GTHFKETFGILGNVYKREGFRSLFKGLGPNLVGVIPARSINFFTYGTTKEIYSKAFNNGQ 171

Query: 103 QTGVVSTGNTFVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXX 162
           +T ++   +   AG            NP+ ++K R+Q                       
Sbjct: 172 ETPLIHLMSAATAGWATST-----ATNPIWMIKTRVQ----------------------- 203

Query: 163 XXXXXXXXENVAATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGA-NFTVYS 221
                   +    T KY+N+      ++K EG   LYRG  L+A+   + +G   + +Y 
Sbjct: 204 -------LDKAGTTRKYKNSWDCLKTVLKSEGIYGLYRG--LSASYLGSIEGILQWLLYE 254

Query: 222 TLKSRLQEY------HQ-------TDMLPSW-ETSLIGLISGALGPFSNAPLDTIKTRLQ 267
            +K  +++       H+       T+ +  W + S    ++  +      P + ++TRL+
Sbjct: 255 QMKHLIKQRSIEKFGHEGQLTKSRTEKIKEWCQRSGSAGVAKFIASIVTYPHEVVRTRLR 314

Query: 268 KDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITPRVMRVAPGQAVTFTVYELI 322
           +    +    ++ ++   R +I+EEG  ++Y G+TP +MR  P   + F  +EL+
Sbjct: 315 QMPMENGKPKYTGLVQSFRVIIKEEGLASMYSGLTPHLMRTVPNSIIMFGTWELV 369

 Score = 35.0 bits (79), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 20/86 (23%), Positives = 42/86 (48%), Gaps = 3/86 (3%)

Query: 16  AGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQ-RARGFIGTARDISTQEGFLALYKGL 74
           + G A    ++  +P + ++ R++      E G+ +  G + + R I  +EG  ++Y GL
Sbjct: 291 SAGVAKFIASIVTYPHEVVRTRLR--QMPMENGKPKYTGLVQSFRVIIKEEGLASMYSGL 348

Query: 75  GAVVIGIIPKMAIRFTSYEFFRTLLA 100
              ++  +P   I F ++E    LL+
Sbjct: 349 TPHLMRTVPNSIIMFGTWELVIRLLS 374

>Kwal_26.7653
          Length = 325

 Score = 75.5 bits (184), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 64/226 (28%), Positives = 97/226 (42%), Gaps = 44/226 (19%)

Query: 107 VSTGNTFVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXX 166
           VS   +F+AG G     AV V NP+E+VK R+Q        L+ +++             
Sbjct: 22  VSKTGSFIAG-GMAACIAVTVTNPIELVKTRMQ--------LQGEMSAD----------- 61

Query: 167 XXXXENVAATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSR 226
                   A   Y+N +QA  VI K EG R L +G+S     Q    G+    Y  ++S 
Sbjct: 62  --------AQRIYKNPMQALKVIFKNEGIRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSV 113

Query: 227 LQEYHQTDMLPSWETSLI-----GLISGALGPFSNAPLDTIKTRLQK-------DKSTSK 274
           L +     M P    ++      G  SG +G    +PL  IKTR+Q         + T  
Sbjct: 114 LNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHY 173

Query: 275 DSGWSRILAIGRQLIREEGFRALYKGITPRVMRVAPGQAVTFTVYE 320
            S W+ + +I     R EGF+ LY+G+   ++R   G +V   +Y 
Sbjct: 174 TSIWNGLSSI----YRAEGFKGLYRGVDAAILRTGAGSSVQLPIYN 215

 Score = 64.7 bits (156), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 75/319 (23%), Positives = 120/319 (37%), Gaps = 47/319 (14%)

Query: 13  NLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRA-RGFIGTARDISTQEGFLALY 71
           + +AGG A        +P++ +K RMQ+        QR  +  +   + I   EG   L 
Sbjct: 27  SFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQ 86

Query: 72  KGLGAVVIGIIPKMAIRFTSYEFFRTLL------ADRQTGVVSTGNTFVAGVGAGITEAV 125
           KGL    I  I     R   YE  R++L      A     V +     V+G  +GI  A+
Sbjct: 87  KGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAI 146

Query: 126 MVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQA 185
           M  +P+ ++K R+Q+                                +     Y +    
Sbjct: 147 MG-SPLFLIKTRMQS--------------------------YSNAIQIGQQTHYTSIWNG 179

Query: 186 AYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPSWETSLIG 245
              I + EG + LYRGV     R          +Y+T K  L ++   D++   E + + 
Sbjct: 180 LSSIYRAEGFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKH---DLMK--EGTGLH 234

Query: 246 LISGALGPFSNA----PLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGI 301
           L++  +  F       P D I TR+   K       +   L    + +R EG  ALYKG 
Sbjct: 235 LVASTVSGFGVGVVMNPWDVILTRVYNQKGNL----YKGPLDCFVKTVRIEGIGALYKGF 290

Query: 302 TPRVMRVAPGQAVTFTVYE 320
             ++ R+AP   +  T  E
Sbjct: 291 EAQIFRIAPHTILCLTFME 309

 Score = 54.7 bits (130), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 45/138 (32%), Positives = 69/138 (50%), Gaps = 13/138 (9%)

Query: 11  AINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRAR--GFIGTARDISTQEGFL 68
           A+N+V+G T+G+  A+   PL  IK RMQ YS A + GQ+            I   EGF 
Sbjct: 131 AVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFK 190

Query: 69  ALYKGLGAVVI----GIIPKMAIRFTSYEF-FRTLLADRQTGVVSTGNTFVAGVGAGITE 123
            LY+G+ A ++    G   ++ I  T+  F  +  L    TG+    +T V+G G G+  
Sbjct: 191 GLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVAST-VSGFGVGV-- 247

Query: 124 AVMVVNPMEVVKIRLQAQ 141
              V+NP +V+  R+  Q
Sbjct: 248 ---VMNPWDVILTRVYNQ 262

>ADL264C [1477] [Homologous to ScYOR100C (CRC1) - SH]
           (241532..242521) [990 bp, 329 aa]
          Length = 329

 Score = 75.5 bits (184), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 85/322 (26%), Positives = 125/322 (38%), Gaps = 61/322 (18%)

Query: 11  AINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDI----STQEG 66
           A +L AG   G+   L  HP D +KVR         Q  +A G +   R I      Q G
Sbjct: 48  AKSLAAGAVGGVCAVLTGHPFDLLKVRC--------QSNQASGTVDAVRKILVEARAQSG 99

Query: 67  FLAL------YKGLGAVVIGIIPKMAIRFTSYEFFRTLLA-DRQTGVVSTGNTFVAGVGA 119
             A+      YKG+   ++G+ P  A+ F  Y+  + L+  +  +G ++T     AG  +
Sbjct: 100 LSAVNMMRGFYKGVIPPLLGVTPIFAVSFWGYDVGKKLVTWNDNSGKLTTAQLATAGFIS 159

Query: 120 GITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKY 179
            I    +V+ P E VK+ LQ Q    +       GS                        
Sbjct: 160 AI-PTTLVMAPTERVKVVLQTQSNHSL-------GS------------------------ 187

Query: 180 RNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPSW 239
                AA  I+   G R+L+RG   T AR        F  Y   K+ L     T+ L   
Sbjct: 188 -----AAKHILATGGVRSLFRGSLATLARDGPGSALYFASYEATKAYLNARSGTNELSIK 242

Query: 240 ETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYK 299
              L G ++G        P+DTIKT LQ     S ++  + + A  +      G +  + 
Sbjct: 243 NVCLAGGMAGVSMWVGVFPIDTIKTELQ-----SSNTRQTMMEATRKIYNTRGGIKGFFP 297

Query: 300 GITPRVMRVAPGQAVTFTVYEL 321
           GI P ++R  P  A TF   EL
Sbjct: 298 GIGPALLRSFPANAATFLGVEL 319

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 38/83 (45%), Gaps = 3/83 (3%)

Query: 245 GLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQ---LIREEGFRALYKGI 301
           G + G     +  P D +K R Q ++++       +IL   R    L      R  YKG+
Sbjct: 54  GAVGGVCAVLTGHPFDLLKVRCQSNQASGTVDAVRKILVEARAQSGLSAVNMMRGFYKGV 113

Query: 302 TPRVMRVAPGQAVTFTVYELIRK 324
            P ++ V P  AV+F  Y++ +K
Sbjct: 114 IPPLLGVTPIFAVSFWGYDVGKK 136

 Score = 37.4 bits (85), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 45/112 (40%), Gaps = 7/112 (6%)

Query: 216 NFTVYSTLKSRLQEYHQTDMLPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKD 275
           +F  Y   K  +     +  L + + +  G IS        AP + +K  LQ   + S  
Sbjct: 127 SFWGYDVGKKLVTWNDNSGKLTTAQLATAGFISAIPTTLVMAPTERVKVVLQTQSNHSLG 186

Query: 276 SGWSRILAIGRQLIREEGFRALYKGITPRVMRVAPGQAVTFTVYELIRKKLE 327
           S    ILA G       G R+L++G    + R  PG A+ F  YE  +  L 
Sbjct: 187 SAAKHILATG-------GVRSLFRGSLATLARDGPGSALYFASYEATKAYLN 231

>Kwal_55.20868
          Length = 380

 Score = 75.9 bits (185), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 80/333 (24%), Positives = 125/333 (37%), Gaps = 50/333 (15%)

Query: 12  INLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALY 71
           I  ++G  AG    +   PLD  K R+Q            +G +GT   I   EG   LY
Sbjct: 77  ITALSGAMAGFLAGVTVCPLDVAKTRLQAQGLHSNPSNYYKGILGTLTTIIRDEGARGLY 136

Query: 72  KGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNTFVAGVGAGITE---AVMVV 128
           KGL  +++G  P   I F+ YE  + L        +     F++   + +T    + ++ 
Sbjct: 137 KGLVPIIMGYFPTWMIYFSVYERSKKLYPR-----IFPSFDFISHSASALTAGTVSTILT 191

Query: 129 NPMEVVKIRLQAQ-HVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAAY 187
           NP+ VVK RL  Q HV                            N  +T  Y +   A +
Sbjct: 192 NPVWVVKTRLMLQTHV----------------------------NKNST-HYTSTFDAFH 222

Query: 188 VIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPSWETSLIGLI 247
            +   EG R  Y G+ L +     +   +F +Y  LK  L              +L  LI
Sbjct: 223 KMYTTEGLRTFYAGL-LPSLLGLFHVAIHFPIYEKLKVWLHCTPSMSRTEDHNLNLARLI 281

Query: 248 -----SGALGPFSNAPLDTIKTRLQ-KDKSTSKDSGWSR-----ILAIGRQLIREEGFRA 296
                S  +      P + ++TR+Q K   T   +   +     ++ + +   + EG R 
Sbjct: 282 IASSASKMVASTLTYPHEILRTRMQLKAYPTDPLAALQKTSRHGLIRLIKHTYKSEGLRG 341

Query: 297 LYKGITPRVMRVAPGQAVTFTVYELIRKKLEGL 329
            Y G T  + R  P  A+T   +E  RK L  L
Sbjct: 342 FYSGFTANLARTLPASAITLVSFEYFRKYLTKL 374

>YOR100C (CRC1) [4905] chr15 complement(513295..514278)
           Mitochondrial carnitine carrier, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [984 bp, 327 aa]
          Length = 327

 Score = 75.1 bits (183), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 85/330 (25%), Positives = 138/330 (41%), Gaps = 71/330 (21%)

Query: 13  NLVAGGTAGLFEALCCHPLDTIKVRMQ----------IYSRAREQGQRARGFIGTARDIS 62
           + VAGG  G+      HP D IKVR Q          I +  +E   + +G + T    +
Sbjct: 38  SFVAGGVGGVCAVFTGHPFDLIKVRCQNGQANSTVHAITNIIKEAKTQVKGTLFT----N 93

Query: 63  TQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLA--DRQTGV--VSTGNTFVAGVG 118
           + +GF   YKG+   ++G+ P  A+ F  Y+  + L+   ++Q G   ++ G    AG  
Sbjct: 94  SVKGF---YKGVIPPLLGVTPIFAVSFWGYDVGKKLVTFNNKQGGSNELTMGQMAAAGFI 150

Query: 119 AGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPK 178
           + I    +V  P E VK+ LQ                                    T  
Sbjct: 151 SAI-PTTLVTAPTERVKVVLQ------------------------------------TSS 173

Query: 179 YRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRL------QEYHQ 232
             + IQAA  IVKE G  +L++G   T AR        F  Y   K+ L      Q+  +
Sbjct: 174 KGSFIQAAKTIVKEGGIASLFKGSLATLARDGPGSALYFASYEISKNYLNSRQPRQDAGK 233

Query: 233 TDMLPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQL-IRE 291
            + +      L G I+G     +  P+DTIKT+LQ   ST ++     +L+  +++ ++ 
Sbjct: 234 DEPVNILNVCLAGGIAGMSMWLAVFPIDTIKTKLQAS-STRQN-----MLSATKEIYLQR 287

Query: 292 EGFRALYKGITPRVMRVAPGQAVTFTVYEL 321
            G +  + G+ P ++R  P  A TF   E+
Sbjct: 288 GGIKGFFPGLGPALLRSFPANAATFLGVEM 317

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 40/84 (47%), Gaps = 4/84 (4%)

Query: 245 GLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGF----RALYKG 300
           G + G    F+  P D IK R Q  ++ S     + I+   +  ++   F    +  YKG
Sbjct: 42  GGVGGVCAVFTGHPFDLIKVRCQNGQANSTVHAITNIIKEAKTQVKGTLFTNSVKGFYKG 101

Query: 301 ITPRVMRVAPGQAVTFTVYELIRK 324
           + P ++ V P  AV+F  Y++ +K
Sbjct: 102 VIPPLLGVTPIFAVSFWGYDVGKK 125

 Score = 35.8 bits (81), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 39/83 (46%), Gaps = 7/83 (8%)

Query: 245 GLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITPR 304
           G IS        AP + +K  LQ   ++SK S     +   + +++E G  +L+KG    
Sbjct: 148 GFISAIPTTLVTAPTERVKVVLQ---TSSKGS----FIQAAKTIVKEGGIASLFKGSLAT 200

Query: 305 VMRVAPGQAVTFTVYELIRKKLE 327
           + R  PG A+ F  YE+ +  L 
Sbjct: 201 LARDGPGSALYFASYEISKNYLN 223

 Score = 35.4 bits (80), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 38/86 (44%), Gaps = 8/86 (9%)

Query: 15  VAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFL-ALYKG 73
           +AGG AG+   L   P+DTIK ++Q  S  +         +   ++I  Q G +   + G
Sbjct: 244 LAGGIAGMSMWLAVFPIDTIKTKLQASSTRQN-------MLSATKEIYLQRGGIKGFFPG 296

Query: 74  LGAVVIGIIPKMAIRFTSYEFFRTLL 99
           LG  ++   P  A  F   E   +L 
Sbjct: 297 LGPALLRSFPANAATFLGVEMTHSLF 322

>AER419W [2919] [Homologous to ScYNL083W - SH]
           complement(1442595..1444076) [1482 bp, 493 aa]
          Length = 493

 Score = 76.3 bits (186), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 78/330 (23%), Positives = 133/330 (40%), Gaps = 61/330 (18%)

Query: 27  CCHPLDTIKVRM----------------QIYSRAREQGQRARG-FIGTARDISTQEGFLA 69
           C  P D IKV +                 ++   R    + R   +  A  +  Q G  A
Sbjct: 192 CTAPFDRIKVFLIARTDLSSPLLHTPEQLLHHNPRADPAKIRSPLVKAATSLYRQGGLRA 251

Query: 70  LYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADR----QTGVVSTGNTFVAGVGAGITEAV 125
            Y G G  VI + P+ A++F S+E  + +LA      +TG +S  +T+VAG G G   A 
Sbjct: 252 FYLGNGLNVIKVFPESAMKFGSFELAKRVLAGLEGCGETGELSRLSTYVAG-GLGGIMAQ 310

Query: 126 MVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQA 185
             V P++ +K R+Q       PL  +  G                            I+ 
Sbjct: 311 FSVYPIDTLKFRIQC-----APLDTRCRGLPLL------------------------IKT 341

Query: 186 AYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPSWETSLI- 244
           A  + +E G R  YRG+ +           +   +S LK R     + + L   E  ++ 
Sbjct: 342 AKDMYREGGLRLFYRGLGVGILGVFPYAALDLGTFSALK-RWYITRRANALGISENEVVM 400

Query: 245 --------GLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRA 296
                   G  SG +G     P++ ++TRLQ   + +    +     + R+ ++ EG   
Sbjct: 401 SNLVVLPMGAFSGTVGATVVYPINLLRTRLQAQGTYAHPHRYDGFQDVFRKTVQREGLPG 460

Query: 297 LYKGITPRVMRVAPGQAVTFTVYELIRKKL 326
           LYKG+ P + +V P  A+++  YE +++ +
Sbjct: 461 LYKGLVPTLAKVCPAVAISYLCYENLKRAM 490

 Score = 57.0 bits (136), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 55/222 (24%), Positives = 85/222 (38%), Gaps = 46/222 (20%)

Query: 15  VAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGF---IGTARDISTQEGFLALY 71
           VAGG  G+      +P+DT+K R+Q          R RG    I TA+D+  + G    Y
Sbjct: 300 VAGGLGGIMAQFSVYPIDTLKFRIQ----CAPLDTRCRGLPLLIKTAKDMYREGGLRLFY 355

Query: 72  KGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGV-------VSTGNTFVAGVGA-GITE 123
           +GLG  ++G+ P  A+   ++   +     R+          V   N  V  +GA   T 
Sbjct: 356 RGLGVGILGVFPYAALDLGTFSALKRWYITRRANALGISENEVVMSNLVVLPMGAFSGTV 415

Query: 124 AVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAI 183
              VV P+ +++ RLQAQ                                 A P   +  
Sbjct: 416 GATVVYPINLLRTRLQAQ------------------------------GTYAHPHRYDGF 445

Query: 184 QAAY-VIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLK 224
           Q  +   V+ EG   LY+G+  T A+       ++  Y  LK
Sbjct: 446 QDVFRKTVQREGLPGLYKGLVPTLAKVCPAVAISYLCYENLK 487

 Score = 37.0 bits (84), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 36/82 (43%), Gaps = 1/82 (1%)

Query: 12  INLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALY 71
           + L  G  +G   A   +P++ ++ R+Q          R  GF    R    +EG   LY
Sbjct: 404 VVLPMGAFSGTVGATVVYPINLLRTRLQAQG-TYAHPHRYDGFQDVFRKTVQREGLPGLY 462

Query: 72  KGLGAVVIGIIPKMAIRFTSYE 93
           KGL   +  + P +AI +  YE
Sbjct: 463 KGLVPTLAKVCPAVAISYLCYE 484

 Score = 32.3 bits (72), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 24/42 (57%)

Query: 288 LIREEGFRALYKGITPRVMRVAPGQAVTFTVYELIRKKLEGL 329
           L R+ G RA Y G    V++V P  A+ F  +EL ++ L GL
Sbjct: 243 LYRQGGLRAFYLGNGLNVIKVFPESAMKFGSFELAKRVLAGL 284

>Kwal_23.2913
          Length = 320

 Score = 75.1 bits (183), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 76/333 (22%), Positives = 126/333 (37%), Gaps = 71/333 (21%)

Query: 13  NLVAGGTAGLFEALCCHPLDTIKVRMQ---------IYSRAREQGQRARGFIGTARDIST 63
           +L AGG  G+   L  HP D +KVR Q           SR   + +   G +     ++ 
Sbjct: 31  SLAAGGVGGVCAVLTGHPFDLLKVRCQSNQASGTLDAISRVLHEAKSKSGPL----PLNQ 86

Query: 64  QEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLL------------ADRQTGVVSTGN 111
            +GF   Y+G+   ++G+ P  A+ F  Y+  + L+            +  +   ++T  
Sbjct: 87  IKGF---YRGVIPPLLGVTPIFAVSFWGYDVGKRLVTWGSNPVTDIAGSSSKLTPLTTSQ 143

Query: 112 TFVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXE 171
             +AG  + I    ++  P E VK+ LQ                                
Sbjct: 144 LALAGFFSAI-PTTLITAPTERVKVVLQ-------------------------------- 170

Query: 172 NVAATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYH 231
               T +  + + AA  +++E G R+L++G   T AR        F  Y   K  L    
Sbjct: 171 ----TSESGSFLGAARTLIREGGVRSLFQGTLATLARDGPGSALYFASYEVSKRFLSRNQ 226

Query: 232 QTDMLPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIRE 291
            TD L      + G ++G        P+DTIKT+LQ    +        ++   R++   
Sbjct: 227 DTDALSVVSICVAGGVAGMSMWIGVFPIDTIKTKLQSSSRSQS------MVQAAREIYTR 280

Query: 292 EGFRALYKGITPRVMRVAPGQAVTFTVYELIRK 324
            G R  + G+ P +MR  P  A TF   E   +
Sbjct: 281 AGLRGFFPGLGPALMRSFPANAATFLGVEFTHQ 313

 Score = 47.8 bits (112), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 41/85 (48%), Gaps = 7/85 (8%)

Query: 15  VAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYKGL 74
           VAGG AG+   +   P+DTIK ++Q  SR++   Q        AR+I T+ G    + GL
Sbjct: 238 VAGGVAGMSMWIGVFPIDTIKTKLQSSSRSQSMVQ-------AAREIYTRAGLRGFFPGL 290

Query: 75  GAVVIGIIPKMAIRFTSYEFFRTLL 99
           G  ++   P  A  F   EF   L 
Sbjct: 291 GPALMRSFPANAATFLGVEFTHQLF 315

 Score = 43.9 bits (102), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 29/92 (31%), Positives = 43/92 (46%), Gaps = 7/92 (7%)

Query: 236 LPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFR 295
           L + + +L G  S        AP + +K  LQ  +S S        L   R LIRE G R
Sbjct: 139 LTTSQLALAGFFSAIPTTLITAPTERVKVVLQTSESGS-------FLGAARTLIREGGVR 191

Query: 296 ALYKGITPRVMRVAPGQAVTFTVYELIRKKLE 327
           +L++G    + R  PG A+ F  YE+ ++ L 
Sbjct: 192 SLFQGTLATLARDGPGSALYFASYEVSKRFLS 223

 Score = 37.0 bits (84), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 26/109 (23%), Positives = 54/109 (49%), Gaps = 10/109 (9%)

Query: 223 LKSRLQEYHQTDML-PSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRI 281
           L +++++   +  L  S+E+   G + G     +  P D +K R Q ++++      SR+
Sbjct: 12  LNAKIEQASNSHTLRDSFESLAAGGVGGVCAVLTGHPFDLLKVRCQSNQASGTLDAISRV 71

Query: 282 LAIGRQ------LIREEGFRALYKGITPRVMRVAPGQAVTFTVYELIRK 324
           L   +       L + +GF   Y+G+ P ++ V P  AV+F  Y++ ++
Sbjct: 72  LHEAKSKSGPLPLNQIKGF---YRGVIPPLLGVTPIFAVSFWGYDVGKR 117

>Sklu_2433.8 YFR045W, Contig c2433 11995-13257 reverse complement
          Length = 420

 Score = 75.9 bits (185), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 76/328 (23%), Positives = 129/328 (39%), Gaps = 36/328 (10%)

Query: 14  LVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYKG 73
           +VAG  A +F+    +P + +K  +Q++             +  A   +    F   + G
Sbjct: 98  IVAGSCASVFQTTISYPFEFLKTGLQLHRS-----------LPNAHPFNMMHQFKYYFSG 146

Query: 74  LGAVVIGIIPKMAIRFTSYEFFRTLLAD--RQTGVVSTGNTFVAGVGAGITEAVMVVNPM 131
             A+ +G + K   RFT++E    LL D    +  +S     +AG   G  E++ VV P 
Sbjct: 147 CAALNVGTLFKTVTRFTTFEKACQLLKDPSSPSAFISGPRLLMAGAITGFMESLWVV-PF 205

Query: 132 EVVKIRLQAQHV----RYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYR------- 180
           E +K  +    +    R+   + +  G                +    +P+ R       
Sbjct: 206 ENIKTTMVENALVLSGRFQK-EIEDKGKAETGSKREVRATFHKQTPGISPRERLFLHYEE 264

Query: 181 NAIQAAYVIVKE----EGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDML 236
           +     +  VKE     G R   +G + T  RQ  N    FT Y++LK  +        L
Sbjct: 265 HPTSRFFSTVKEIYLTRGLRGFVQGTAPTIFRQMGNSAVRFTTYTSLKQLISP---NKPL 321

Query: 237 PSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRA 296
             +   ++G IS         P+D IKTR+Q   S    + +   L    ++  EEG   
Sbjct: 322 NEYYAFVLGFISSCAVVAVTQPIDVIKTRMQ---SKYAWANYKNSLNCAYRIFVEEGIPK 378

Query: 297 LYKGITPRVMRVAPGQAVTFTVYELIRK 324
            +KG  PR+M+V     V+F VY+ +  
Sbjct: 379 FWKGWAPRLMKVGLSGGVSFGVYQYVEN 406

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 35/175 (20%), Positives = 70/175 (40%), Gaps = 35/175 (20%)

Query: 54  FIGTARDISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNTF 113
           F  T ++I    G     +G    +   +   A+RFT+Y   + L++  +   ++    F
Sbjct: 270 FFSTVKEIYLTRGLRGFVQGTAPTIFRQMGNSAVRFTTYTSLKQLISPNKP--LNEYYAF 327

Query: 114 VAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENV 173
           V G  +     V V  P++V+K R+Q+++                               
Sbjct: 328 VLGFISSCA-VVAVTQPIDVIKTRMQSKY------------------------------- 355

Query: 174 AATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQ 228
            A   Y+N++  AY I  EEG    ++G +    +   + G +F VY  +++ ++
Sbjct: 356 -AWANYKNSLNCAYRIFVEEGIPKFWKGWAPRLMKVGLSGGVSFGVYQYVENLIK 409

>Sklu_2127.5 YOR130C, Contig c2127 7354-8190 reverse complement
          Length = 278

 Score = 74.3 bits (181), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 77/316 (24%), Positives = 128/316 (40%), Gaps = 51/316 (16%)

Query: 11  AINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDIS---TQEGF 67
           A +++ G  AG    +  +P DT+KVR+Q         Q A  F  T   I      EG 
Sbjct: 7   AKDILYGSIAGAVGKVIEYPFDTVKVRLQT--------QPAHMFPTTWSCIKFTYDNEGL 58

Query: 68  L-ALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNTFVAGVGAGITEAVM 126
               Y+G+G+ + G   + A+ F S+   + LL D ++ +     T  AG  AG   A  
Sbjct: 59  WRGFYQGIGSPLAGAALENAVLFVSFNQAKRLL-DVESLLSPLSKTVWAGAFAGAC-ASF 116

Query: 127 VVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAA 186
           V+ P+E++K +LQ  ++                            +    P  ++     
Sbjct: 117 VLTPVELIKCKLQVSNLS----------------------TTKTSHTKILPTIKS----- 149

Query: 187 YVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPSWETSLIGL 246
             ++ E G   L++G S T  R++    A FT Y  +K+ L    Q +   +WE    G 
Sbjct: 150 --VLSERGFLGLWQGQSGTFIRESGGGAAWFTTYEVVKNYLASRRQAEQNTTWELLASGA 207

Query: 247 ISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITPRVM 306
            +G     S  P DTIK+ +Q D           + +  R++   +G    Y+G+   ++
Sbjct: 208 SAGLAFNASIFPADTIKSTMQTDH--------IDLSSATRKIYARQGIAGFYRGLGITLI 259

Query: 307 RVAPGQAVTFTVYELI 322
           R  P  A  F  YE +
Sbjct: 260 RAVPANAAIFYTYETL 275

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 34/131 (25%), Positives = 62/131 (47%), Gaps = 2/131 (1%)

Query: 196 RALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPSWETSLIGLISGALGPFS 255
           R  Y+G+    A  A      F  ++  K  L    ++ + P  +T   G  +GA   F 
Sbjct: 60  RGFYQGIGSPLAGAALENAVLFVSFNQAKRLLDV--ESLLSPLSKTVWAGAFAGACASFV 117

Query: 256 NAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITPRVMRVAPGQAVT 315
             P++ IK +LQ    ++  +  ++IL   + ++ E GF  L++G +   +R + G A  
Sbjct: 118 LTPVELIKCKLQVSNLSTTKTSHTKILPTIKSVLSERGFLGLWQGQSGTFIRESGGGAAW 177

Query: 316 FTVYELIRKKL 326
           FT YE+++  L
Sbjct: 178 FTTYEVVKNYL 188

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 40/86 (46%), Gaps = 5/86 (5%)

Query: 243 LIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEG-FRALYKGI 301
           L G I+GA+G     P DT+K RLQ   +    + WS I    +     EG +R  Y+GI
Sbjct: 11  LYGSIAGAVGKVIEYPFDTVKVRLQTQPAHMFPTTWSCI----KFTYDNEGLWRGFYQGI 66

Query: 302 TPRVMRVAPGQAVTFTVYELIRKKLE 327
              +   A   AV F  +   ++ L+
Sbjct: 67  GSPLAGAALENAVLFVSFNQAKRLLD 92

>CAGL0F08305g complement(827705..828829) similar to sp|P53320
           Saccharomyces cerevisiae YGR257c, start by similarity
          Length = 374

 Score = 74.7 bits (182), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 71/296 (23%), Positives = 119/296 (40%), Gaps = 48/296 (16%)

Query: 47  QGQRARGFIGTARDISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQ--T 104
           + Q+  G +     I+  EG   L++G+   ++  IP   + FT YE+ R    DR    
Sbjct: 106 RNQKFNGTLEAFEKIAKFEGVTTLWRGISITLLMAIPANVVYFTGYEYVR----DRSPLN 161

Query: 105 GVVSTGNTFVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXX 164
           G+  T N  + G  A  T A   V P+E++K +LQ+     +P  +   GSV        
Sbjct: 162 GLYPTINPLICGAFAR-TLAATSVAPLELIKTKLQS-----IPSSSMKNGSVIM------ 209

Query: 165 XXXXXXENVAATPKYRNAIQAAYVIVKEEG-PRALYRGVSLTAARQATNQGANFTVYSTL 223
                         YR+        +   G  + +++G+ +T  R        +  Y   
Sbjct: 210 --------------YRDLFNEIKSEIAMRGVAQTMFKGLEITLWRDVPFSAIYWASYEFY 255

Query: 224 KSRLQ-------EYHQTDMLPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDS 276
           K+++        + + ++      + L G ISG+L      P D  KTR Q    T K  
Sbjct: 256 KTKVAYLSPSTFDKNSSNWFHFTNSFLGGFISGSLAAICTHPFDVGKTRQQISLVTDKKL 315

Query: 277 GWSRI--------LAIGRQLIREEGFRALYKGITPRVMRVAPGQAVTFTVYELIRK 324
             S +              + + EG  ALY G+ PRV ++AP  A+  + YEL ++
Sbjct: 316 ANSNLKYGSSNTMFGFLNYIRKTEGIGALYTGLAPRVAKIAPSCAIMISSYELTKR 371

 Score = 48.1 bits (113), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 60/251 (23%), Positives = 98/251 (39%), Gaps = 42/251 (16%)

Query: 115 AGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLA-------------GSVXXXXX 161
           A VG+ +T  ++   PM+VV+IRLQ Q +      A ++             G V     
Sbjct: 18  ATVGSLLTSVILT--PMDVVRIRLQQQQMLADCGCADISELDDSKVRKRISEGGVRRNTL 75

Query: 162 XXXXXXXXXENVAATPK-----------------YRNAIQAAYVIVKEEGPRALYRGVSL 204
                      +   PK                 +   ++A   I K EG   L+RG+S+
Sbjct: 76  EQLRQSKVVNRIDTVPKIFWESTCFQNLNCRNQKFNGTLEAFEKIAKFEGVTTLWRGISI 135

Query: 205 TAARQATNQGANFTVYSTLKSRLQEYHQTDMLPSWETSLIGLISGALGPFSNAPLDTIKT 264
           T           FT Y  ++ R        + P+    + G  +  L   S APL+ IKT
Sbjct: 136 TLLMAIPANVVYFTGYEYVRDR---SPLNGLYPTINPLICGAFARTLAATSVAPLELIKT 192

Query: 265 RLQKDKSTSKDSGWSRIL--AIGRQLIREEGFR----ALYKGITPRVMRVAPGQAVTFTV 318
           +LQ   S+S  +G S I+   +  ++  E   R     ++KG+   + R  P  A+ +  
Sbjct: 193 KLQSIPSSSMKNG-SVIMYRDLFNEIKSEIAMRGVAQTMFKGLEITLWRDVPFSAIYWAS 251

Query: 319 YELIRKKLEGL 329
           YE  + K+  L
Sbjct: 252 YEFYKTKVAYL 262

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/104 (30%), Positives = 42/104 (40%), Gaps = 7/104 (6%)

Query: 3   NRKNSSHPAINLVAGGTAGLFEALCCHPLDTIKVRMQI-------YSRAREQGQRARGFI 55
           N  N  H   + + G  +G   A+C HP D  K R QI        + +  +   +    
Sbjct: 270 NSSNWFHFTNSFLGGFISGSLAAICTHPFDVGKTRQQISLVTDKKLANSNLKYGSSNTMF 329

Query: 56  GTARDISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLL 99
           G    I   EG  ALY GL   V  I P  AI  +SYE  + L 
Sbjct: 330 GFLNYIRKTEGIGALYTGLAPRVAKIAPSCAIMISSYELTKRLF 373

>KLLA0F04697g complement(461126..462049) similar to sp|P40464
           Saccharomyces cerevisiae YIL134w FLX1 FAD carrier
           protein (MCF), mitochondrial, start by similarity
          Length = 307

 Score = 73.9 bits (180), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 80/328 (24%), Positives = 131/328 (39%), Gaps = 63/328 (19%)

Query: 14  LVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDIS-TQEGFLALYK 72
           +++G TAG    +  HPLD IK+R+Q+ +   +            +D S TQ+     Y+
Sbjct: 16  IISGLTAGTITTIVTHPLDLIKLRLQLAAIDLKPSSYYNQVQRIIKDGSGTQQLLKEAYR 75

Query: 73  GLGAVVIGIIPKMAIRFTSYEFFRT--------------LLADRQTGVVSTGNTFVAGVG 118
           GLG  +IG      + F  Y   +                + DR+     T + ++   G
Sbjct: 76  GLGINIIGNAVAWGLYFGLYRCSKDVVYSLSSEPALQNKFMNDRKM----TSSMYLVSAG 131

Query: 119 AGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPK 178
           A      ++ NPM V+K R+ +                                  ++  
Sbjct: 132 ASGLATALLTNPMWVIKTRIMS--------------------------------TKSSQG 159

Query: 179 YRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGA-NFTVYSTLKSRLQEYH-----Q 232
           Y + + A   I  EEG +  +RG  L  +     QGA  F +Y TLK  L+  H     Q
Sbjct: 160 YTSILNAITRIYTEEGLKTFWRG--LVPSLFGVTQGALYFAIYDTLK--LKYLHDRNDIQ 215

Query: 233 TDMLPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREE 292
              L + ET  I  +S  +   S  PL  +KT LQ  ++   ++  S++ ++ R +    
Sbjct: 216 ERRLNAVETIGIISLSKMISVSSVYPLQLLKTNLQTFRTEHNEN--SKMNSLIRSIWHTN 273

Query: 293 GFRALYKGITPRVMRVAPGQAVTFTVYE 320
           G    YKG+   ++R  P   +TF VYE
Sbjct: 274 GIAGFYKGLFANLVRAIPSTCITFGVYE 301

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 29/68 (42%), Gaps = 3/68 (4%)

Query: 29  HPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYKGLGAVVIGIIPKMAIR 88
           +PL  +K  +Q +     +  +    I   R I    G    YKGL A ++  IP   I 
Sbjct: 240 YPLQLLKTNLQTFRTEHNENSKMNSLI---RSIWHTNGIAGFYKGLFANLVRAIPSTCIT 296

Query: 89  FTSYEFFR 96
           F  YE F+
Sbjct: 297 FGVYEHFK 304

>Scas_687.15*
          Length = 328

 Score = 74.3 bits (181), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 73/327 (22%), Positives = 138/327 (42%), Gaps = 36/327 (11%)

Query: 12  INLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALY 71
           I ++AG  A +FE    +P + +K   Q++ R           +G A+           +
Sbjct: 10  IQILAGSAAAVFETTLTYPFEFLKTGFQLHRRT----------VG-AKPFEALRPIKVYF 58

Query: 72  KGLGAVVIGIIPKMAIRFTSYEFFRTLLADR---QTGVVSTGNTFVAGVGAGITEAVMVV 128
            G  A+ +  I K ++RF +++    +L D    +  ++      +AG+  G  E++ ++
Sbjct: 59  AGCTALNLSAIVKTSVRFATFDKACQILRDPNLPKDSLLKGPRLLLAGILTGAVESLCII 118

Query: 129 NPMEVVKIRL---QAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQA 185
            P E VK+ +     Q     P + ++AG++              + ++   ++R     
Sbjct: 119 -PFENVKVTMIENSLQLSESKPTEKEIAGTLKKKVTFHVAKP---KQLSPQEQWRQVYSK 174

Query: 186 -----AYVIVKE----EGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDML 236
                 + +VKE     G R   +G   T  RQ +N    FT Y+TLK  +      + +
Sbjct: 175 YPSSNIFSVVKEIYLTRGLRGFAQGAMPTVFRQVSNSTVRFTAYTTLKQLISPTQPLNEV 234

Query: 237 PSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRA 296
            ++    IGL S         P+D +KTR+Q   S +    +   L    ++  EEG  +
Sbjct: 235 YAFG---IGLFSSCAVVALTQPIDVVKTRMQ---SKTAHYFYKNSLNCAYRVFVEEGMVS 288

Query: 297 LYKGITPRVMRVAPGQAVTFTVYELIR 323
           L+KG  PR+ +V     ++F VY+ + 
Sbjct: 289 LWKGWLPRLFKVGLSGGISFGVYQYVE 315

>Kwal_27.12081
          Length = 369

 Score = 74.3 bits (181), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 79/348 (22%), Positives = 148/348 (42%), Gaps = 64/348 (18%)

Query: 10  PAINLVAGGTAGLFEALCCHPLDTIKVRMQ------IY--------SRAREQGQRA-RGF 54
           P ++ VAGG  G+  A+   P D +K R+Q       Y        S     G R  R  
Sbjct: 52  PWVHFVAGGAGGMAGAIVTCPFDVVKTRLQSDVFQSTYANLSHNKSSNVVSSGIRHFRET 111

Query: 55  IGTARDISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADR-QTGVVSTGNTF 113
            G   ++   EGF +L+KGLG  ++G+IP  +I F +Y   + + +     G  +     
Sbjct: 112 FGIISNLYKLEGFRSLFKGLGPNLVGVIPARSINFFTYGTTKQIYSRAFNNGEEAPWIHL 171

Query: 114 VAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENV 173
           ++   AG   +    NP+ ++K RLQ                               +  
Sbjct: 172 ISAATAGWATST-ATNPIWLIKTRLQ------------------------------LDKA 200

Query: 174 AATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGA-NFTVYSTLKSRLQ---- 228
             T +Y+N+      I+++EG   LY+G  L+A+   + +G   + +Y  +K  ++    
Sbjct: 201 GHTRQYKNSWDCLKHIIQKEGFFGLYKG--LSASYLGSVEGILQWLLYEQMKQMIKMRSI 258

Query: 229 ---------EYHQTDMLPSW-ETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGW 278
                    E + ++ +  W + S    ++  L      P + ++TRL++    +    +
Sbjct: 259 EKFGHISEGEKNTSEKIKEWCQRSGSAGLAKFLASIVTYPHEVVRTRLRQAPLENDKLKY 318

Query: 279 SRILAIGRQLIREEGFRALYKGITPRVMRVAPGQAVTFTVYELIRKKL 326
           + ++   R +I+EEG  ++Y G+TP ++R  P   + F  +EL+ K L
Sbjct: 319 TGLIQSFRVIIKEEGLASMYGGLTPHLLRTVPNSIIMFGTWELVIKLL 366

 Score = 45.1 bits (105), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 50/211 (23%), Positives = 85/211 (40%), Gaps = 33/211 (15%)

Query: 126 MVVNPMEVVKIRLQAQ--HVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAI 183
           +V  P +VVK RLQ+      Y  L    + +V                 +    +R   
Sbjct: 68  IVTCPFDVVKTRLQSDVFQSTYANLSHNKSSNVVS---------------SGIRHFRETF 112

Query: 184 QAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPSWETSL 243
                + K EG R+L++G+          +  NF  Y T K              W    
Sbjct: 113 GIISNLYKLEGFRSLFKGLGPNLVGVIPARSINFFTYGTTKQIYSRAFNNGEEAPW---- 168

Query: 244 IGLISGALGPFSNA----PLDTIKTRLQKDK---STSKDSGWSRILAIGRQLIREEGFRA 296
           I LIS A   ++ +    P+  IKTRLQ DK   +    + W  +    + +I++EGF  
Sbjct: 169 IHLISAATAGWATSTATNPIWLIKTRLQLDKAGHTRQYKNSWDCL----KHIIQKEGFFG 224

Query: 297 LYKGITPRVMRVAPGQAVTFTVYELIRKKLE 327
           LYKG++   +    G  + + +YE +++ ++
Sbjct: 225 LYKGLSASYLGSVEG-ILQWLLYEQMKQMIK 254

 Score = 36.6 bits (83), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 20/86 (23%), Positives = 41/86 (47%), Gaps = 1/86 (1%)

Query: 16  AGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYKGLG 75
           + G A    ++  +P + ++ R++  +       +  G I + R I  +EG  ++Y GL 
Sbjct: 284 SAGLAKFLASIVTYPHEVVRTRLR-QAPLENDKLKYTGLIQSFRVIIKEEGLASMYGGLT 342

Query: 76  AVVIGIIPKMAIRFTSYEFFRTLLAD 101
             ++  +P   I F ++E    LL+D
Sbjct: 343 PHLLRTVPNSIIMFGTWELVIKLLSD 368

>KLLA0A00979g complement(92561..93592) weakly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, mitochondrial (MCF), start by similarity
          Length = 343

 Score = 73.9 bits (180), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 84/352 (23%), Positives = 137/352 (38%), Gaps = 61/352 (17%)

Query: 6   NSSHPAI--NLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDIST 63
           + ++P++  NL+AG  A +F+    HP + +K            GQ+    +  A   + 
Sbjct: 2   SDTNPSLYSNLLAGSAAAVFQTTLSHPFEFLKT-----------GQQLHRSLPNAEAFNM 50

Query: 64  QEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQT--GVVSTGNTFVAGVGAGI 121
                + + G  A+ IGI+ K A RF +++    LL D +     VS      AG   G 
Sbjct: 51  FHHVKSYFAGCSALNIGILLKTATRFATFDKACQLLKDPENPEAPVSGLRLIAAGSITGF 110

Query: 122 TEAVMVVNPMEVVKIRL-----------------------QAQHVRYVPLKAQ----LAG 154
            E+++++ P E +K R+                       +++ V  +  K Q    L  
Sbjct: 111 MESMLII-PFENIKTRMIENALILSNRYQEEVETGGKDKPRSKSVNNMETKEQIRPKLYK 169

Query: 155 SVXXXXXXXXXXXXXXENVAATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQG 214
            V              E   +T    N       +V+  G    ++G   T  RQ  N  
Sbjct: 170 QVKKEINPRYEKFLYYEKHPST----NIFTTVREMVQTRGFTTFFQGSMPTIFRQVGNSA 225

Query: 215 ANFTVYSTLKSRLQEYHQTDMLPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSK 274
             FT Y+TLK   Q       L  +    IG+ S         P+D +KTR+Q   +   
Sbjct: 226 VRFTTYTTLK---QMISPNKPLSEYYAFGIGVFSSCAVVALTQPIDVVKTRMQSKYT--- 279

Query: 275 DSGWS----RILAIGRQLIREEGFRALYKGITPRVMRVAPGQAVTFTVYELI 322
              WS     +  + R  I EEG  +L+KG  PR+ +V     V+F VY+ +
Sbjct: 280 ---WSLYRNSLNCVYRTFI-EEGLTSLWKGWVPRLFKVGLSGGVSFGVYQYV 327

 Score = 31.2 bits (69), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 12/48 (25%), Positives = 24/48 (50%)

Query: 279 SRILAIGRQLIREEGFRALYKGITPRVMRVAPGQAVTFTVYELIRKKL 326
           + I    R++++  GF   ++G  P + R     AV FT Y  +++ +
Sbjct: 191 TNIFTTVREMVQTRGFTTFFQGSMPTIFRQVGNSAVRFTTYTTLKQMI 238

>Kwal_55.21335
          Length = 317

 Score = 73.2 bits (178), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 80/314 (25%), Positives = 128/314 (40%), Gaps = 51/314 (16%)

Query: 13  NLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDIS---TQEGFL- 68
           +++ G  AG    +  +PLDTIKVR+Q         Q A  F  +   I     +EGF+ 
Sbjct: 48  DILYGSIAGAAGKVIEYPLDTIKVRLQT--------QPAHVFPTSWSCIKYTYQKEGFVK 99

Query: 69  ALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNTFVAGVGAGITEAVMVV 128
             Y+G+ + ++G   + A+ F ++   +  L   ++ V     T ++G  AG   +  V+
Sbjct: 100 GFYQGVASPLVGAALENAVLFVTFNRAQNFLQQYES-VSPLSQTVLSGAFAGACTS-YVL 157

Query: 129 NPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAAYV 188
            P+E++K  LQ  ++                               AT ++         
Sbjct: 158 TPVELIKCTLQVSNLE-----------------------------GATTRHSKIWPTVKH 188

Query: 189 IVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPSWETSLIGLIS 248
           IV+ +G   L++G S T  R+       FT Y +LKS L          +WE    G  +
Sbjct: 189 IVQHKGIGGLWQGQSSTFIRECAGGAVWFTTYESLKSYLARRRNDTENHTWELLASGASA 248

Query: 249 GALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITPRVMRV 308
           G     S  P DTIK+  Q       D+   RILA         G   LY+G+   ++R 
Sbjct: 249 GVAFNASIFPADTIKSTAQTQHLGIVDAT-KRILA-------RSGPAGLYRGLGITLIRA 300

Query: 309 APGQAVTFTVYELI 322
           AP  A+ F  YE +
Sbjct: 301 APANAIVFYTYETL 314

 Score = 53.5 bits (127), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 52/246 (21%), Positives = 90/246 (36%), Gaps = 39/246 (15%)

Query: 81  IIPKMAIRFTSYEFFRTLLADRQTGVVSTGNTFVAGVGAGITEAVMVVNPMEVVKIRLQA 140
           I+ ++  R   Y  FR  + D +  +       +AG    + E      P++ +K+RLQ 
Sbjct: 21  IVSQLIARSHRYGPFRVGIMDFKDALKDILYGSIAGAAGKVIE-----YPLDTIKVRLQT 75

Query: 141 QHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAAYVIVKEEGPRALYR 200
           Q     P                                       Y   KE   +  Y+
Sbjct: 76  QPAHVFPTSWSCI--------------------------------KYTYQKEGFVKGFYQ 103

Query: 201 GVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPSWETSLIGLISGALGPFSNAPLD 260
           GV+      A      F  ++  ++ LQ+Y     L   +T L G  +GA   +   P++
Sbjct: 104 GVASPLVGAALENAVLFVTFNRAQNFLQQYESVSPLS--QTVLSGAFAGACTSYVLTPVE 161

Query: 261 TIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITPRVMRVAPGQAVTFTVYE 320
            IK  LQ        +  S+I    + +++ +G   L++G +   +R   G AV FT YE
Sbjct: 162 LIKCTLQVSNLEGATTRHSKIWPTVKHIVQHKGIGGLWQGQSSTFIRECAGGAVWFTTYE 221

Query: 321 LIRKKL 326
            ++  L
Sbjct: 222 SLKSYL 227

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 47/213 (22%), Positives = 77/213 (36%), Gaps = 40/213 (18%)

Query: 14  LVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYKG 73
           +++G  AG   +    P++ IK  +Q+ S       R      T + I   +G   L++G
Sbjct: 143 VLSGAFAGACTSYVLTPVELIKCTLQV-SNLEGATTRHSKIWPTVKHIVQHKGIGGLWQG 201

Query: 74  LGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVS-TGNTFVAGVGAGITEAVMVVNPME 132
             +  I      A+ FT+YE  ++ LA R+    + T     +G  AG+     +  P +
Sbjct: 202 QSSTFIRECAGGAVWFTTYESLKSYLARRRNDTENHTWELLASGASAGVAFNASIF-PAD 260

Query: 133 VVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAAYVIVKE 192
            +K   Q QH+                                       + A   I+  
Sbjct: 261 TIKSTAQTQHL-------------------------------------GIVDATKRILAR 283

Query: 193 EGPRALYRGVSLTAARQATNQGANFTVYSTLKS 225
            GP  LYRG+ +T  R A      F  Y TL +
Sbjct: 284 SGPAGLYRGLGITLIRAAPANAIVFYTYETLSN 316

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 42/86 (48%), Gaps = 5/86 (5%)

Query: 243 LIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGF-RALYKGI 301
           L G I+GA G     PLDTIK RLQ   +    + WS I    +   ++EGF +  Y+G+
Sbjct: 50  LYGSIAGAAGKVIEYPLDTIKVRLQTQPAHVFPTSWSCI----KYTYQKEGFVKGFYQGV 105

Query: 302 TPRVMRVAPGQAVTFTVYELIRKKLE 327
              ++  A   AV F  +   +  L+
Sbjct: 106 ASPLVGAALENAVLFVTFNRAQNFLQ 131

 Score = 36.6 bits (83), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 43/100 (43%), Gaps = 11/100 (11%)

Query: 1   MSNRKNSS--HPAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTA 58
           ++ R+N +  H    L +G +AG+       P DTIK   Q          +  G +   
Sbjct: 227 LARRRNDTENHTWELLASGASAGVAFNASIFPADTIKSTAQT---------QHLGIVDAT 277

Query: 59  RDISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTL 98
           + I  + G   LY+GLG  +I   P  AI F +YE    L
Sbjct: 278 KRILARSGPAGLYRGLGITLIRAAPANAIVFYTYETLSNL 317

>YKL120W (OAC1) [3145] chr11 (216990..217964) Mitochondrial
           oxaloacetate transporter, member of the mitochondrial
           carrier (MCF) family of membrane transporters [975 bp,
           324 aa]
          Length = 324

 Score = 73.2 bits (178), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 63/237 (26%), Positives = 98/237 (41%), Gaps = 54/237 (22%)

Query: 107 VSTGNTFVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXX 166
           +S   +FVAG G     AV V NP+E++KIR+Q        L+ +++ S           
Sbjct: 20  ISKFGSFVAG-GLAACIAVTVTNPIELIKIRMQ--------LQGEMSAS----------- 59

Query: 167 XXXXENVAATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSR 226
                   A   Y+N IQ   VI K EG + L +G++     Q    G+    Y  ++S 
Sbjct: 60  --------AAKVYKNPIQGMAVIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSS 111

Query: 227 LQEYHQTDMLPSWETSL-----IGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRI 281
           L +    D  P    S+      G  SG +G    +PL  +KTRLQ          +S  
Sbjct: 112 LNQLFFPDQEPHKVQSVGVNVFSGAASGIIGAVIGSPLFLVKTRLQS---------YSEF 162

Query: 282 LAIGRQ------------LIREEGFRALYKGITPRVMRVAPGQAVTFTVYELIRKKL 326
           + IG Q            + + EG + L++GI   ++R   G +V   +Y   +  L
Sbjct: 163 IKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNIL 219

 Score = 68.2 bits (165), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 79/315 (25%), Positives = 118/315 (37%), Gaps = 39/315 (12%)

Query: 13  NLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRA-RGFIGTARDISTQEGFLALY 71
           + VAGG A        +P++ IK+RMQ+         +  +  I     I   EG   L 
Sbjct: 25  SFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQ 84

Query: 72  KGLGAVVIGIIPKMAIRFTSYEFFRT-----LLADRQTGVV-STGNTFVAGVGAGITEAV 125
           KGL A  I  I     R   YE  R+        D++   V S G    +G  +GI  AV
Sbjct: 85  KGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFSGAASGIIGAV 144

Query: 126 MVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQA 185
            + +P+ +VK RLQ+ +  ++ +  Q                           Y      
Sbjct: 145 -IGSPLFLVKTRLQS-YSEFIKIGEQ-------------------------THYTGVWNG 177

Query: 186 AYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPSWETSLIG 245
              I K EG + L+RG+     R          +Y+T K+ L +       P+   +   
Sbjct: 178 LVTIFKTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNILVKNDLMKDGPALHLTA-S 236

Query: 246 LISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITPRV 305
            ISG        P D I TR+   K          ++    + +R EG  ALYKG   +V
Sbjct: 237 TISGLGVAVVMNPWDVILTRIYNQKGDLYKGPIDCLV----KTVRIEGVTALYKGFAAQV 292

Query: 306 MRVAPGQAVTFTVYE 320
            R+AP   +  T  E
Sbjct: 293 FRIAPHTIMCLTFME 307

 Score = 37.0 bits (84), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 39/84 (46%), Gaps = 5/84 (5%)

Query: 10  PAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLA 69
           PA++L A   +GL  A+  +P D I  R  IY+   ++G   +G I         EG  A
Sbjct: 229 PALHLTASTISGLGVAVVMNPWDVILTR--IYN---QKGDLYKGPIDCLVKTVRIEGVTA 283

Query: 70  LYKGLGAVVIGIIPKMAIRFTSYE 93
           LYKG  A V  I P   +  T  E
Sbjct: 284 LYKGFAAQVFRIAPHTIMCLTFME 307

 Score = 37.0 bits (84), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 31/132 (23%), Positives = 58/132 (43%), Gaps = 3/132 (2%)

Query: 12  INLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRAR--GFIGTARDISTQEGFLA 69
           +N+ +G  +G+  A+   PL  +K R+Q YS   + G++    G       I   EG   
Sbjct: 130 VNVFSGAASGIIGAVIGSPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKG 189

Query: 70  LYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNTFVAGVGAGITEAVMVVN 129
           L++G+ A ++      +++   Y   + +L               A   +G+  AV V+N
Sbjct: 190 LFRGIDAAILRTGAGSSVQLPIYNTAKNILVKNDLMKDGPALHLTASTISGLGVAV-VMN 248

Query: 130 PMEVVKIRLQAQ 141
           P +V+  R+  Q
Sbjct: 249 PWDVILTRIYNQ 260

>KLLA0A09383g complement(818752..819852) similar to sp|P53320
           Saccharomyces cerevisiae YGR257c, start by similarity
          Length = 366

 Score = 73.2 bits (178), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 67/284 (23%), Positives = 119/284 (41%), Gaps = 48/284 (16%)

Query: 61  ISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNTFVAGVGAG 120
           IS  EG   L++GL   ++  IP   + F+ YE FR     R +    + N    G  A 
Sbjct: 107 ISEVEGLATLWRGLSITLLMAIPANVVYFSGYEMFRDHSPMRDS--YPSLNPLFCGATAR 164

Query: 121 ITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYR 180
           +  A  V  P+E++K RLQ+     +P                       ++      ++
Sbjct: 165 MVAATTVA-PLELIKTRLQS-----IP--------------------RSRKDTTTQMMFK 198

Query: 181 NAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRL-----QEYHQTDM 235
           + ++     ++  G + L++G+ +T  R        +  Y   K        ++  + ++
Sbjct: 199 DLLKETRNEIRSGGYKVLFKGLEITLWRDVPFSAIYWGSYEFYKKNFWIDFSEQCLRWNL 258

Query: 236 LPSWE---TSLIG-LISGALGPFSNAPLDTIKTRLQ------KDKSTSKDSGWSRILAIG 285
            P+W+    S IG  +SG+       P D  KTR+Q        +  +  S   R+ A G
Sbjct: 259 SPNWDFFINSFIGGSVSGSSAALLTHPFDVGKTRMQITMDIENKQRNTLVSPKKRVSARG 318

Query: 286 R-----QLIREEGFRALYKGITPRVMRVAPGQAVTFTVYELIRK 324
                  + + EG+ ALY G+ PRVM++AP  A+  + YEL ++
Sbjct: 319 MFKFLYNIKQTEGYGALYTGLIPRVMKIAPSCAIMISTYELSKR 362

 Score = 56.2 bits (134), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 60/249 (24%), Positives = 100/249 (40%), Gaps = 30/249 (12%)

Query: 101 DRQTGVVSTGNTFVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVP-----LKAQLAGS 155
           DR +  +       A  G+ +T     + PM+VV+IRLQ Q +  +P       ++L GS
Sbjct: 4   DRSSTAIMKERMLSACAGSFLTS--FFLTPMDVVRIRLQQQVM--LPDCSCGAASELKGS 59

Query: 156 V------XXXXXXXXXXXXXXENVA--------ATPKYRNAIQAAYVIVKEEGPRALYRG 201
           V                    ++V         +  ++ +  +A   I + EG   L+RG
Sbjct: 60  VGTEVIYDHVVANKNSPKIFWQDVCFQDIQCKNSALRFNSTWEAFTKISEVEGLATLWRG 119

Query: 202 VSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPSWETSLIGLISGALGPFSNAPLDT 261
           +S+T           F+ Y   +         D  PS      G  +  +   + APL+ 
Sbjct: 120 LSITLLMAIPANVVYFSGYEMFR---DHSPMRDSYPSLNPLFCGATARMVAATTVAPLEL 176

Query: 262 IKTRLQKDKSTSKDSG----WSRILAIGRQLIREEGFRALYKGITPRVMRVAPGQAVTFT 317
           IKTRLQ    + KD+     +  +L   R  IR  G++ L+KG+   + R  P  A+ + 
Sbjct: 177 IKTRLQSIPRSRKDTTTQMMFKDLLKETRNEIRSGGYKVLFKGLEITLWRDVPFSAIYWG 236

Query: 318 VYELIRKKL 326
            YE  +K  
Sbjct: 237 SYEFYKKNF 245

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 41/147 (27%), Positives = 68/147 (46%), Gaps = 15/147 (10%)

Query: 7   SSHPAIN-LVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGF---IGTARDIS 62
            S+P++N L  G TA +  A    PL+ IK R+Q   R+R+       F   +   R+  
Sbjct: 149 DSYPSLNPLFCGATARMVAATTVAPLELIKTRLQSIPRSRKDTTTQMMFKDLLKETRNEI 208

Query: 63  TQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFF-RTLLADRQTGVVSTG---------NT 112
              G+  L+KGL   +   +P  AI + SYEF+ +    D     +            N+
Sbjct: 209 RSGGYKVLFKGLEITLWRDVPFSAIYWGSYEFYKKNFWIDFSEQCLRWNLSPNWDFFINS 268

Query: 113 FVAGVGAGITEAVMVVNPMEVVKIRLQ 139
           F+ G  +G + A ++ +P +V K R+Q
Sbjct: 269 FIGGSVSG-SSAALLTHPFDVGKTRMQ 294

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 45/99 (45%), Gaps = 12/99 (12%)

Query: 13  NLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQR-----------ARGFIGTARDI 61
           + + G  +G   AL  HP D  K RMQI +   E  QR           ARG      +I
Sbjct: 268 SFIGGSVSGSSAALLTHPFDVGKTRMQI-TMDIENKQRNTLVSPKKRVSARGMFKFLYNI 326

Query: 62  STQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLA 100
              EG+ ALY GL   V+ I P  AI  ++YE  + L A
Sbjct: 327 KQTEGYGALYTGLIPRVMKIAPSCAIMISTYELSKRLFA 365

>Scas_714.18
          Length = 305

 Score = 72.4 bits (176), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 74/319 (23%), Positives = 130/319 (40%), Gaps = 35/319 (10%)

Query: 14  LVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDIS---TQEGFL-A 69
           ++AG  AG       +P DT+KVR+Q         Q A  F  T   I      EG L  
Sbjct: 16  ILAGSIAGAIGKFIEYPFDTVKVRLQT--------QEAYMFPSTWSCIKYTYENEGILEG 67

Query: 70  LYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNTFVAGVGAGI--TEAVMV 127
            Y+G+ + +IG   + AI F +Y    + L              +  + AG   + A  V
Sbjct: 68  FYQGIESPLIGAALENAILFLAYNQCSSFL----NAFTEFSAFLIILISAGFAGSCASFV 123

Query: 128 VNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAAY 187
           + P+E++K +LQ  ++ Y  L                       +    P  ++      
Sbjct: 124 LTPVELIKCKLQISNLHY-SLHDNDGEQQDEEDEDQGMVIGEGRHTRIIPTIKS------ 176

Query: 188 VIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPSWETSLIGLI 247
            I+KE+G   L++G S T  R++      F  Y  +K  L++  ++++  +W+  + G  
Sbjct: 177 -IIKEKGLFGLWQGQSSTFIRESIGSVVWFATYELMKQTLRD-PKSEVNTTWQLLISGAT 234

Query: 248 SGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITPRVMR 307
           +G     S  P DT+K+ +Q +           ++   R ++  +G    Y+G+   ++R
Sbjct: 235 AGLAFNGSVFPADTVKSIMQTEHLA--------LMETVRSILERDGVAGFYRGLGITLLR 286

Query: 308 VAPGQAVTFTVYELIRKKL 326
             P  A  F  YE + K L
Sbjct: 287 AVPSNAAVFYTYEKLSKIL 305

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/153 (24%), Positives = 65/153 (42%), Gaps = 23/153 (15%)

Query: 12  INLVAGGTAGLFEALCCHPLDTIKVRMQI----YSRARE-----------------QGQR 50
           I L++ G AG   +    P++ IK ++QI    YS                     +G+ 
Sbjct: 108 IILISAGFAGSCASFVLTPVELIKCKLQISNLHYSLHDNDGEQQDEEDEDQGMVIGEGRH 167

Query: 51  ARGFIGTARDISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTG 110
            R  I T + I  ++G   L++G  +  I       + F +YE  +  L D ++ V +T 
Sbjct: 168 TR-IIPTIKSIIKEKGLFGLWQGQSSTFIRESIGSVVWFATYELMKQTLRDPKSEVNTTW 226

Query: 111 NTFVAGVGAGITEAVMVVNPMEVVKIRLQAQHV 143
              ++G  AG+     V  P + VK  +Q +H+
Sbjct: 227 QLLISGATAGLAFNGSVF-PADTVKSIMQTEHL 258

>YIL134W (FLX1) [2542] chr9 (97395..98330) Protein involved in
           transport of FAD from cytosol into the mitochondrial
           matrix, member of mitochondrial carrier (MCF) family of
           membrane transporters [936 bp, 311 aa]
          Length = 311

 Score = 72.0 bits (175), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 76/340 (22%), Positives = 140/340 (41%), Gaps = 68/340 (20%)

Query: 14  LVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRA---------RGFIGTARDISTQ 64
           +++G +AG    L  HPLD +KVR+Q+ + + ++             R    + R ++ +
Sbjct: 13  VISGLSAGSVTTLVVHPLDLLKVRLQLSATSAQKAHYGPFMVIKEIIRSSANSGRSVTNE 72

Query: 65  EGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADR-----QTGVVSTGNT------- 112
                LY+GL   + G      + F  Y   + L+        +T +   GN        
Sbjct: 73  -----LYRGLSINLFGNAIAWGVYFGLYGVTKELIYKSVAKPGETQLKGVGNDHKMNSLI 127

Query: 113 -FVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXE 171
              AG  +G+  A++  NP+ V+K R+ +                               
Sbjct: 128 YLSAGASSGLMTAILT-NPIWVIKTRIMS------------------------------T 156

Query: 172 NVAATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGA-NFTVYSTLKSRLQEY 230
           +  A   Y +       +++ +G + L++G  L  A    +QGA  F VY TLK R    
Sbjct: 157 SKGAQGAYTSMYNGVQQLLRTDGFQGLWKG--LVPALFGVSQGALYFAVYDTLKQRKLRR 214

Query: 231 HQTDMLPSWETSLIGLISGALGPFSNA----PLDTIKTRLQKDKSTSKDSGWSRILAIGR 286
            + + L    T+L  +   +LG   +     P   +K+ LQ  ++  +     R+  + +
Sbjct: 215 KRENGLDIHLTNLETIEITSLGKMVSVTLVYPFQLLKSNLQSFRANEQKF---RLFPLIK 271

Query: 287 QLIREEGFRALYKGITPRVMRVAPGQAVTFTVYELIRKKL 326
            +I  +GF  LYKG++  ++R  P   +TF VYE ++ +L
Sbjct: 272 LIIANDGFVGLYKGLSANLVRAIPSTCITFCVYENLKHRL 311

>YDL198C (GGC1) [676] chr4 complement(103650..104552) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses loss of Abf2p
           [903 bp, 300 aa]
          Length = 300

 Score = 71.6 bits (174), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 82/335 (24%), Positives = 133/335 (39%), Gaps = 70/335 (20%)

Query: 14  LVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQ---EGFLAL 70
           L+   +AG+ E    HP+DTI  R+         GQ     I   RD  ++   +    L
Sbjct: 14  LLGSASAGIMEIAVFHPVDTISKRLMSNHTKITSGQELNRVI--FRDHFSEPLGKRLFTL 71

Query: 71  YKGLGAVVIGIIPKMAIRFTSYEF------------FRTLLADRQTGVVSTGNTFVAGVG 118
           + GLG      + +   ++    F            F  L  ++    + +     AG  
Sbjct: 72  FPGLGYAASYKVLQRVYKYGGQPFANEFLNKHYKKDFDNLFGEKTGKAMRSA---AAGSL 128

Query: 119 AGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPK 178
            GI E V++  P++V+KI+ Q     +                                K
Sbjct: 129 IGIGEIVLL--PLDVLKIKRQTNPESF--------------------------------K 154

Query: 179 YRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSR---LQEYHQTDM 235
            R  I+    I+++EG   LYRG   TAAR A    A F   +  K     L++Y Q   
Sbjct: 155 GRGFIK----ILRDEGLFNLYRGWGWTAARNAPGSFALFGGNAFAKEYILGLKDYSQA-- 208

Query: 236 LPSWETSLIGLISGALGPF-SNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGF 294
             +W  + I  I GA      +APLD IKTR+Q     + +SG    L I +  ++ EG 
Sbjct: 209 --TWSQNFISSIVGACSSLIVSAPLDVIKTRIQNRNFDNPESG----LRIVKNTLKNEGV 262

Query: 295 RALYKGITPRVMRVAPGQAVTFTVYELIRKKLEGL 329
            A +KG+TP+++   P    +F + + +  + + L
Sbjct: 263 TAFFKGLTPKLLTTGPKLVFSFALAQSLIPRFDNL 297

>YOR130C (ORT1) [4932] chr15 complement(569929..570807) Ornithine
           transport protein of mitochondria involved in arginine
           metabolism, member of the mitochondrial carrier family
           (MCF) of membrane transporters [879 bp, 292 aa]
          Length = 292

 Score = 71.2 bits (173), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 73/318 (22%), Positives = 133/318 (41%), Gaps = 54/318 (16%)

Query: 12  INLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDIS---TQEGFL 68
           ++++ G  AG    +   P DT+KVR+Q         Q +  F  T   I      EG  
Sbjct: 15  LDIINGSIAGACGKVIEFPFDTVKVRLQT--------QASNVFPTTWSCIKFTYQNEGIA 66

Query: 69  -ALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNTFVAGVGAGITEAVMV 127
              ++G+ + ++G   + A  F SY      L ++ T V   G   ++G  AG + A +V
Sbjct: 67  RGFFQGIASPLVGACLENATLFVSYNQCSKFL-EKHTNVFPLGQILISGGVAG-SCASLV 124

Query: 128 VNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAAY 187
           + P+E+VK +LQ  +++                             +A  K+   +    
Sbjct: 125 LTPVELVKCKLQVANLQVA---------------------------SAKTKHTKVLPTIK 157

Query: 188 VIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPSWETSLIGLI 247
            I+ E G   L++G S T  R++    A F  Y  +K  L++ H  D     E+ +  L+
Sbjct: 158 AIITERGLAGLWQGQSGTFIRESFGGVAWFATYEIVKKSLKDRHSLDDPKRDESKIWELL 217

Query: 248 --SGALGPFSNA---PLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGIT 302
              G+ G   NA   P DT+K+ +Q +  +  ++         +++  + G +  Y+G+ 
Sbjct: 218 ISGGSAGLAFNASIFPADTVKSVMQTEHISLTNAV--------KKIFGKFGLKGFYRGLG 269

Query: 303 PRVMRVAPGQAVTFTVYE 320
             + R  P  A  F ++E
Sbjct: 270 ITLFRAVPANAAVFYIFE 287

 Score = 43.9 bits (102), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 34/154 (22%), Positives = 70/154 (45%), Gaps = 8/154 (5%)

Query: 177 PKYRNAIQAAYVIVKEEG-PRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDM 235
           P   + I+  Y   + EG  R  ++G++             F  Y+   S+  E H T++
Sbjct: 50  PTTWSCIKFTY---QNEGIARGFFQGIASPLVGACLENATLFVSYNQC-SKFLEKH-TNV 104

Query: 236 LPSWETSLIGLISGALGPFSNAPLDTIKTRLQ--KDKSTSKDSGWSRILAIGRQLIREEG 293
            P  +  + G ++G+       P++ +K +LQ    +  S  +  +++L   + +I E G
Sbjct: 105 FPLGQILISGGVAGSCASLVLTPVELVKCKLQVANLQVASAKTKHTKVLPTIKAIITERG 164

Query: 294 FRALYKGITPRVMRVAPGQAVTFTVYELIRKKLE 327
              L++G +   +R + G    F  YE+++K L+
Sbjct: 165 LAGLWQGQSGTFIRESFGGVAWFATYEIVKKSLK 198

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 36/84 (42%), Gaps = 5/84 (5%)

Query: 245 GLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGF-RALYKGITP 303
           G I+GA G     P DT+K RLQ   S    + WS I    +   + EG  R  ++GI  
Sbjct: 20  GSIAGACGKVIEFPFDTVKVRLQTQASNVFPTTWSCI----KFTYQNEGIARGFFQGIAS 75

Query: 304 RVMRVAPGQAVTFTVYELIRKKLE 327
            ++      A  F  Y    K LE
Sbjct: 76  PLVGACLENATLFVSYNQCSKFLE 99

 Score = 30.4 bits (67), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 33/85 (38%), Gaps = 9/85 (10%)

Query: 14  LVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYKG 73
           L++GG+AGL       P DT+K  MQ                   + I  + G    Y+G
Sbjct: 217 LISGGSAGLAFNASIFPADTVKSVMQ---------TEHISLTNAVKKIFGKFGLKGFYRG 267

Query: 74  LGAVVIGIIPKMAIRFTSYEFFRTL 98
           LG  +   +P  A  F  +E    L
Sbjct: 268 LGITLFRAVPANAAVFYIFETLSAL 292

>Kwal_23.3965
          Length = 307

 Score = 71.6 bits (174), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 80/344 (23%), Positives = 138/344 (40%), Gaps = 63/344 (18%)

Query: 4   RKNSSHPAI-NLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDIS 62
           RK    P   +LVAG  +G+   +   PLDT+K+R+Q+  +   + Q   G + T + + 
Sbjct: 7   RKGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQL--QLANEAQYG-GILVTFKRLV 63

Query: 63  TQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNTFVAGVGAGIT 122
            QEG  AL+KG    +   I   + +FTSY     LL+  Q  + +  +T + G  +G  
Sbjct: 64  RQEGVRALWKGNVPAMAMYILYGSTQFTSYAILNKLLSKSQ--LPAQIHTGMVGALSGTC 121

Query: 123 EAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNA 182
            A+    P +V++ R  A H R                                 +    
Sbjct: 122 SAI-ASYPCDVLRTRFIANHSR---------------------------------ELSTM 147

Query: 183 IQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTD-----MLP 237
           +  A  I + EG R  ++GVS +    A    +    Y ++K   ++    D     +L 
Sbjct: 148 LSTAQEIWRHEGFRGFFKGVSSSIVSIAVATSSILATYESVKIFCEQRPDRDSSVIQLLE 207

Query: 238 SWETSLIGLISGALGPFSNAPLDTIKTRLQ--------------KDKSTSKDSGWSRILA 283
           S  + + G++S  +      P+DT++ R Q              K     K    +  L 
Sbjct: 208 SSASVIAGIVSKTI----VFPIDTVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLR 263

Query: 284 IGRQLIREEGFRALYKGITPRVMRVAPGQAVTFTVYELIRKKLE 327
           +   ++ +EG  ALY G T  + +  P   V+  VYE   +++E
Sbjct: 264 LALMIVEKEGLLALYHGYTLGIAKSVPSTVVSLGVYEWCLRRME 307

 Score = 29.3 bits (64), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 24/105 (22%), Positives = 41/105 (39%), Gaps = 13/105 (12%)

Query: 3   NRKNSSHPAINLVAGGTAGLFEALCCHPLDTIKVRMQI--YSRAREQGQRARG------- 53
           +R +S    +   A   AG+       P+DT++ R Q+  + +    G   +        
Sbjct: 197 DRDSSVIQLLESSASVIAGIVSKTIVFPIDTVRKRYQVIDWQQLGHPGHTNKAYKAYKSY 256

Query: 54  ----FIGTARDISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYEF 94
               F+  A  I  +EG LALY G    +   +P   +    YE+
Sbjct: 257 TSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPSTVVSLGVYEW 301

>CAGL0F00231g 29705..30628 highly similar to sp|P23641 Saccharomyces
           cerevisiae YJR077c MIR1, hypothetical start
          Length = 307

 Score = 71.2 bits (173), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 74/310 (23%), Positives = 125/310 (40%), Gaps = 61/310 (19%)

Query: 30  PLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYKGLGAVVIGIIPKMAIRF 89
           P+D +K R+Q+     E     +G +G+ R I  +EG  AL  G G  ++G   + A +F
Sbjct: 33  PIDVVKTRIQL-----EPTVYNKGMVGSFRKIIAEEGAGALLTGFGPTLLGYSIQGAFKF 87

Query: 90  TSYEFFRTLLADR---QTGVVSTGNTFVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYV 146
             YE F+    D     T      + ++    A    A + + P+E  +IRL +Q     
Sbjct: 88  GGYEVFKKFFIDTLGYDTAARYKNSVYIGSAAAAEFLADIALCPLEATRIRLVSQ----- 142

Query: 147 PLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAAYV-IVKEEGPRALYRGVSLT 205
                                         P + N +   +  I+KEEG  + Y G +  
Sbjct: 143 ------------------------------PTFANGLVGGFSRILKEEGVGSFYSGFTPI 172

Query: 206 AARQATNQGANFTVYSTLKSRLQEYHQT-----DMLPSWETSLIGLISGALGPFSNA--- 257
             +Q     A F V+     R  E + +     D L     + I L+SG     + A   
Sbjct: 173 LFKQIPYNIAKFLVF----ERASELYFSLAPPKDTLSQTSLTAINLLSGLTAGLAAAIVS 228

Query: 258 -PLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITPRVMRVAPGQAVTF 316
            P DT+ +++ K   TSK  G S +  +  QL ++ GF   + G+  R++ V    ++ F
Sbjct: 229 QPADTLLSKVNK---TSKAPGQSTV-GLLFQLAKQLGFVGSFAGLPTRLVMVGTLTSLQF 284

Query: 317 TVYELIRKKL 326
            +Y  ++K L
Sbjct: 285 GIYGQLKKSL 294

 Score = 36.2 bits (82), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 48/102 (47%), Gaps = 7/102 (6%)

Query: 223 LKSRLQEYHQTDMLPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRIL 282
           + ++L +Y  +D     + +L G I       S  P+D +KTR+Q + +         ++
Sbjct: 1   MSNQLPQYSYSDY---AKFALAGAIGCGSTHSSMVPIDVVKTRIQLEPTVYNKG----MV 53

Query: 283 AIGRQLIREEGFRALYKGITPRVMRVAPGQAVTFTVYELIRK 324
              R++I EEG  AL  G  P ++  +   A  F  YE+ +K
Sbjct: 54  GSFRKIIAEEGAGALLTGFGPTLLGYSIQGAFKFGGYEVFKK 95

 Score = 35.4 bits (80), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 36/69 (52%), Gaps = 5/69 (7%)

Query: 6   NSSHPAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQE 65
            +S  AINL++G TAGL  A+   P DT+  ++   S+A  Q       +G    ++ Q 
Sbjct: 206 QTSLTAINLLSGLTAGLAAAIVSQPADTLLSKVNKTSKAPGQST-----VGLLFQLAKQL 260

Query: 66  GFLALYKGL 74
           GF+  + GL
Sbjct: 261 GFVGSFAGL 269

>ADL009W [1733] [Homologous to ScYIL006W - SH; ScYEL006W - SH]
           complement(693078..694217) [1140 bp, 379 aa]
          Length = 379

 Score = 71.6 bits (174), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 81/334 (24%), Positives = 130/334 (38%), Gaps = 57/334 (17%)

Query: 12  INLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRA-RGFIGTARDISTQEGFLAL 70
           +  V+G  AG    +   PLD  K R+Q  ++    G+R  RG +GT   I   EG   L
Sbjct: 86  VTAVSGALAGFVSGIMVCPLDVAKTRLQ--AQGAGSGERYYRGIVGTLSAILRDEGVAGL 143

Query: 71  YKGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNTFVAGVGAGITEAVM---V 127
           YKGL  +V+G  P   + F+ YE  +     R    +  G  FV+   + +T   +   +
Sbjct: 144 YKGLAPIVLGYFPTWMLYFSVYEKCK----QRYPSYLPGG--FVSHAASALTAGAISTAL 197

Query: 128 VNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAAY 187
            NP+ VVK RL  Q                             +    +  YR+ + A  
Sbjct: 198 TNPIWVVKTRLMIQ----------------------------SDVSRDSTNYRSTLDAFR 229

Query: 188 VIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQ------EYHQTDMLPSWET 241
            + + EG +  Y G+ + +     +   +F VY  LK  L       +  + D       
Sbjct: 230 KMYRSEGLKVFYSGL-VPSLFGLFHVAIHFPVYEKLKIWLHRNTPAADGQRLDHNKLQLD 288

Query: 242 SLI--GLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYK 299
            LI    +S  +      P + ++TR+Q   S    S    +L +  ++   EG+   Y 
Sbjct: 289 RLIVASCLSKVVASVITYPHEILRTRMQVRHSGVPPS----LLNLLGRIRASEGYVGFYS 344

Query: 300 GITPRVMRVAPGQAVTFTVYELIRKKL----EGL 329
           G    ++R  P   +T   +E  RK L    EGL
Sbjct: 345 GFATNLVRTVPASVITLVSFEYFRKYLRMWNEGL 378

>YBR192W (RIM2) [375] chr2 (607609..608742) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, required for respiration [1134 bp, 377 aa]
          Length = 377

 Score = 71.2 bits (173), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 72/351 (20%), Positives = 145/351 (41%), Gaps = 68/351 (19%)

Query: 10  PAINLVAGGTAGLFEALCCHPLDTIKVRMQ--IYSRAREQ-------------------- 47
           P ++ VAGG  G+  A+   P D +K R+Q  I+ +A +                     
Sbjct: 52  PWVHFVAGGIGGMAGAVVTCPFDLVKTRLQSDIFLKAYKSQAVNISKGSTRPKSINYVIQ 111

Query: 48  -GQRARGFIGTARDISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGV 106
            G   +  +G   ++  QEGF +L+KGLG  ++G+IP  +I F +Y   + + A      
Sbjct: 112 AGTHFKETLGIIGNVYKQEGFRSLFKGLGPNLVGVIPARSINFFTYGTTKDMYAKAFNNG 171

Query: 107 VSTGNTFVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXX 166
             T    +              NP+ ++K R+Q             AG            
Sbjct: 172 QETPMIHLMAAATAGWATATATNPIWLIKTRVQLDK----------AGK----------- 210

Query: 167 XXXXENVAATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGA-NFTVYSTLKS 225
                   +  +Y+N+      +++ EG   LY+G  L+A+   + +G   + +Y  +K 
Sbjct: 211 -------TSVRQYKNSWDCLKSVIRNEGFTGLYKG--LSASYLGSVEGILQWLLYEQMKR 261

Query: 226 RLQE-------------YHQTDMLPSW-ETSLIGLISGALGPFSNAPLDTIKTRLQKDKS 271
            ++E                ++ +  W + S    ++  +   +  P + ++TRL++   
Sbjct: 262 LIKERSIEKFGYQAEGTKSTSEKVKEWCQRSGSAGLAKFVASIATYPHEVVRTRLRQTPK 321

Query: 272 TSKDSGWSRILAIGRQLIREEGFRALYKGITPRVMRVAPGQAVTFTVYELI 322
            +    ++ ++   + +I+EEG  ++Y G+TP +MR  P   + F  +E++
Sbjct: 322 ENGKRKYTGLVQSFKVIIKEEGLFSMYSGLTPHLMRTVPNSIIMFGTWEIV 372

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 51/208 (24%), Positives = 90/208 (43%), Gaps = 23/208 (11%)

Query: 126 MVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQA 185
           +V  P ++VK RLQ+     + LKA  + +V                 A T  ++  +  
Sbjct: 68  VVTCPFDLVKTRLQSD----IFLKAYKSQAVNISKGSTRPKSINYVIQAGT-HFKETLGI 122

Query: 186 AYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPSWETSLIG 245
              + K+EG R+L++G+          +  NF  Y T K    +          ET +I 
Sbjct: 123 IGNVYKQEGFRSLFKGLGPNLVGVIPARSINFFTYGTTKDMYAKAFNNGQ----ETPMIH 178

Query: 246 LISGALGPFSNA----PLDTIKTRLQKDKSTSKD-----SGWSRILAIGRQLIREEGFRA 296
           L++ A   ++ A    P+  IKTR+Q DK+         + W  +    + +IR EGF  
Sbjct: 179 LMAAATAGWATATATNPIWLIKTRVQLDKAGKTSVRQYKNSWDCL----KSVIRNEGFTG 234

Query: 297 LYKGITPRVMRVAPGQAVTFTVYELIRK 324
           LYKG++   +    G  + + +YE +++
Sbjct: 235 LYKGLSASYLGSVEG-ILQWLLYEQMKR 261

 Score = 37.4 bits (85), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 20/86 (23%), Positives = 43/86 (50%), Gaps = 3/86 (3%)

Query: 16  AGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRA-RGFIGTARDISTQEGFLALYKGL 74
           + G A    ++  +P + ++ R++     +E G+R   G + + + I  +EG  ++Y GL
Sbjct: 294 SAGLAKFVASIATYPHEVVRTRLR--QTPKENGKRKYTGLVQSFKVIIKEEGLFSMYSGL 351

Query: 75  GAVVIGIIPKMAIRFTSYEFFRTLLA 100
              ++  +P   I F ++E    LL+
Sbjct: 352 TPHLMRTVPNSIIMFGTWEIVIRLLS 377

>YLR348C (DIC1) [3731] chr12 complement(826976..827872)
           Mitochondrial dicarboxylate transport protein, member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [897 bp, 298 aa]
          Length = 298

 Score = 70.5 bits (171), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 76/330 (23%), Positives = 122/330 (36%), Gaps = 52/330 (15%)

Query: 5   KNSSHPAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQ 64
           KN  +P      GG AG+F  +  HPLD  KVR+Q     +    R          I   
Sbjct: 11  KNIKYP---WWYGGAAGIFATMVTHPLDLAKVRLQAAPMPKPTLFR------MLESILAN 61

Query: 65  EGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQ----TGVVSTGNTFVAGVGAG 120
           EG + LY GL A V+       +RF +Y+  +  +  R+       +   + F   +G  
Sbjct: 62  EGVVGLYSGLSAAVLRQCTYTTVRFGAYDLLKENVIPREQLTNMAYLLPCSMFSGAIGG- 120

Query: 121 ITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYR 180
                +  N  +VV IR+Q        L+A                       A    Y+
Sbjct: 121 -----LAGNFADVVNIRMQNDSA----LEA-----------------------AKRRNYK 148

Query: 181 NAIQAAYVIVKEEGP-RALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPSW 239
           NAI   Y I + EG  + L+ G      R      +    Y   K+ L      D   ++
Sbjct: 149 NAIDGVYKIYRYEGGLKTLFTGWKPNMVRGILMTASQVVTYDVFKNYLVTKLDFDASKNY 208

Query: 240 ETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYK 299
                 L++G +     +P D +KTR+       + +     L I    +R+EG   +++
Sbjct: 209 THLTASLLAGLVATTVCSPADVMKTRIMNGSGDHQPA-----LKILADAVRKEGPSFMFR 263

Query: 300 GITPRVMRVAPGQAVTFTVYELIRKKLEGL 329
           G  P   R+ P   + F   E ++K   G+
Sbjct: 264 GWLPSFTRLGPFTMLIFFAIEQLKKHRVGM 293

>CAGL0M05225g 563163..564308 highly similar to sp|P38127
           Saccharomyces cerevisiae YBR192w RIM2 mitochondrial
           carrier protein, start by similarity
          Length = 381

 Score = 70.9 bits (172), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 62/285 (21%), Positives = 117/285 (41%), Gaps = 47/285 (16%)

Query: 60  DISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNTFVAGVGA 119
           ++  QEGF +L+KGLG  ++G+IP  +I F +Y   + + +             +     
Sbjct: 129 NVYRQEGFRSLFKGLGPNLVGVIPARSINFFTYGTTKDIYSKAFNNGQEAPWIHLMAAAT 188

Query: 120 GITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKY 179
                    NP+ +VK R+Q                               +    T  Y
Sbjct: 189 AGWATATATNPIWMVKTRVQ------------------------------LDKAGKTRTY 218

Query: 180 RNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGA-NFTVYSTLKSRLQEY-------H 231
           +N+      I++ EG   LYRG  L+A+   + +G   + +Y  LK  +++        H
Sbjct: 219 KNSYDCLKSILRNEGIYGLYRG--LSASYLGSVEGILQWLLYEQLKHLIKKRSIEKFGAH 276

Query: 232 Q------TDMLPSWETSLIGL-ISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAI 284
                  TD +  W     G  ++  +      P + ++TRL++    +    ++ ++  
Sbjct: 277 DESTMTTTDKIKQWCQRSGGAGLAKFMASIVTYPHEVVRTRLRQSPLENGKVKYTGLVQS 336

Query: 285 GRQLIREEGFRALYKGITPRVMRVAPGQAVTFTVYELIRKKLEGL 329
            R +I+EEG  ++Y G+TP +MR  P   + F  +E++ K L  +
Sbjct: 337 FRVIIKEEGLASMYSGLTPHLMRTVPNSIIMFGTWEVVIKLLSDI 381

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 43/87 (49%), Gaps = 24/87 (27%)

Query: 257 APLDTIKTRLQKD------KSTSK----DSGWSRILAIGRQ--------------LIREE 292
            P D +KTRLQ D      KS ++    ++   RI+ +  Q              + R+E
Sbjct: 75  CPFDLVKTRLQSDIYQNMYKSQAEALMMNTTRPRIVNLTLQAATHFKETVSIIGNVYRQE 134

Query: 293 GFRALYKGITPRVMRVAPGQAVTFTVY 319
           GFR+L+KG+ P ++ V P +++ F  Y
Sbjct: 135 GFRSLFKGLGPNLVGVIPARSINFFTY 161

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 58/237 (24%), Positives = 98/237 (41%), Gaps = 52/237 (21%)

Query: 10  PAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGT---ARDISTQEG 66
           P I+L+A  TAG   A   +P+  +K R+Q+     ++  + R +  +    + I   EG
Sbjct: 179 PWIHLMAAATAGWATATATNPIWMVKTRVQL-----DKAGKTRTYKNSYDCLKSILRNEG 233

Query: 67  FLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADR--------QTGVVSTGNTFVAGV- 117
              LY+GL A  +G +  + +++  YE  + L+  R            ++T +       
Sbjct: 234 IYGLYRGLSASYLGSVEGI-LQWLLYEQLKHLIKKRSIEKFGAHDESTMTTTDKIKQWCQ 292

Query: 118 ---GAGITE--AVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXEN 172
              GAG+ +  A +V  P EVV+ RL     R  PL+    G V                
Sbjct: 293 RSGGAGLAKFMASIVTYPHEVVRTRL-----RQSPLE---NGKV---------------- 328

Query: 173 VAATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQE 229
                KY   +Q+  VI+KEEG  ++Y G++    R   N    F  +  +   L +
Sbjct: 329 -----KYTGLVQSFRVIIKEEGLASMYSGLTPHLMRTVPNSIIMFGTWEVVIKLLSD 380

>Sklu_2432.5 YLR348C, Contig c2432 10310-11176 reverse complement
          Length = 288

 Score = 69.7 bits (169), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 76/317 (23%), Positives = 116/317 (36%), Gaps = 47/317 (14%)

Query: 17  GGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYKGLGA 76
           GG  G+   +  HPLD  KVR+Q     +         +  A  I   EG   LY GL A
Sbjct: 15  GGFGGIVACVATHPLDLAKVRLQTAPAPKPT------LVRMASQILRNEGVPGLYSGLTA 68

Query: 77  VVIGIIPKMAIRFTSYEFFRTLLADRQ----TGVVSTGNTFVAGVGAGITEAVMVVNPME 132
            ++        RF  Y+F +     ++       +   + F   VG       ++ NP +
Sbjct: 69  AILRQCTYTTARFGVYDFVKERYIPKEYLNSMLYLLPCSMFSGAVGG------LIGNPAD 122

Query: 133 VVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAAYVIVKE 192
           VV IR+Q        L A+L  +                       Y+NA    Y I   
Sbjct: 123 VVNIRMQNDS----SLPAELRRN-----------------------YKNAADGLYKICSG 155

Query: 193 EGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPSWETSLIGLISGALG 252
           EG   L+ G      R      +    Y   K+ L +    D           L++G + 
Sbjct: 156 EGVAKLFTGWQPNLVRGILMTSSQVVTYDIAKNYLVQNVGLDKDNKSTHFASSLLAGLVA 215

Query: 253 PFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITPRVMRVAPGQ 312
               +P D IKTR+      S DS   RIL      +++EG   +++G  P  +R+ P  
Sbjct: 216 TTVCSPADVIKTRVMNAHKHSHDSA-VRILL---DAVKQEGPSFMFRGWLPSFVRLGPNT 271

Query: 313 AVTFTVYELIRKKLEGL 329
            + F   E +RK   G+
Sbjct: 272 ILIFLTVEQLRKHRVGM 288

>Sklu_2117.2 YDL198C, Contig c2117 3737-4633
          Length = 298

 Score = 69.7 bits (169), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 85/334 (25%), Positives = 132/334 (39%), Gaps = 66/334 (19%)

Query: 1   MSNRKNSSHPAINLVAGGTAGLFEALCCHPLDTIKVR-MQIYSRAREQGQRARGFIGTAR 59
           MSN K  S  A  ++   +AG+ E    HP+DTI  R M  +++     Q          
Sbjct: 1   MSNDKKQSGLA-RVLGSASAGILEIGVFHPVDTISKRLMSNHTKIGSSSQLNSVIFREHA 59

Query: 60  DISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNTF------ 113
                +    L+ GLG      I +   ++    F    L   +       NTF      
Sbjct: 60  AEPLSKRVFTLFPGLGYAATYKILQRVYKYGGQPFANEFL--NRNFKADFDNTFGEKTGK 117

Query: 114 -----VAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXX 168
                 AG   GI E V++  P++V+KI+ Q     +                       
Sbjct: 118 ALRSATAGSMIGIGEIVLL--PLDVLKIKRQTNPEAF----------------------- 152

Query: 169 XXENVAATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSR-- 226
                    K R  ++    I+K+EG   LYRG   TAAR A    A F   +  K    
Sbjct: 153 ---------KGRGFVK----ILKDEG-LGLYRGWGWTAARNAPGSFALFGGNAFAKEYIL 198

Query: 227 -LQEYHQTDMLPSWETSLIGLISGALGPFS-NAPLDTIKTRLQKDKSTSKDSGWSRILAI 284
            L++Y Q     +W  + +  I GA      +APLD IKTR+Q     + +SG++    I
Sbjct: 199 GLKDYSQA----TWSQNFVSSIVGASASLIISAPLDVIKTRIQNKNFENPESGFT----I 250

Query: 285 GRQLIREEGFRALYKGITPRVMRVAPGQAVTFTV 318
            +  ++ EGF A +KG+TP+++   P    +F +
Sbjct: 251 VKNTLKNEGFSAFFKGLTPKLLTTGPKLVFSFAL 284

>AFR147C [3339] [Homologous to NOHBY] (703270..704217) [948 bp, 315
           aa]
          Length = 315

 Score = 70.1 bits (170), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 71/282 (25%), Positives = 121/282 (42%), Gaps = 56/282 (19%)

Query: 30  PLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYKGLGAVVIGIIPKMAIRF 89
           PL T+  RMQ+  + +E G R++  +   R+I  +EG +  Y GL + + G    MA   
Sbjct: 36  PLVTLATRMQVSEQDKEPGTRSKSKLEAVREIYRKEGVVGFYYGLESAMYG----MAANS 91

Query: 90  TSYEFFRTLLAD-----RQTGVVSTGNTFVAGVGAGITEAVMVVNPMEVVKIRLQAQHVR 144
            +Y +F  L A      R +  ++T    ++   AG   A+   NP+ VV  R+      
Sbjct: 92  LNYYYFYELAARATMRVRGSRRLNTSEAILSSAVAGSMTAI-ASNPIWVVNTRMTVAKSE 150

Query: 145 YVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAAYVIVKEEGPRALYRGVSL 204
              L   L                                    IV+++G  AL+ G+  
Sbjct: 151 QSTLAVLLD-----------------------------------IVRKDGVTALFNGLR- 174

Query: 205 TAARQATNQGANFTVYSTLKSRLQEYHQTD-MLPSWETSLIGLISGALGPFSNAPLDTIK 263
            A    +N    +TV+  LK+ + ++  +D +LPSW   L+G +       S  P  T+K
Sbjct: 175 PALMLVSNPIIQYTVFEQLKNVVLKWSGSDVLLPSW-AFLLGAVGKLAATGSTYPYITLK 233

Query: 264 TRLQ----KDKSTSKDSGWSRILAIGRQLIREEGFRALYKGI 301
           TR+     K+ + ++ S WS ++ I    +++EG + LY GI
Sbjct: 234 TRMHLAKGKEDADTQQSMWSLMVDI----VKKEGIQGLYHGI 271

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 31/144 (21%), Positives = 64/144 (44%), Gaps = 7/144 (4%)

Query: 180 RNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPSW 239
           ++ ++A   I ++EG    Y G+       A N    +  Y            +  L + 
Sbjct: 58  KSKLEAVREIYRKEGVVGFYYGLESAMYGMAANSLNYYYFYELAARATMRVRGSRRLNTS 117

Query: 240 ETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYK 299
           E  L   ++G++   ++ P+  + TR+   KS          LA+   ++R++G  AL+ 
Sbjct: 118 EAILSSAVAGSMTAIASNPIWVVNTRMTVAKSEQST------LAVLLDIVRKDGVTALFN 171

Query: 300 GITPRVMRVAPGQAVTFTVYELIR 323
           G+ P +M V+    + +TV+E ++
Sbjct: 172 GLRPALMLVS-NPIIQYTVFEQLK 194

 Score = 32.3 bits (72), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 34/86 (39%), Gaps = 1/86 (1%)

Query: 10  PAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLA 69
           P+   + G    L      +P  T+K RM + ++ +E     +       DI  +EG   
Sbjct: 208 PSWAFLLGAVGKLAATGSTYPYITLKTRMHL-AKGKEDADTQQSMWSLMVDIVKKEGIQG 266

Query: 70  LYKGLGAVVIGIIPKMAIRFTSYEFF 95
           LY G+G  +   I   A  F   E F
Sbjct: 267 LYHGIGVKLTQSILTAAFLFYFKEGF 292

>Sklu_2115.4 YDL119C, Contig c2115 2906-3805
          Length = 299

 Score = 69.7 bits (169), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 77/348 (22%), Positives = 139/348 (39%), Gaps = 76/348 (21%)

Query: 1   MSNR-KNSSHPAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTAR 59
           M+ R K SSH    L+ G   GL  A+   P D +K R+        Q  +     GT +
Sbjct: 1   MAERPKTSSH----LIGGFVGGLTSAIVLQPFDLLKTRL--------QQNKDTTLWGTLK 48

Query: 60  DISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNTFVAGV-- 117
           +I + +    L++G     +      A+  ++   FRT +A  +T  ++ G++F+  +  
Sbjct: 49  EIRSPK---QLWRGALPSSLRTSIGSALYLSTLNVFRTAMAKGKTQTLNPGSSFLPQLTM 105

Query: 118 -----GAGITEAVM--VVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXX 170
                    T  V+  +  P+ ++K+R ++    Y  L                      
Sbjct: 106 YENLASGAFTRGVVGFITMPITIIKVRYESTMYSYKSLG--------------------- 144

Query: 171 ENVAATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYS--------T 222
                        +A   I   EG R  + G   T  R A   G    +Y          
Sbjct: 145 -------------EATRHIYSTEGIRGFFNGCGATVMRDAPYAGLYVLLYEKAKLLVPMM 191

Query: 223 LKSRLQEYHQTDMLPSWETSLI----GLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGW 278
           L S    Y +  M  ++ ++++      +S +L     +P DTIKTR+Q D   +K SG+
Sbjct: 192 LPSSTISYDEAGMFTTYTSTVVNSISAFMSASLATTITSPFDTIKTRMQLDP--TKFSGF 249

Query: 279 SRILAIGRQLIREEGFRALYKGITPRVMRVAPGQAVTFTVYELIRKKL 326
            + L +   ++ +E F+ L+ G+T R+ R A    + + +YE + K+ 
Sbjct: 250 YKTLVL---IVSKEKFKNLFDGLTLRLTRKAFSAGIAWGIYEELIKRF 294

>KLLA0F13464g 1246646..1247548 highly similar to sp|P38988
           Saccharomyces cerevisiae YDL198c YHM1 member of the
           mitochondrial carrier family (MCF), start by similarity
          Length = 300

 Score = 69.7 bits (169), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 82/322 (25%), Positives = 130/322 (40%), Gaps = 67/322 (20%)

Query: 14  LVAGGTAGLFEALCCHPLDTIKVR-MQIYSRAREQGQRARGFIGTARDISTQ---EGFLA 69
           ++   +AG+ E    HP+DTI  R M  +++     Q         RD +++      L+
Sbjct: 14  VLGSASAGILEIGVFHPVDTISKRLMSNHTKIASTSQLNSVIF---RDFASEPLGRRLLS 70

Query: 70  LYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVS------TGNTF---VAGVGAG 120
           L+ GLG      I +   ++    F    L     G         TG       AG   G
Sbjct: 71  LFPGLGYAAAYKILQRVYKYGGQPFANEFLNKNFKGDFDQAFGEKTGKALRSATAGSLIG 130

Query: 121 ITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYR 180
           I E V++  P++V+KI+ Q     +                                K R
Sbjct: 131 IGEIVLL--PLDVLKIKRQTNPESF--------------------------------KGR 156

Query: 181 NAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSR---LQEYHQTDMLP 237
             ++    I+K+EG   LYRG   TAAR A    A F   +  K     L++Y Q     
Sbjct: 157 GFLK----IIKDEG-FGLYRGWGWTAARNAPGSFALFGGNAFAKEYILGLKDYGQA---- 207

Query: 238 SWETSLIGLISGALGPF-SNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRA 296
           +W  + +  I GA      +APLD IKTR+Q     + +SG+  I    +  ++ EGF A
Sbjct: 208 TWSQNFVSSIVGASASLIVSAPLDVIKTRIQNRNFDNPESGFKII----KNTLKNEGFTA 263

Query: 297 LYKGITPRVMRVAPGQAVTFTV 318
            +KG+TP+++   P    +F +
Sbjct: 264 FFKGLTPKLLTTGPKLVFSFAL 285

 Score = 32.7 bits (73), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 36/82 (43%), Gaps = 8/82 (9%)

Query: 8   SHPAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGF 67
           S   ++ + G +A L   +   PLD IK R+Q     R       GF    ++    EGF
Sbjct: 210 SQNFVSSIVGASASL---IVSAPLDVIKTRIQ----NRNFDNPESGF-KIIKNTLKNEGF 261

Query: 68  LALYKGLGAVVIGIIPKMAIRF 89
            A +KGL   ++   PK+   F
Sbjct: 262 TAFFKGLTPKLLTTGPKLVFSF 283

>CAGL0F07711g complement(751794..752900) similar to sp|Q03829
           Saccharomyces cerevisiae YMR166c, hypothetical start
          Length = 368

 Score = 70.1 bits (170), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 69/261 (26%), Positives = 104/261 (39%), Gaps = 39/261 (14%)

Query: 14  LVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFL-ALYK 72
            +AGG  G+      H LDT+K R Q          + +  +   R +  +EGF   LY 
Sbjct: 57  FLAGGVGGIIGDSAMHSLDTVKTRQQ----GAPNVHKYKHMLQAYRTMFIEEGFRRGLYG 112

Query: 73  GLGAVVIGIIPKMAIRFTSYEFF-RTLLADRQTGVVSTGNTFVAGVGAGITEAVMVVNPM 131
           G  A ++G  P  AI F++YEF  RT++ D    +  T +   AG       + + V P 
Sbjct: 113 GYCAAMLGSFPSAAIFFSTYEFTKRTMINDYH--LNDTFSHLTAGFLGDFFSSFVYV-PS 169

Query: 132 EVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAAYVIVK 191
           EV+K RLQ Q     P                        +  +   Y++   A   I +
Sbjct: 170 EVLKTRLQLQGCYNNP------------------------HFNSGYNYKSLRNAIATIYR 205

Query: 192 EEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRL-----QEYHQTDMLPSWETSLIGL 246
            EG  AL+ G   T AR        F  Y   +        ++ ++ D+  S E  + G 
Sbjct: 206 TEGVAALFFGYKATLARDLPFSALQFAFYEKFRQWAFLLEGKDIYKHDLSISNEI-VTGA 264

Query: 247 ISGALGPFSNAPLDTIKTRLQ 267
            +G L      PLD +KTR+Q
Sbjct: 265 CAGGLAGILTTPLDVVKTRVQ 285

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 44/91 (48%), Gaps = 4/91 (4%)

Query: 237 PSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGF-R 295
           P W   L G + G +G  +   LDT+KTR Q   +  K   +  +L   R +  EEGF R
Sbjct: 52  PIWHCFLAGGVGGIIGDSAMHSLDTVKTRQQGAPNVHK---YKHMLQAYRTMFIEEGFRR 108

Query: 296 ALYKGITPRVMRVAPGQAVTFTVYELIRKKL 326
            LY G    ++   P  A+ F+ YE  ++ +
Sbjct: 109 GLYGGYCAAMLGSFPSAAIFFSTYEFTKRTM 139

 Score = 44.7 bits (104), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 40/138 (28%), Positives = 59/138 (42%), Gaps = 10/138 (7%)

Query: 13  NLVAGGTAGLFEALCCHPLDTIKVRMQI---YSRAR-EQGQRARGFIGTARDISTQEGFL 68
           +L AG     F +    P + +K R+Q+   Y+      G   +        I   EG  
Sbjct: 151 HLTAGFLGDFFSSFVYVPSEVLKTRLQLQGCYNNPHFNSGYNYKSLRNAIATIYRTEGVA 210

Query: 69  ALYKGLGAVVIGIIPKMAIRFTSYEFFRT---LLA--DRQTGVVSTGNTFVAGVGAGITE 123
           AL+ G  A +   +P  A++F  YE FR    LL   D     +S  N  V G  AG   
Sbjct: 211 ALFFGYKATLARDLPFSALQFAFYEKFRQWAFLLEGKDIYKHDLSISNEIVTGACAGGLA 270

Query: 124 AVMVVNPMEVVKIRLQAQ 141
            ++   P++VVK R+Q Q
Sbjct: 271 GILTT-PLDVVKTRVQTQ 287

 Score = 44.3 bits (103), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 43/158 (27%), Positives = 68/158 (43%), Gaps = 18/158 (11%)

Query: 178 KYRNAIQAAYVIVKEEG-PRALYRGVSLTAARQATNQGANFTVYS-TLKSRLQEYHQTDM 235
           KY++ +QA   +  EEG  R LY G          +    F+ Y  T ++ + +YH  D 
Sbjct: 89  KYKHMLQAYRTMFIEEGFRRGLYGGYCAAMLGSFPSAAIFFSTYEFTKRTMINDYHLNDT 148

Query: 236 LPSWETSLIGLISGALGPFSNA----PLDTIKTRLQKDKSTSK---DSGWS--RILAIGR 286
                     L +G LG F ++    P + +KTRLQ     +    +SG++   +     
Sbjct: 149 FSH-------LTAGFLGDFFSSFVYVPSEVLKTRLQLQGCYNNPHFNSGYNYKSLRNAIA 201

Query: 287 QLIREEGFRALYKGITPRVMRVAPGQAVTFTVYELIRK 324
            + R EG  AL+ G    + R  P  A+ F  YE  R+
Sbjct: 202 TIYRTEGVAALFFGYKATLARDLPFSALQFAFYEKFRQ 239

>Sklu_2037.2 YIL134W, Contig c2037 1645-2577 reverse complement
          Length = 310

 Score = 68.9 bits (167), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 79/341 (23%), Positives = 137/341 (40%), Gaps = 70/341 (20%)

Query: 14  LVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDI---STQEGFL-A 69
           +++G TAG    +  HPLD +KVR+Q+ +      ++ +G+    + I   S Q  F   
Sbjct: 12  MISGLTAGTITTVSTHPLDLVKVRLQLLA----TNKKPQGYYDVVKRIVKDSKQHSFFRE 67

Query: 70  LYKGLGAVVIGIIPKMAIRFTSYE----------------FFRTLLADRQTGVVSTGNTF 113
            Y+GLG  ++G      + F  Y                 F  T+  D++   +++    
Sbjct: 68  TYRGLGVNLLGNSVAWGLYFGLYRASKDWVFQWCNTDVKRFNNTMNNDKE---MTSLMYL 124

Query: 114 VAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENV 173
           +A   +G+  +V+  NP+ V+K R+ +                               + 
Sbjct: 125 LAAAMSGVATSVLT-NPIWVIKTRIMS------------------------------TSF 153

Query: 174 AATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGA-NFTVYSTLKSRLQEYHQ 232
             +  YR+ +     + + EG    +RG  L  +    +QGA  FTVY TLK        
Sbjct: 154 VDSRSYRSTVDGIKKLYRIEGLAGFWRG--LVPSLFGVSQGAIYFTVYDTLKYHYFAAKH 211

Query: 233 TDM---LPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTS----KDSGWSRILAIG 285
            D    L + E   I  +S  +   +  PL  +K+ LQ  + ++    K S   R+  + 
Sbjct: 212 VDKKKKLSNLEYITITSLSKMVSVTAVYPLQLLKSNLQSFEVSTVINPKTS--HRVWKLI 269

Query: 286 RQLIREEGFRALYKGITPRVMRVAPGQAVTFTVYELIRKKL 326
             +   +G   LYKG+   ++R  P   +TF VYE  R  L
Sbjct: 270 TTIYVRDGVTGLYKGLLANLIRAVPSTCITFCVYENFRHWL 310

 Score = 33.5 bits (75), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 41/88 (46%), Gaps = 1/88 (1%)

Query: 233 TDMLPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILA-IGRQLIRE 291
           +D  P  +  + GL +G +   S  PLD +K RLQ   +  K  G+  ++  I +   + 
Sbjct: 3   SDFSPVQKEMISGLTAGTITTVSTHPLDLVKVRLQLLATNKKPQGYYDVVKRIVKDSKQH 62

Query: 292 EGFRALYKGITPRVMRVAPGQAVTFTVY 319
             FR  Y+G+   ++  +    + F +Y
Sbjct: 63  SFFRETYRGLGVNLLGNSVAWGLYFGLY 90

>Kwal_23.4731
          Length = 314

 Score = 68.9 bits (167), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 73/336 (21%), Positives = 131/336 (38%), Gaps = 61/336 (18%)

Query: 14  LVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEG-FLALYK 72
           ++AG  AG    +  HPLD +K+R+Q+                  RD       F   Y+
Sbjct: 17  IIAGLAAGTLTTIATHPLDLVKLRLQLLVNTTHSHGYKEVIKTIIRDSKADSNVFREAYR 76

Query: 73  GLGAVVIGIIPKMAIRFTSYEF-----FRTLLADRQTGVVST-------------GNTFV 114
           GLG  +IG      + F  Y F     +R  +A  +T   S+              +  +
Sbjct: 77  GLGVNLIGNSIAWGLYFGLYRFTKDMVYRYGVAQMKTPTQSSFQKDKAMGPSLYLASAAL 136

Query: 115 AGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVA 174
           +G+G  I     + NP+ V+K R+ +   +                              
Sbjct: 137 SGLGTAI-----LTNPIWVIKTRIMSTSSQ------------------------------ 161

Query: 175 ATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGA-NFTVYSTLKSRL---QEY 230
           A+ +Y+        +   EG    +RG  L  +     QGA  FT+Y +L+ +    +  
Sbjct: 162 ASERYKTTWDGIRKVYAHEGFSGFWRG--LVPSLFGVAQGAIYFTIYDSLRHQYFARRGI 219

Query: 231 HQTDMLPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIR 290
            + + + + E   I  +S  L   +  P   +K+ LQ   +  K   + R   + + + +
Sbjct: 220 TEDEKMGNLENIAITSVSKMLSVTAVYPFQLLKSNLQSFAAVEKRDSY-RFWNLVKSIHQ 278

Query: 291 EEGFRALYKGITPRVMRVAPGQAVTFTVYELIRKKL 326
           +EG + LYKG++  ++R  P   +TF +YE +R  L
Sbjct: 279 KEGLQGLYKGLSANLLRAIPSTCITFCIYENLRHWL 314

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 49/225 (21%), Positives = 96/225 (42%), Gaps = 44/225 (19%)

Query: 10  PAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLA 69
           P++ L +   +GL  A+  +P+  IK R  I S + +  +R +      R +   EGF  
Sbjct: 127 PSLYLASAALSGLGTAILTNPIWVIKTR--IMSTSSQASERYKTTWDGIRKVYAHEGFSG 184

Query: 70  LYKGLGAVVIGIIPKMAIRFTSYE-----FF--RTLLADRQTGVVSTGNTFVAGVGAGIT 122
            ++GL   + G + + AI FT Y+     +F  R +  D + G +   N  +  V   ++
Sbjct: 185 FWRGLVPSLFG-VAQGAIYFTIYDSLRHQYFARRGITEDEKMGNLE--NIAITSVSKMLS 241

Query: 123 EAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNA 182
             V  V P +++K  LQ+    +  ++ +                        + ++ N 
Sbjct: 242 --VTAVYPFQLLKSNLQS----FAAVEKR-----------------------DSYRFWNL 272

Query: 183 IQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRL 227
           +++   I ++EG + LY+G+S    R   +    F +Y  L+  L
Sbjct: 273 VKS---IHQKEGLQGLYKGLSANLLRAIPSTCITFCIYENLRHWL 314

 Score = 35.0 bits (79), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 23/96 (23%), Positives = 44/96 (45%), Gaps = 8/96 (8%)

Query: 233 TDMLPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREE 292
           +D  P     + GL +G L   +  PLD +K RLQ   +T+   G+  ++   + +IR+ 
Sbjct: 8   SDFTPLQREIIAGLAAGTLTTIATHPLDLVKLRLQLLVNTTHSHGYKEVI---KTIIRDS 64

Query: 293 G-----FRALYKGITPRVMRVAPGQAVTFTVYELIR 323
                 FR  Y+G+   ++  +    + F +Y   +
Sbjct: 65  KADSNVFREAYRGLGVNLIGNSIAWGLYFGLYRFTK 100

>Scas_716.29
          Length = 316

 Score = 68.9 bits (167), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 71/327 (21%), Positives = 127/327 (38%), Gaps = 52/327 (15%)

Query: 13  NLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFL-ALY 71
           +LVAG  +GL       PLDT+K+R+Q+  R    GQ   G +   + +   EG L + +
Sbjct: 25  SLVAGSVSGLLARTVIAPLDTLKIRLQL--RPSYTGQAPSGLLKMMKGMILNEGGLRSFW 82

Query: 72  KGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNTFVAGVGAGITEAVMVVNPM 131
           KG     +  +     +F+SY F+  L  +  + +     + V G  AG+T +  V  P 
Sbjct: 83  KGNVPGTMMYVLYGGAQFSSYSFYNNLFGE-TSDMNGQLQSLVVGALAGMTSS-FVSYPT 140

Query: 132 EVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAAYVIVK 191
           +V++ R  A                              ++VA +       +    I  
Sbjct: 141 DVLRTRFIAN-----------------------------QDVALSSLSHGCKE----IWN 167

Query: 192 EEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPSWETSLIGLISGAL 251
            EG    +RG + +      +    F  Y ++K    EY +     ++       ISG  
Sbjct: 168 MEGIPGFFRGCTASMFTITLSASILFGTYESIKIYCDEYSKESDYTNYLRYSASSISGVT 227

Query: 252 GPFSNAPLDTIKTRLQKDKST--------------SKDSGWSRILAIGRQLIREEGFRAL 297
                 PLDTI+ R+Q   S                +    +  + +G  ++R+EG  +L
Sbjct: 228 SKMVTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSL 287

Query: 298 YKGITPRVMRVAPGQAVTFTVYELIRK 324
           Y+G++  + +  P   V+   YE + +
Sbjct: 288 YQGVSMSLCKTVPSTVVSLWAYETVMR 314

 Score = 37.4 bits (85), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 42/97 (43%), Gaps = 6/97 (6%)

Query: 231 HQTDMLPSWET-----SLI-GLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAI 284
           H TD L   E      SL+ G +SG L     APLDT+K RLQ   S +  +    +  +
Sbjct: 9   HNTDHLRKGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMM 68

Query: 285 GRQLIREEGFRALYKGITPRVMRVAPGQAVTFTVYEL 321
              ++ E G R+ +KG  P  M         F+ Y  
Sbjct: 69  KGMILNEGGLRSFWKGNVPGTMMYVLYGGAQFSSYSF 105

>YGR096W (TPC1) [2056] chr7 (676623..677567) Mitochondrial thiamine
           pyrophosphate transporter, controls import of thiamine
           pyrophosphate during growth on fermentative carbon
           sources, member of the mitochondrial carrier family
           (MCF) of membrane transporters [945 bp, 314 aa]
          Length = 314

 Score = 68.9 bits (167), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 79/325 (24%), Positives = 132/325 (40%), Gaps = 57/325 (17%)

Query: 14  LVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARG--FIGTARDISTQEGFLALY 71
           L+AG  +GL       P+DTIK+R+Q+       G +  G   +  AR +   EG  + +
Sbjct: 20  LLAGAVSGLLARSITAPMDTIKIRLQL---TPANGLKPFGSQVMEVARSMIKNEGIRSFW 76

Query: 72  KGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNTFVAGVGAGITEAVMVVNPM 131
           KG     +  +   + +F+SY  F   L     G+ +  ++ V G  AGIT ++ V  P 
Sbjct: 77  KGNIPGSLLYVTYGSAQFSSYSLFNRYLTP--FGLEARLHSLVVGAFAGITSSI-VSYPF 133

Query: 132 EVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAAYVIVK 191
           +V++ RL A +                             +++ T + R+       I K
Sbjct: 134 DVLRTRLVANN--------------------------QMHSMSITREVRD-------IWK 160

Query: 192 EEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDML-PSWETSLI----GL 246
            EG    ++G   +           F  Y T++    E  +T      WE + +    G 
Sbjct: 161 LEGLPGFFKGSIASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGT 220

Query: 247 ISGALGPFSNAPLDTIKTRLQ--KDKSTSKDSGWSRILA---------IGRQLIREEGFR 295
           I G +      PL+TI+ R+Q    K   K S  S +           IG Q++++EG  
Sbjct: 221 IGGVIAKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVS 280

Query: 296 ALYKGITPRVMRVAPGQAVTFTVYE 320
           +LY+GI   + +  P   V+F  YE
Sbjct: 281 SLYRGILVALSKTIPTTFVSFWGYE 305

 Score = 55.5 bits (132), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 46/89 (51%)

Query: 238 SWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRAL 297
           +W+T L G +SG L     AP+DTIK RLQ   +       S+++ + R +I+ EG R+ 
Sbjct: 16  AWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSF 75

Query: 298 YKGITPRVMRVAPGQAVTFTVYELIRKKL 326
           +KG  P  +      +  F+ Y L  + L
Sbjct: 76  WKGNIPGSLLYVTYGSAQFSSYSLFNRYL 104

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 51/228 (22%), Positives = 90/228 (39%), Gaps = 38/228 (16%)

Query: 13  NLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYK 72
           +LV G  AG+  ++  +P D ++ R+     A  Q   +       RDI   EG    +K
Sbjct: 115 SLVVGAFAGITSSIVSYPFDVLRTRLV----ANNQ-MHSMSITREVRDIWKLEGLPGFFK 169

Query: 73  GLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGV-------VSTGNTFVAGVGAGITEAV 125
           G  A +  I    +I F +YE  R    + +          ++T N     +G  I  A 
Sbjct: 170 GSIASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVI--AK 227

Query: 126 MVVNPMEVVKIRLQ---AQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNA 182
           ++  P+E ++ R+Q   ++H+      + + GS                        R  
Sbjct: 228 IITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFA-----------------RIG 270

Query: 183 IQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEY 230
           +Q    I+K+EG  +LYRG+ +  ++       +F  Y T    L+ Y
Sbjct: 271 LQ----ILKQEGVSSLYRGILVALSKTIPTTFVSFWGYETAIHYLRMY 314

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 48/218 (22%), Positives = 82/218 (37%), Gaps = 39/218 (17%)

Query: 107 VSTGNTFVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYV-PLKAQLAGSVXXXXXXXXX 165
           V+   T +AG  +G+  A  +  PM+ +KIRLQ      + P  +Q+             
Sbjct: 14  VAAWKTLLAGAVSGLL-ARSITAPMDTIKIRLQLTPANGLKPFGSQV------------- 59

Query: 166 XXXXXENVAATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKS 225
                            ++ A  ++K EG R+ ++G    +    T   A F+ YS    
Sbjct: 60  -----------------MEVARSMIKNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNR 102

Query: 226 RLQEYHQTDMLPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIG 285
            L  +     L S    ++G  +G      + P D ++TRL  +      S    I    
Sbjct: 103 YLTPFGLEARLHS---LVVGAFAGITSSIVSYPFDVLRTRLVANNQMHSMS----ITREV 155

Query: 286 RQLIREEGFRALYKGITPRVMRVAPGQAVTFTVYELIR 323
           R + + EG    +KG    +  +    ++ F  YE IR
Sbjct: 156 RDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYETIR 193

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 40/92 (43%), Gaps = 10/92 (10%)

Query: 12  INLVAGGTAGLFEALCCHPLDTIKVRMQIY-SRAREQGQR---------ARGFIGTARDI 61
           +N  AG   G+   +   PL+TI+ RMQ   S+  E+  R           GF      I
Sbjct: 214 LNHSAGTIGGVIAKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQI 273

Query: 62  STQEGFLALYKGLGAVVIGIIPKMAIRFTSYE 93
             QEG  +LY+G+   +   IP   + F  YE
Sbjct: 274 LKQEGVSSLYRGILVALSKTIPTTFVSFWGYE 305

>Scas_721.129
          Length = 323

 Score = 68.6 bits (166), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 76/315 (24%), Positives = 113/315 (35%), Gaps = 39/315 (12%)

Query: 13  NLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRA-RGFIGTARDISTQEGFLALY 71
           + +AGG A        +P++ +K+RMQ+       GQ+  R  I     I   EG   L 
Sbjct: 24  SFIAGGMAACIAVTFTNPIELVKIRMQLQGELAAVGQKVYRNPIQGMGVIFRNEGIRGLQ 83

Query: 72  KGLGAVVIGIIPKMAIRFTSYEFFRTLLA------DRQTGVVSTGNTFVAGVGAGITEAV 125
           KGL A  I  I     R   YE  R  L       +    +        AG  +GI  AV
Sbjct: 84  KGLVAAYIYQIGLNGSRLGFYEPIRNALNSTFYPNEESHKIQKVSINVAAGASSGIIGAV 143

Query: 126 MVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQA 185
            + +P+ +VK R+Q+                                +     YRN    
Sbjct: 144 -IGSPLFLVKTRMQS--------------------------YSDAIKIGEQTHYRNVWNG 176

Query: 186 AYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPSWETSLIG 245
              I + EG + L+RG+     R          +Y+T K+ L +       P    +   
Sbjct: 177 LSTIARTEGFKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLKNDLMKDGPGLHLTA-S 235

Query: 246 LISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITPRV 305
            ISG        P D I TR+   K           +    + +R EG  ALYKG   ++
Sbjct: 236 TISGLGVAVVMNPWDVILTRIYNQKGNLYKGPVDCFV----KTVRTEGISALYKGFQAQI 291

Query: 306 MRVAPGQAVTFTVYE 320
           +R+AP   +  T  E
Sbjct: 292 LRIAPHTIICLTFME 306

 Score = 67.0 bits (162), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 63/236 (26%), Positives = 96/236 (40%), Gaps = 52/236 (22%)

Query: 107 VSTGNTFVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXX 166
           VS   +F+AG G     AV   NP+E+VKIR+Q        L+ +LA             
Sbjct: 19  VSKFGSFIAG-GMAACIAVTFTNPIELVKIRMQ--------LQGELAA------------ 57

Query: 167 XXXXENVAATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSR 226
                       YRN IQ   VI + EG R L +G+      Q    G+    Y  +++ 
Sbjct: 58  -------VGQKVYRNPIQGMGVIFRNEGIRGLQKGLVAAYIYQIGLNGSRLGFYEPIRNA 110

Query: 227 LQEYHQTDMLPSWETSLI---------GLISGALGPFSNAPLDTIKTRLQK-------DK 270
           L     +   P+ E+  I         G  SG +G    +PL  +KTR+Q         +
Sbjct: 111 LN----STFYPNEESHKIQKVSINVAAGASSGIIGAVIGSPLFLVKTRMQSYSDAIKIGE 166

Query: 271 STSKDSGWSRILAIGRQLIREEGFRALYKGITPRVMRVAPGQAVTFTVYELIRKKL 326
            T   + W+ +  I R     EGF+ L++GI   ++R   G +V   +Y   +  L
Sbjct: 167 QTHYRNVWNGLSTIAR----TEGFKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFL 218

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 63/133 (47%), Gaps = 3/133 (2%)

Query: 11  AINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRA--RGFIGTARDISTQEGFL 68
           +IN+ AG ++G+  A+   PL  +K RMQ YS A + G++   R        I+  EGF 
Sbjct: 128 SINVAAGASSGIIGAVIGSPLFLVKTRMQSYSDAIKIGEQTHYRNVWNGLSTIARTEGFK 187

Query: 69  ALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNTFVAGVGAGITEAVMVV 128
            L++G+ A ++      +++   Y   +  L          G    A   +G+  AV V+
Sbjct: 188 GLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLKNDLMKDGPGLHLTASTISGLGVAV-VM 246

Query: 129 NPMEVVKIRLQAQ 141
           NP +V+  R+  Q
Sbjct: 247 NPWDVILTRIYNQ 259

 Score = 36.2 bits (82), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 44/97 (45%), Gaps = 13/97 (13%)

Query: 1   MSNRKNSSHPAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARG----FIG 56
           + N      P ++L A   +GL  A+  +P D I  R  IY+   ++G   +G    F+ 
Sbjct: 219 LKNDLMKDGPGLHLTASTISGLGVAVVMNPWDVILTR--IYN---QKGNLYKGPVDCFVK 273

Query: 57  TARDISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYE 93
           T R     EG  ALYKG  A ++ I P   I  T  E
Sbjct: 274 TVRT----EGISALYKGFQAQILRIAPHTIICLTFME 306

>Scas_669.6
          Length = 373

 Score = 68.9 bits (167), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 78/325 (24%), Positives = 122/325 (37%), Gaps = 57/325 (17%)

Query: 29  HPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFL-ALYKGLGAVVIGIIPKMAI 87
           H LDT+K R Q          + +      R I  +EG    LY G  A ++G  P  AI
Sbjct: 70  HSLDTVKTRQQ----GAPMTPKYKNMTTAYRTIFLEEGIARGLYGGYFAAMLGSFPSAAI 125

Query: 88  RFTSYEFF-RTLLADRQTGVVSTGNTFVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYV 146
            F +YE+  R ++ D   G   T +   AG+      + + V P EV+K RLQ Q     
Sbjct: 126 FFGTYEWCKRKMIGD--LGFNDTVSHLSAGLLGDFVSSFVYV-PSEVLKTRLQLQGRVNN 182

Query: 147 PLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAAYVIVKEEGPRALYRGVSLTA 206
           P                           +   YR+   A  +IV  EG +AL+ G   T 
Sbjct: 183 PF------------------------FQSGYNYRSLRTAIRIIVNTEGVKALFFGYKATL 218

Query: 207 ARQATNQGANFTVYSTLKSRLQEYHQTDM----LPSWETSLIGLISGALGPFSNAPLDTI 262
           AR        F  Y   +    +  + D+    L        G I+G L      P+D I
Sbjct: 219 ARDLPFSALQFGFYEKFRQTAFKLEKKDITKHNLSIPNEIFTGAIAGGLAGIITTPMDVI 278

Query: 263 KTRLQKDKS-------------TSKDSGWSRILAIGRQLIR-------EEGFRALYKGIT 302
           KTRLQ  ++             ++K +  SR + +   + R        EG    + G+ 
Sbjct: 279 KTRLQTQQADINPNSATTVGAISAKTNKKSRPIVLSNSIFRSLKLVYQSEGVIGFFSGVG 338

Query: 303 PRVMRVAPGQAVTFTVYELIRKKLE 327
           PR +  +   ++   +Y++  + L 
Sbjct: 339 PRFVWTSVQSSIMLLLYQMTLRLLN 363

 Score = 36.2 bits (82), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 34/71 (47%), Gaps = 4/71 (5%)

Query: 259 LDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGF-RALYKGITPRVMRVAPGQAVTFT 317
           LDT+KTR Q    T K   +  +    R +  EEG  R LY G    ++   P  A+ F 
Sbjct: 72  LDTVKTRQQGAPMTPK---YKNMTTAYRTIFLEEGIARGLYGGYFAAMLGSFPSAAIFFG 128

Query: 318 VYELIRKKLEG 328
            YE  ++K+ G
Sbjct: 129 TYEWCKRKMIG 139

>AFL196W [2999] [Homologous to ScYMR166C - SH]
           complement(66955..68040) [1086 bp, 361 aa]
          Length = 361

 Score = 68.9 bits (167), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 80/311 (25%), Positives = 125/311 (40%), Gaps = 44/311 (14%)

Query: 29  HPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFL-ALYKGLGAVVIGIIPKMAI 87
           H LDT+K R Q          + R  I   R ++ +EG    LY G GA ++G  P  A+
Sbjct: 72  HSLDTVKTRQQ----GAPGEVKYRHMISAYRTLALEEGVRRGLYGGYGAAMLGSFPSAAV 127

Query: 88  RFTSYEFF-RTLLADRQTGVVSTGNTFVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYV 146
            F +YE+  R ++ + Q  +  T +   AG    +  +V+ V P EV+K RLQ Q     
Sbjct: 128 FFGTYEWVKRQMINEWQ--IHETYSHLAAGFLGDLFSSVVYV-PSEVLKTRLQLQGC--- 181

Query: 147 PLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAAYVIVKEEGPRALYRGVSLTA 206
                                    +  +   YR    A   IV+ EG  AL+ G   T 
Sbjct: 182 ---------------------YNNRHFQSGYNYRGLSDAVRTIVRTEGVSALFFGYKATL 220

Query: 207 ARQATNQGANFTVYSTLK--SRLQEYHQTDMLPSWETSLI-GLISGALGPFSNAPLDTIK 263
           +R        F  Y   +  + L E    D   S+   ++ G  +G L      PLD +K
Sbjct: 221 SRDLPFSALQFAFYERFRKWAFLLERKPVDGHLSFTAEVVTGASAGGLAGIITTPLDVVK 280

Query: 264 TRLQK----DKSTSKDSGWSRIL-AIGRQL---IREEGFRALYKGITPRVMRVAPGQAVT 315
           TR+Q        T   S  +R+  +I R L   +R EG    + G+ PR +  +   ++ 
Sbjct: 281 TRIQTQPRGSAGTPDASAPARLNGSIFRSLLVVLRYEGLGGAFSGVGPRFIWTSIQSSIM 340

Query: 316 FTVYELIRKKL 326
             +Y+   + L
Sbjct: 341 LLLYQTALRTL 351

 Score = 54.7 bits (130), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 66/137 (48%), Gaps = 9/137 (6%)

Query: 13  NLVAGGTAGLFEALCCHPLDTIKVRMQIY----SRAREQGQRARGFIGTARDISTQEGFL 68
           +L AG    LF ++   P + +K R+Q+     +R  + G   RG     R I   EG  
Sbjct: 151 HLAAGFLGDLFSSVVYVPSEVLKTRLQLQGCYNNRHFQSGYNYRGLSDAVRTIVRTEGVS 210

Query: 69  ALYKGLGAVVIGIIPKMAIRFTSYEFFR--TLLADRQ--TGVVSTGNTFVAGVGAGITEA 124
           AL+ G  A +   +P  A++F  YE FR    L +R+   G +S     V G  AG   A
Sbjct: 211 ALFFGYKATLSRDLPFSALQFAFYERFRKWAFLLERKPVDGHLSFTAEVVTGASAG-GLA 269

Query: 125 VMVVNPMEVVKIRLQAQ 141
            ++  P++VVK R+Q Q
Sbjct: 270 GIITTPLDVVKTRIQTQ 286

>Scas_562.12
          Length = 300

 Score = 68.2 bits (165), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 82/332 (24%), Positives = 129/332 (38%), Gaps = 64/332 (19%)

Query: 14  LVAGGTAGLFEALCCHPLDTIKVR-MQIYSRAREQGQRARGFIGTARDISTQEGFLALYK 72
           L+   +AG+ E    HP+DTI  R M  +++     +  R            +    L+ 
Sbjct: 14  LLGSASAGILEIGVFHPVDTISKRLMSNHTKIGNSHELNRVIFREHFSEPLGKRLFTLFP 73

Query: 73  GLGAVVIGIIPKMAIRFTSYEFFRTLLADR-----------QTGVVSTGNTFVAGVGAGI 121
           GLG      + +   ++    F    L              +TG      T  AG   GI
Sbjct: 74  GLGYAASYKVLQRVYKYGGQPFANEFLNKHYKKDFDSAFGEKTGKAMRSAT--AGSLIGI 131

Query: 122 TEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRN 181
            E V++  P++V+KI+ Q     +                                K R 
Sbjct: 132 GEIVLL--PLDVLKIKRQTNPEAF--------------------------------KGRG 157

Query: 182 AIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSR---LQEYHQTDMLPS 238
            ++    I+K+EG   LYRG   TAAR A    A F   +  K     L++Y Q     S
Sbjct: 158 FVK----ILKDEGIFNLYRGWGWTAARNAPGSFALFGGNAFAKEYILGLEDYSQA----S 209

Query: 239 WETSLIGLISGA-LGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRAL 297
           W  + I  I GA      +APLD IKTR+Q     + ++G    L I +   + EG  A 
Sbjct: 210 WSQNFISSIVGASCSLIVSAPLDVIKTRIQNRSFDNPETG----LTIVKNTFKNEGITAF 265

Query: 298 YKGITPRVMRVAPGQAVTFTVYELIRKKLEGL 329
           +KG+TP+++   P    +F + + +  K + L
Sbjct: 266 FKGLTPKLLTTGPKLVFSFALAQSLIPKFDSL 297

>YGR257C (MTM1) [2204] chr7 complement(1006210..1007310) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [1101 bp, 366 aa]
          Length = 366

 Score = 68.6 bits (166), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 66/278 (23%), Positives = 116/278 (41%), Gaps = 45/278 (16%)

Query: 61  ISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNTFVAGVGAG 120
           I++ EG  +L++G+   ++  IP   + F+ YE+ R +     T    T N    G  A 
Sbjct: 112 IASVEGITSLWRGISLTLLMAIPANMVYFSGYEYIRDVSPIAST--YPTLNPLFCGAIAR 169

Query: 121 ITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYR 180
           +  A  +  P+E+VK +LQ+     +P  ++   +                        +
Sbjct: 170 VFAATSIA-PLELVKTKLQS-----IPRSSKSTKTWMMV--------------------K 203

Query: 181 NAIQAAYVIVKEEGP-RALYRGVSLTAARQATNQGANFTVYSTLKSRL---------QEY 230
           + +      +K  GP RAL++G+ +T  R        ++ Y   K RL         ++ 
Sbjct: 204 DLLNETRQEMKMVGPSRALFKGLEITLWRDVPFSAIYWSSYELCKERLWLDSTRFASKDA 263

Query: 231 HQTDMLPSWETSLIGLISGALGPFSNAPLDTIKTRLQ---KDKSTSKDSGWSR-ILAIGR 286
           +    + S+ +   G ISG +      P D  KTR Q    + S  K    SR +     
Sbjct: 264 NWVHFINSFAS---GCISGMIAAICTHPFDVGKTRWQISMMNNSDPKGGNRSRNMFKFLE 320

Query: 287 QLIREEGFRALYKGITPRVMRVAPGQAVTFTVYELIRK 324
            + R EG  ALY G+  RV+++ P  A+  + YE+ +K
Sbjct: 321 TIWRTEGLAALYTGLAARVIKIRPSCAIMISSYEISKK 358

 Score = 60.8 bits (146), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 64/256 (25%), Positives = 110/256 (42%), Gaps = 33/256 (12%)

Query: 99  LADRQTGVVSTGNTFVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPL-----KAQLA 153
           ++DR T    T    +   GAG     +++ PM+VV+IRLQ Q +  +P       A++ 
Sbjct: 1   MSDRNTSNSLTLKERMLSAGAGSVLTSLILTPMDVVRIRLQQQQM--IPDCSCDGAAEVP 58

Query: 154 GSVXXXXXXXXXXXXXXENVA------------------ATPKYRNAIQAAYVIVKEEGP 195
            +V              +N+                   ++ K+   ++A   I   EG 
Sbjct: 59  NAVSSGSKMKTFTNVGGQNLNNAKIFWESACFQELHCKNSSLKFNGTLEAFTKIASVEGI 118

Query: 196 RALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPSWETSLIGLISGALGPFS 255
            +L+RG+SLT           F+ Y  ++  +     T   P+      G I+      S
Sbjct: 119 TSLWRGISLTLLMAIPANMVYFSGYEYIRD-VSPIAST--YPTLNPLFCGAIARVFAATS 175

Query: 256 NAPLDTIKTRLQKDKSTSKDSG-W---SRILAIGRQLIREEG-FRALYKGITPRVMRVAP 310
            APL+ +KT+LQ    +SK +  W     +L   RQ ++  G  RAL+KG+   + R  P
Sbjct: 176 IAPLELVKTKLQSIPRSSKSTKTWMMVKDLLNETRQEMKMVGPSRALFKGLEITLWRDVP 235

Query: 311 GQAVTFTVYELIRKKL 326
             A+ ++ YEL +++L
Sbjct: 236 FSAIYWSSYELCKERL 251

 Score = 59.7 bits (143), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 35/104 (33%), Positives = 46/104 (44%), Gaps = 3/104 (2%)

Query: 2   SNRKNSSHPAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQ---GQRARGFIGTA 58
           S   N  H   +  +G  +G+  A+C HP D  K R QI          G R+R      
Sbjct: 260 SKDANWVHFINSFASGCISGMIAAICTHPFDVGKTRWQISMMNNSDPKGGNRSRNMFKFL 319

Query: 59  RDISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADR 102
             I   EG  ALY GL A VI I P  AI  +SYE  + +  ++
Sbjct: 320 ETIWRTEGLAALYTGLAARVIKIRPSCAIMISSYEISKKVFGNK 363

 Score = 48.1 bits (113), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 68/146 (46%), Gaps = 15/146 (10%)

Query: 7   SSHPAIN-LVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQE 65
           S++P +N L  G  A +F A    PL+ +K ++Q   R+  +  +    +    + + QE
Sbjct: 154 STYPTLNPLFCGAIARVFAATSIAPLELVKTKLQSIPRS-SKSTKTWMMVKDLLNETRQE 212

Query: 66  GFL-----ALYKGLGAVVIGIIPKMAIRFTSYEFFR-------TLLADRQTGVVSTGNTF 113
             +     AL+KGL   +   +P  AI ++SYE  +       T  A +    V   N+F
Sbjct: 213 MKMVGPSRALFKGLEITLWRDVPFSAIYWSSYELCKERLWLDSTRFASKDANWVHFINSF 272

Query: 114 VAGVGAGITEAVMVVNPMEVVKIRLQ 139
            +G  +G+  A+   +P +V K R Q
Sbjct: 273 ASGCISGMIAAI-CTHPFDVGKTRWQ 297

>KLLA0D14036g complement(1203522..1204817) some similarities with
           sp|P40556 Saccharomyces cerevisiae YIL006w, hypothetical
           start
          Length = 431

 Score = 68.6 bits (166), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 89/355 (25%), Positives = 132/355 (37%), Gaps = 79/355 (22%)

Query: 12  INLVAGGTAGLFEALCCHPLDTIKVRMQ-------------IYSRARE-QGQRARGFIGT 57
           I  ++G  AG    +   PLD  K R+Q             + S A    G+   G  GT
Sbjct: 105 ITALSGALAGFLAGVIVCPLDVAKTRLQAQGLQLNGPVTRPVGSVATTFGGKYYSGIWGT 164

Query: 58  ARDISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNTFVAGV 117
              I   E    LYKG+  +V+G  P   I F+ YE  R  L+  +       + F++  
Sbjct: 165 LTTIVRDESIRGLYKGIVPIVLGYFPTWMIYFSVYE--RCKLSYPR---YFNNSEFLSHS 219

Query: 118 GAGITEAVM---VVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVA 174
            + +T   +   + NP+ VVK RL  Q                             +N+ 
Sbjct: 220 MSALTAGAISTTLTNPIWVVKTRLMLQ---------------------------SGKNIK 252

Query: 175 ATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTD 234
               Y+N + A   I K EG ++ Y G+ + +     +   +F VY  LK  L  Y    
Sbjct: 253 GMTHYKNTLDAFIKIYKVEGIKSFYSGL-IPSLFGLLHVAIHFPVYEKLKKVLHCYPSGR 311

Query: 235 MLPSWETSLIG-----------------LISGALGPFSNA-----PLDTIKTRLQKDKST 272
             P+ ET  +                  LI  + G    A     P + ++TRLQ  KS 
Sbjct: 312 --PNQETMNVNGNSNPQTTGSTNFQLGRLIVASCGSKMIASTLTYPHEILRTRLQL-KSD 368

Query: 273 SKDSGWSRILAIGRQLIREEGFRALYKGITPRVMRVAPGQAVTFTVYELIRKKLE 327
            K S    I +I R    +EG R  Y G    + R  P  A+T   +E  RK  +
Sbjct: 369 MKPS----IKSIIRTTYAKEGIRGFYSGFLTNMFRTVPASAITLVSFEYFRKHFK 419

>KLLA0C13431g 1145919..1146905 similar to sgd|S0005626 Saccharomyces
           cerevisiae YOR100c CRC1 mitochondrial carnitine carrier,
           member of the mitochondrial carrier (MCF) family, start
           by similarity
          Length = 328

 Score = 67.8 bits (164), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 82/333 (24%), Positives = 127/333 (38%), Gaps = 60/333 (18%)

Query: 13  NLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLAL-- 70
           +L AGG  G+   L  HP D +KVR Q  ++AR         +  AR  +      A+  
Sbjct: 31  SLAAGGVGGVCAVLTGHPFDLVKVRCQ-SNQARSAMDAVSHILQAARQAAGPTSLNAVRG 89

Query: 71  -YKGLGAVVIGIIPKMAIRFTSYEFFRTLLAD------RQTGVVSTGNTFVAGVGAGITE 123
            YKG+   ++G+ P  A+ F  Y+  + L+             V    T      AG   
Sbjct: 90  FYKGVVPPLLGVTPIFAVSFWGYDVGKKLVTSVPSSAASGAAAVEPELTLSQMAAAGFIS 149

Query: 124 AV---MVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYR 180
           A+   +V  P E VK+ LQ                                    T    
Sbjct: 150 AIPTTLVTAPTERVKVVLQ-----------------------------------TTQGKA 174

Query: 181 NAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEY--HQTDMLPS 238
           + + AA  IV+ +G ++L++G   T +R        F  Y   K  L +   H +  L  
Sbjct: 175 SFLDAAKQIVRTQGFQSLFKGSLATLSRDGPGSALYFASYEICKEYLNKASGHTSGELSI 234

Query: 239 WETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREE-GFRAL 297
               + G ++G        P+DT+KT+LQ   S+SK      +L + R +     G +  
Sbjct: 235 TNVCISGGMAGVSMWVVVFPIDTVKTQLQ---SSSKR---QSMLEVTRMIYNTRGGIKGF 288

Query: 298 YKGITPRVMRVAPGQAVTFTVYELIR---KKLE 327
           + G+ P ++R  P  A TF   EL     KK E
Sbjct: 289 FPGVGPAILRSFPANAATFLGVELTHSLFKKFE 321

>YJR077C (MIR1) [2970] chr10 complement(577169..578104) Phosphate
           transporter of the mitochondrial carrier (MCF) family
           [936 bp, 311 aa]
          Length = 311

 Score = 67.8 bits (164), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 71/310 (22%), Positives = 125/310 (40%), Gaps = 61/310 (19%)

Query: 30  PLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYKGLGAVVIGIIPKMAIRF 89
           P+D +K R+Q+     E     +G +G+ + I   EG  AL  G G  ++G   + A +F
Sbjct: 37  PIDVVKTRIQL-----EPTVYNKGMVGSFKQIIAGEGAGALLTGFGPTLLGYSIQGAFKF 91

Query: 90  TSYEFFRTLLADR---QTGVVSTGNTFVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYV 146
             YE F+    D     T      + ++         A + + P+E  +IRL +Q     
Sbjct: 92  GGYEVFKKFFIDNLGYDTASRYKNSVYMGSAAMAEFLADIALCPLEATRIRLVSQ----- 146

Query: 147 PLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAAYV-IVKEEGPRALYRGVSLT 205
                                         P++ N +   +  I+KEEG  + Y G +  
Sbjct: 147 ------------------------------PQFANGLVGGFSRILKEEGIGSFYSGFTPI 176

Query: 206 AARQATNQGANFTVYSTLKSRLQEYH-----QTDMLPSWETSLIGLISGALGPFSNA--- 257
             +Q     A F V+     R  E++       + L S  T+L+ L+SG     + A   
Sbjct: 177 LFKQIPYNIAKFLVFE----RASEFYYGFAGPKEKLSSTSTTLLNLLSGLTAGLAAAIVS 232

Query: 258 -PLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITPRVMRVAPGQAVTF 316
            P DT+ +++ K K   K  G S +  +  QL ++ GF   + G+  R++ V    ++ F
Sbjct: 233 QPADTLLSKVNKTK---KAPGQSTV-GLLAQLAKQLGFFGSFAGLPTRLVMVGTLTSLQF 288

Query: 317 TVYELIRKKL 326
            +Y  ++  L
Sbjct: 289 GIYGSLKSTL 298

 Score = 33.5 bits (75), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 34/70 (48%), Gaps = 4/70 (5%)

Query: 255 SNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITPRVMRVAPGQAV 314
           S  P+D +KTR+Q + +         ++   +Q+I  EG  AL  G  P ++  +   A 
Sbjct: 34  SMVPIDVVKTRIQLEPTVYNKG----MVGSFKQIIAGEGAGALLTGFGPTLLGYSIQGAF 89

Query: 315 TFTVYELIRK 324
            F  YE+ +K
Sbjct: 90  KFGGYEVFKK 99

 Score = 32.0 bits (71), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 37/140 (26%), Positives = 62/140 (44%), Gaps = 21/140 (15%)

Query: 25  ALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYKGLGAVVIGIIPK 84
           ALC  PL+  ++R+        Q Q A G +G    I  +EG  + Y G   ++   IP 
Sbjct: 132 ALC--PLEATRIRL------VSQPQFANGLVGGFSRILKEEGIGSFYSGFTPILFKQIPY 183

Query: 85  MAIRFTSY----EFFRTLLADRQTGVVSTGNT---FVAGVGAGITEAVMVVNPMEVVKIR 137
              +F  +    EF+      ++  + ST  T    ++G+ AG+  A+ V  P + +  +
Sbjct: 184 NIAKFLVFERASEFYYGFAGPKEK-LSSTSTTLLNLLSGLTAGLAAAI-VSQPADTLLSK 241

Query: 138 L----QAQHVRYVPLKAQLA 153
           +    +A     V L AQLA
Sbjct: 242 VNKTKKAPGQSTVGLLAQLA 261

 Score = 31.6 bits (70), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 46/99 (46%), Gaps = 5/99 (5%)

Query: 6   NSSHPAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQE 65
           ++S   +NL++G TAGL  A+   P DT+  ++    +A  Q       +G    ++ Q 
Sbjct: 210 STSTTLLNLLSGLTAGLAAAIVSQPADTLLSKVNKTKKAPGQST-----VGLLAQLAKQL 264

Query: 66  GFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQT 104
           GF   + GL   ++ +    +++F  Y   ++ L    T
Sbjct: 265 GFFGSFAGLPTRLVMVGTLTSLQFGIYGSLKSTLGCPPT 303

>CAGL0G01166g complement(111298..112185) highly similar to tr|Q06143
           Saccharomyces cerevisiae YLR348c DIC1, hypothetical
           start
          Length = 295

 Score = 67.0 bits (162), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 78/328 (23%), Positives = 128/328 (39%), Gaps = 65/328 (19%)

Query: 17  GGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYKGLGA 76
           GG AG+F  +  HPLD  KVR+Q     +         +   R I   EG + LY GL A
Sbjct: 13  GGAAGIFAVMNTHPLDLTKVRLQAAPIPKPT------IVQMLRSILKNEGIVGLYAGLSA 66

Query: 77  VVIGIIPKMAIRFTSYEFFR--TLLADRQTGVVST-GNTFVAGVGAGITEAVMVVNPMEV 133
            ++        RF  Y+  +   +  D+ T +    G + V+G   G+       N  ++
Sbjct: 67  SLLRQCTYTTARFGMYDALKEHVIPRDKLTNMWYLLGASMVSGALGGLAG-----NFADL 121

Query: 134 VKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAAYVIVKEE 193
           + IR+Q      +PL  +                           Y+NAI     I K E
Sbjct: 122 INIRMQNDSA--LPLDKRR-------------------------NYKNAIDGMVKIYKAE 154

Query: 194 GPRALY---------RGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPSWETSLI 244
           G ++L+         RGV +TA++  T        Y   K+ L   +  D   +      
Sbjct: 155 GAKSLFLTGWKPNMVRGVLMTASQVVT--------YDMFKNFLVTKYNMDPKKNSTHLTS 206

Query: 245 GLISGALGPFSNAPLDTIKT---RLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGI 301
            L++G +     +P D IKT      K    + DS +  ++    + I +EG   +++G 
Sbjct: 207 SLLAGFVATTVCSPADVIKTIVMNAHKKPGHNHDSSFKILM----EAINKEGPSFMFRGW 262

Query: 302 TPRVMRVAPGQAVTFTVYELIRKKLEGL 329
            P   R+AP   + F   E ++K   G+
Sbjct: 263 VPSFTRLAPFTMLIFFAMEQLKKYRVGM 290

>Kwal_23.4354
          Length = 343

 Score = 67.4 bits (163), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 77/353 (21%), Positives = 136/353 (38%), Gaps = 70/353 (19%)

Query: 14  LVAGGTAGLFEALCCHPLDTIKVRMQ---------------IYSRAREQG--------QR 50
           L++     L  +L   P+D +++R+Q               + SRA  +G        + 
Sbjct: 15  LLSAVVGSLLTSLILTPMDVVRIRLQQQKMLPDCGCETDAGLTSRASSKGVFWQDICFED 74

Query: 51  ARGFIGTARDISTQ---------EGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLAD 101
            R      R  ST          EG  +L++GL   ++   P   + F  YE  R     
Sbjct: 75  VRCKTSPVRYNSTWDAFGKIAKIEGVQSLWRGLSITLLMAAPANMVYFIGYESLRD--KS 132

Query: 102 RQTGVVSTGNTFVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXX 161
           R      T N  + G  A +  A  V  P+E+ + RLQ+     +P  +  + +      
Sbjct: 133 RLQDKYPTLNPLMCGALARVLAATTVA-PLELFRTRLQS-----IPRSSPKSTTAMMI-- 184

Query: 162 XXXXXXXXXENVAATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYS 221
                             ++ I+ +   + + G +AL+RG+ +T  R        +  Y 
Sbjct: 185 ------------------KDLIKESRYEISKVGYKALFRGLEITLWRDVPFSSIYWGCYE 226

Query: 222 TLKSRLQEYHQTDMLPS----WETSLIGLISGALGPFSNA----PLDTIKTRLQKD--KS 271
             KS +    +  ++ S    W   +   + G+ G    A    P D  KTR+Q     S
Sbjct: 227 FYKSNVSIDSEKSIVNSSNSNWNHFVNSFVGGSFGGAVAAVLTHPFDVGKTRMQITYLNS 286

Query: 272 TSKDSGWSRILAIGRQLIREEGFRALYKGITPRVMRVAPGQAVTFTVYELIRK 324
           T +      +     Q+ + EG  ALY G+ PRV+++AP  A+  + YE+ ++
Sbjct: 287 TLEKKPSKNMFKYLNQMRKSEGLAALYTGLVPRVIKIAPSCAIMISTYEVCKR 339

 Score = 65.1 bits (157), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 63/241 (26%), Positives = 108/241 (44%), Gaps = 27/241 (11%)

Query: 101 DRQTGVVSTGNTFVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVP-----LKAQLAGS 155
           ++Q G+        A VG+ +T   +++ PM+VV+IRLQ Q  + +P       A L   
Sbjct: 4   EKQKGIGLKERLLSAVVGSLLTS--LILTPMDVVRIRLQQQ--KMLPDCGCETDAGLTSR 59

Query: 156 VXXXXXXXXXXXXXXENVAATP-KYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQG 214
                               +P +Y +   A   I K EG ++L+RG+S+T    A    
Sbjct: 60  ASSKGVFWQDICFEDVRCKTSPVRYNSTWDAFGKIAKIEGVQSLWRGLSITLLMAAPANM 119

Query: 215 ANFTVYSTL--KSRLQEYHQTDMLPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKST 272
             F  Y +L  KSRLQ     D  P+    + G ++  L   + APL+  +TRLQ    +
Sbjct: 120 VYFIGYESLRDKSRLQ-----DKYPTLNPLMCGALARVLAATTVAPLELFRTRLQSIPRS 174

Query: 273 SKDSGWSRILAIGRQLIREE-------GFRALYKGITPRVMRVAPGQAVTFTVYELIRKK 325
           S  S  + ++   + LI+E        G++AL++G+   + R  P  ++ +  YE  +  
Sbjct: 175 SPKSTTAMMI---KDLIKESRYEISKVGYKALFRGLEITLWRDVPFSSIYWGCYEFYKSN 231

Query: 326 L 326
           +
Sbjct: 232 V 232

 Score = 53.5 bits (127), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 39/154 (25%), Positives = 76/154 (49%), Gaps = 14/154 (9%)

Query: 3   NRKNSSHPAIN-LVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRA---RGFIGTA 58
           +R    +P +N L+ G  A +  A    PL+  + R+Q   R+  +   A   +  I  +
Sbjct: 132 SRLQDKYPTLNPLMCGALARVLAATTVAPLELFRTRLQSIPRSSPKSTTAMMIKDLIKES 191

Query: 59  RDISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLA-DRQTGVVSTG------- 110
           R   ++ G+ AL++GL   +   +P  +I +  YEF+++ ++ D +  +V++        
Sbjct: 192 RYEISKVGYKALFRGLEITLWRDVPFSSIYWGCYEFYKSNVSIDSEKSIVNSSNSNWNHF 251

Query: 111 -NTFVAGVGAGITEAVMVVNPMEVVKIRLQAQHV 143
            N+FV G   G   AV+  +P +V K R+Q  ++
Sbjct: 252 VNSFVGGSFGGAVAAVL-THPFDVGKTRMQITYL 284

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 46/100 (46%), Gaps = 1/100 (1%)

Query: 2   SNRKNSSHPAINLVAGGTAGLFEALCCHPLDTIKVRMQI-YSRAREQGQRARGFIGTARD 60
           S+  N +H   + V G   G   A+  HP D  K RMQI Y  +  + + ++        
Sbjct: 243 SSNSNWNHFVNSFVGGSFGGAVAAVLTHPFDVGKTRMQITYLNSTLEKKPSKNMFKYLNQ 302

Query: 61  ISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLA 100
           +   EG  ALY GL   VI I P  AI  ++YE  + L +
Sbjct: 303 MRKSEGLAALYTGLVPRVIKIAPSCAIMISTYEVCKRLFS 342

>Sklu_2075.3 , Contig c2075 6414-7451 reverse complement
          Length = 345

 Score = 67.4 bits (163), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 75/316 (23%), Positives = 121/316 (38%), Gaps = 46/316 (14%)

Query: 12  INLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALY 71
           +  V+G  +G+ +    HP DTIKVR+Q      +   R +G +       TQ+G    Y
Sbjct: 62  MGFVSGMFSGIAKNAVGHPFDTIKVRLQ----TSQDSTRFKGPLDCVYKTFTQQGIRGFY 117

Query: 72  KGLGAVVIGIIPKMAIRFTSYEFFRTLLAD---RQTGVVSTGNTFVAGVGAGITEAVMVV 128
            G    ++G I   ++       +R LL          +      ++GV AG + +  + 
Sbjct: 118 LGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVS-FIA 176

Query: 129 NPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAAYV 188
            P+E+ K +LQ Q+                               A T KY   +     
Sbjct: 177 APVELAKAKLQVQY------------------------------DAKTTKYTGPVDVIKK 206

Query: 189 IVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPSWETSLIGLIS 248
           +    G R LY+G++ T   + TN    +  Y  L    +E+  T+M  +      G  S
Sbjct: 207 VYSSNGVRGLYKGLTSTLIFR-TNFVFWWGSYELLTRWFKEH--TNMSDTAINFWSGGFS 263

Query: 249 GALGPFSNA-PLDTIK-TRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITPRVM 306
            + G ++ A P D IK   L  DK       W   LA  + + R  G+R  +KG  P  +
Sbjct: 264 ASFGFWTTAYPSDVIKQVVLCNDKYDGTFRSWK--LA-AKDIWRTRGYRGFFKGFVPSFL 320

Query: 307 RVAPGQAVTFTVYELI 322
           R  P  A     +E +
Sbjct: 321 RSFPANAAALAAFEFV 336

>KLLA0B12826g 1121106..1122065 similar to sp|P32332 Saccharomyces
           cerevisiae YKL120w PMT, start by similarity
          Length = 319

 Score = 66.6 bits (161), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 74/332 (22%), Positives = 124/332 (37%), Gaps = 50/332 (15%)

Query: 3   NRKNSSHPAI---NLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRA-RGFIGTA 58
           N+K ++H      + VAGG A        +P D +K RMQ+         +     I   
Sbjct: 10  NQKTAAHKVSKFGSFVAGGLAACIAVTVTNPFDCVKTRMQLQGELHANAAKVYTNPIQAF 69

Query: 59  RDISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLAD------RQTGVVSTGNT 112
             I   EG   L KGL +  +  I     R   YE  R +L +          V   G  
Sbjct: 70  GVIFKNEGIAGLQKGLASAYLYQIALNGSRLGFYEPIRGILNNVFYPNVESHKVQHIGIN 129

Query: 113 FVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXEN 172
             AG  +G+  A  + +P+ +VK R+Q+                               +
Sbjct: 130 VAAGATSGVVGA-FIGSPLFLVKTRMQS--------------------------YSNAIH 162

Query: 173 VAATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQ 232
           +     Y +A      I + EG + L+RGV     R          +Y+  K+ L ++  
Sbjct: 163 IGQQTHYTSAFNGLATIFRSEGIKGLFRGVDAAMLRTGIGSAVQLPIYNICKNFLLKH-- 220

Query: 233 TDMLPSWETSLIGLISGALGPF----SNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQL 288
            D++   + + + L+S  +  F    +  P D + TR+   K       +S  +    + 
Sbjct: 221 -DLMN--DGTGLHLLSSTIAGFGVGVAMNPWDVVLTRVYNQKGNL----YSGPIDCFIKT 273

Query: 289 IREEGFRALYKGITPRVMRVAPGQAVTFTVYE 320
           +R EG  ALYKG   +++R+ P   +  T  E
Sbjct: 274 VRNEGLSALYKGFGAQILRIGPHTVLCLTFME 305

 Score = 66.2 bits (160), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 63/238 (26%), Positives = 96/238 (40%), Gaps = 56/238 (23%)

Query: 107 VSTGNTFVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXX 166
           VS   +FVAG G     AV V NP + VK R+Q        L+ +L  +           
Sbjct: 18  VSKFGSFVAG-GLAACIAVTVTNPFDCVKTRMQ--------LQGELHAN----------- 57

Query: 167 XXXXENVAATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSR 226
                   A   Y N IQA  VI K EG   L +G++     Q    G+    Y  ++  
Sbjct: 58  --------AAKVYTNPIQAFGVIFKNEGIAGLQKGLASAYLYQIALNGSRLGFYEPIRGI 109

Query: 227 LQEYHQTDMLPSWETSLIGL------ISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSR 280
           L      + + S +   IG+       SG +G F  +PL  +KTR+Q          +S 
Sbjct: 110 LNNVFYPN-VESHKVQHIGINVAAGATSGVVGAFIGSPLFLVKTRMQS---------YSN 159

Query: 281 ILAIGRQ------------LIREEGFRALYKGITPRVMRVAPGQAVTFTVYELIRKKL 326
            + IG+Q            + R EG + L++G+   ++R   G AV   +Y + +  L
Sbjct: 160 AIHIGQQTHYTSAFNGLATIFRSEGIKGLFRGVDAAMLRTGIGSAVQLPIYNICKNFL 217

>Scas_702.10
          Length = 302

 Score = 66.2 bits (160), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 76/318 (23%), Positives = 116/318 (36%), Gaps = 48/318 (15%)

Query: 17  GGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYKGLGA 76
           GG AG+F  +  HPLD  KVR+Q     +    R          I   E  + LY GL A
Sbjct: 16  GGAAGIFACVMTHPLDLAKVRLQAAPLPKPTLGRM------LTTILRNENVMGLYSGLSA 69

Query: 77  VVIGIIPKMAIRFTSYEFFRTLLADR----QTGVVSTGNTFVAGVGAGITEAVMVVNPME 132
            V+       +RF +Y+  +  L  +        +   + F   +G       +V N  +
Sbjct: 70  AVLRQCTYTTVRFGAYDLMKENLIPQGHINDMVYLLPCSMFSGAIGG------LVGNFAD 123

Query: 133 VVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAAYVIVKE 192
           VV IR+Q        LK +L  +                       YRNAI   Y I   
Sbjct: 124 VVNIRMQNDSA----LKPELRRN-----------------------YRNAIDGVYKIYMH 156

Query: 193 EGP-RALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPSWETSLIGLISGAL 251
           EG  + L  G      R      +    Y   K+ L      D   +       L++G +
Sbjct: 157 EGGIKTLLTGWKPNMVRGVLMTASQVVTYDVFKNYLVTKLSFDPKKNSTHLSASLLAGLV 216

Query: 252 GPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITPRVMRVAPG 311
                +P D IKTR+     T  +S     + I    I++EG   +++G  P   R+ P 
Sbjct: 217 ATTICSPADVIKTRIMNAHKTESESA----IKILTSAIKKEGPSFMFRGWLPIFTRLGPF 272

Query: 312 QAVTFTVYELIRKKLEGL 329
             + F   E ++K   G+
Sbjct: 273 TMLIFFAIEQLKKHRVGM 290

>Sklu_1119.1 YJR077C, Contig c1119 366-1289
          Length = 307

 Score = 65.9 bits (159), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 77/311 (24%), Positives = 128/311 (41%), Gaps = 63/311 (20%)

Query: 30  PLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYKGLGAVVIGIIPKMAIRF 89
           P+D +K R+Q+     E     +G I + + I + EG  AL  G G  ++G   + + +F
Sbjct: 33  PIDVVKTRIQL-----EPTVYNKGMISSFKQIISSEGAGALLTGFGPTLLGYSLQGSFKF 87

Query: 90  TSYEFFRTLLAD--RQTGVVSTGNTFVAGVGAGITE--AVMVVNPMEVVKIRLQAQHVRY 145
             YE F+ L  D       V+  N+   G  A I E  A + + P+E  +IRL +Q    
Sbjct: 88  GGYEVFKKLFIDVLGYDQAVNYKNSIYIG-SAAIAEFFADIALCPLEATRIRLVSQ---- 142

Query: 146 VPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAAYV-IVKEEGPRALYRGVSL 204
                                          P + N +   +  I+KEEG  + Y G + 
Sbjct: 143 -------------------------------PTFANGLVGGFSRILKEEGAGSFYNGFTP 171

Query: 205 TAARQATNQGANFTVYSTLKSRLQEYH-----QTDMLPSWETSLIGLISGALGPFSNA-- 257
              +Q     A F V+     R  E +       + L +  T+ I L+SG     + A  
Sbjct: 172 ILFKQIPYNIAKFLVF----ERAAEVYFGMAGPKESLSTASTTGINLLSGLTAGLAAAIV 227

Query: 258 --PLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITPRVMRVAPGQAVT 315
             P DT+ +++ K K   K  G S I  +  QL ++ GF   + G+  R++ V    ++ 
Sbjct: 228 SQPADTLLSKVNKTK---KAPGQSTI-GLLAQLAKQLGFVGSFAGLPTRLVMVGTLTSLQ 283

Query: 316 FTVYELIRKKL 326
           F +Y  ++K L
Sbjct: 284 FGIYGSLKKTL 294

 Score = 33.5 bits (75), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 34/69 (49%), Gaps = 5/69 (7%)

Query: 6   NSSHPAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQE 65
            +S   INL++G TAGL  A+   P DT+  ++    +A  Q       IG    ++ Q 
Sbjct: 206 TASTTGINLLSGLTAGLAAAIVSQPADTLLSKVNKTKKAPGQST-----IGLLAQLAKQL 260

Query: 66  GFLALYKGL 74
           GF+  + GL
Sbjct: 261 GFVGSFAGL 269

 Score = 29.3 bits (64), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 38/161 (23%), Positives = 66/161 (40%), Gaps = 21/161 (13%)

Query: 3   NRKNSSHPAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDIS 62
           N KNS    I + +   A  F  +   PL+  ++R+        Q   A G +G    I 
Sbjct: 108 NYKNS----IYIGSAAIAEFFADIALCPLEATRIRL------VSQPTFANGLVGGFSRIL 157

Query: 63  TQEGFLALYKGLGAVVIGIIPKMAIRFTSYE------FFRTLLADRQTGVVSTGNTFVAG 116
            +EG  + Y G   ++   IP    +F  +E      F      +  +   +TG   ++G
Sbjct: 158 KEEGAGSFYNGFTPILFKQIPYNIAKFLVFERAAEVYFGMAGPKESLSTASTTGINLLSG 217

Query: 117 VGAGITEAVMVVNPMEVVKIRL----QAQHVRYVPLKAQLA 153
           + AG+  A+ V  P + +  ++    +A     + L AQLA
Sbjct: 218 LTAGLAAAI-VSQPADTLLSKVNKTKKAPGQSTIGLLAQLA 257

>Scas_673.17
          Length = 314

 Score = 65.9 bits (159), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 75/311 (24%), Positives = 124/311 (39%), Gaps = 63/311 (20%)

Query: 30  PLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYKGLGAVVIGIIPKMAIRF 89
           P+D +K R+Q+     E     +G +G+ + I   EG  AL  G G  ++G   + A +F
Sbjct: 40  PVDVVKTRIQL-----EPTVYNKGMVGSFKKIIADEGAGALLTGFGPTLLGYSVQGAFKF 94

Query: 90  TSYEFFRTLLADR--QTGVVSTGNTFVAGVGAGITE--AVMVVNPMEVVKIRLQAQHVRY 145
             YE F+ L  D       V   N+   G  A + E  A + + P+E  +IRL +Q    
Sbjct: 95  GGYEVFKKLSIDTIGYENAVHYKNSVYMG-SAAVAEFLADIALCPLEATRIRLVSQ---- 149

Query: 146 VPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAAYV-IVKEEGPRALYRGVSL 204
                                          P + N +   +  I+KEEG  + Y G + 
Sbjct: 150 -------------------------------PTFANGLVGGFSRILKEEGVGSFYSGFTP 178

Query: 205 TAARQATNQGANFTVYSTLKSRLQEYHQ---------TDMLPSWETSLIGLISGALGPFS 255
              +Q     A F V+     R  E +          +DM  +    L GL +G    F 
Sbjct: 179 ILFKQIPYNIAKFLVF----ERASEVYYGIVGAKETLSDMTNTGINLLSGLTAGFAAAFV 234

Query: 256 NAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITPRVMRVAPGQAVT 315
           + P DT+ +++ K K   K  G S I  +  QL ++ G    + G+  R++ V    ++ 
Sbjct: 235 SQPADTLLSKVNKTK---KAPGQSTI-GLLAQLAKQLGVIGSFAGLPTRLIMVGTLTSLQ 290

Query: 316 FTVYELIRKKL 326
           F +Y  ++  L
Sbjct: 291 FAIYGSLKNTL 301

 Score = 34.3 bits (77), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 25/104 (24%), Positives = 49/104 (47%), Gaps = 7/104 (6%)

Query: 221 STLKSRLQEYHQTDMLPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSR 280
           +T   ++ +Y  +D    ++ +L G I       S  P+D +KTR+Q + +         
Sbjct: 6   TTDAHKIPDYAASDY---FKFALAGAIGCGTTHSSLVPVDVVKTRIQLEPTVYNKG---- 58

Query: 281 ILAIGRQLIREEGFRALYKGITPRVMRVAPGQAVTFTVYELIRK 324
           ++   +++I +EG  AL  G  P ++  +   A  F  YE+ +K
Sbjct: 59  MVGSFKKIIADEGAGALLTGFGPTLLGYSVQGAFKFGGYEVFKK 102

 Score = 30.0 bits (66), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 34/139 (24%), Positives = 61/139 (43%), Gaps = 19/139 (13%)

Query: 25  ALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYKGLGAVVIGIIPK 84
           ALC  PL+  ++R+        Q   A G +G    I  +EG  + Y G   ++   IP 
Sbjct: 135 ALC--PLEATRIRL------VSQPTFANGLVGGFSRILKEEGVGSFYSGFTPILFKQIPY 186

Query: 85  MAIRFTSY----EFFRTLLADRQT--GVVSTGNTFVAGVGAGITEAVMVVNPMEVVKIRL 138
              +F  +    E +  ++  ++T   + +TG   ++G+ AG   A  V  P + +  ++
Sbjct: 187 NIAKFLVFERASEVYYGIVGAKETLSDMTNTGINLLSGLTAGFA-AAFVSQPADTLLSKV 245

Query: 139 ----QAQHVRYVPLKAQLA 153
               +A     + L AQLA
Sbjct: 246 NKTKKAPGQSTIGLLAQLA 264

 Score = 29.6 bits (65), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 40/87 (45%), Gaps = 5/87 (5%)

Query: 6   NSSHPAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQE 65
           + ++  INL++G TAG   A    P DT+  ++    +A  Q       IG    ++ Q 
Sbjct: 213 DMTNTGINLLSGLTAGFAAAFVSQPADTLLSKVNKTKKAPGQST-----IGLLAQLAKQL 267

Query: 66  GFLALYKGLGAVVIGIIPKMAIRFTSY 92
           G +  + GL   +I +    +++F  Y
Sbjct: 268 GVIGSFAGLPTRLIMVGTLTSLQFAIY 294

>AFR253W [3445] [Homologous to ScYFR045W - SH]
           complement(892939..892986,893047..894033) [1035 bp, 344
           aa]
          Length = 344

 Score = 66.2 bits (160), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 77/336 (22%), Positives = 126/336 (37%), Gaps = 51/336 (15%)

Query: 13  NLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYK 72
           +++AG  A +F+    HP + +K   Q++          R   G A   +    F   + 
Sbjct: 23  SVIAGAAAAVFQTTMSHPFEFLKTGQQLH----------RALPGAA-AFNMLHPFKYYFS 71

Query: 73  GLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTG--VVSTGNTFVAGVGAGITEAVMVVNP 130
           G  A+ +G + K   RF ++E     L D +     ++     +AG   G  E++ VV P
Sbjct: 72  GCAALNVGTLLKTGTRFATFEQACVWLRDPEHADQPIAGPRLLLAGAITGFLESLWVV-P 130

Query: 131 MEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAAYV-- 188
            E +K          V    +L+  V                  AT      +Q A+   
Sbjct: 131 FESIKTTA-------VENALELSRRVQGEPETRAAAVSKGPAPKATFHAARPVQTAHERW 183

Query: 189 ------------------IVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEY 230
                             I +  G R   +G   T  RQ  N    FT Y+ +   L  +
Sbjct: 184 LLHYERQPSSHFAGTVLEIYRTRGVRGFLQGAMPTIFRQLGNSVVRFTTYAWIVQSLSPH 243

Query: 231 HQTDMLPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKS--TSKDSGWSRILAIGRQL 288
              D    ++    G +S A       P+D IKTR+Q   +  T K S     L    ++
Sbjct: 244 KALD---EYQAFAAGALSSAAVVALTQPIDVIKTRMQSKTAWFTYKSS-----LNCAYRI 295

Query: 289 IREEGFRALYKGITPRVMRVAPGQAVTFTVYELIRK 324
             EEGFR ++KG  PR+ +V+    ++F VY+ +  
Sbjct: 296 FVEEGFRYMWKGWVPRLFKVSLSGGISFGVYQYVEN 331

>Kwal_33.15597
          Length = 305

 Score = 65.5 bits (158), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 78/311 (25%), Positives = 125/311 (40%), Gaps = 63/311 (20%)

Query: 30  PLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYKGLGAVVIGIIPKMAIRF 89
           P+D +K R+Q+     E     +G I + + I + EG  AL  G G  ++G   + + +F
Sbjct: 33  PIDVVKTRIQL-----EPTVYNKGMISSFKQIISSEGAGALLTGFGPTLLGYSLQGSFKF 87

Query: 90  TSYEFFRTLLADR--QTGVVSTGNTFVAGVGAGITE--AVMVVNPMEVVKIRLQAQHVRY 145
             YE F+ L  D       V+  N+   G  A I E  A + + P+E  +IRL +Q    
Sbjct: 88  GGYEVFKKLFIDTLGYDQAVNYKNSIYIG-SAAIAEFFADIALCPLEATRIRLVSQ---- 142

Query: 146 VPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAAYV-IVKEEGPRALYRGVSL 204
                                          P + N +   +  I+KEEG  + Y G + 
Sbjct: 143 -------------------------------PTFANGLVGGFSRILKEEGLSSFYNGFTP 171

Query: 205 TAARQATNQGANFTVYSTLKSRLQEYHQTDMLPSWETS---------LIGLISGALGPFS 255
              +Q     A F V+     R  E +     P    S         L GL +G      
Sbjct: 172 ILFKQIPYNIAKFLVF----ERAAEVYFGMAGPKETLSTSTTTGLNLLSGLTAGLAAAIV 227

Query: 256 NAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITPRVMRVAPGQAVT 315
           + P DT+ +++ K K   K  G S I  +G QL +E GF   + G+  R++ V    ++ 
Sbjct: 228 SQPADTLLSKVNKAK---KAPGQSTIGLLG-QLAKELGFVGSFAGLPTRLVMVGTLTSLQ 283

Query: 316 FTVYELIRKKL 326
           F +Y  ++K L
Sbjct: 284 FGIYGSLKKTL 294

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 23/91 (25%), Positives = 37/91 (40%), Gaps = 10/91 (10%)

Query: 3   NRKNSSHPAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDIS 62
           N KNS    I + +   A  F  +   PL+  ++R+        Q   A G +G    I 
Sbjct: 108 NYKNS----IYIGSAAIAEFFADIALCPLEATRIRL------VSQPTFANGLVGGFSRIL 157

Query: 63  TQEGFLALYKGLGAVVIGIIPKMAIRFTSYE 93
            +EG  + Y G   ++   IP    +F  +E
Sbjct: 158 KEEGLSSFYNGFTPILFKQIPYNIAKFLVFE 188

 Score = 30.4 bits (67), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 33/62 (53%), Gaps = 5/62 (8%)

Query: 13  NLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYK 72
           NL++G TAGL  A+   P DT+  ++    +A   GQ   G +G    ++ + GF+  + 
Sbjct: 213 NLLSGLTAGLAAAIVSQPADTLLSKVNKAKKA--PGQSTIGLLG---QLAKELGFVGSFA 267

Query: 73  GL 74
           GL
Sbjct: 268 GL 269

>Kwal_27.11626
          Length = 299

 Score = 64.3 bits (155), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 89/336 (26%), Positives = 135/336 (40%), Gaps = 70/336 (20%)

Query: 1   MSNRKNSSHPAINLVAGGTAGLFEALCCHPLDTIKVRM-----QIYSRAREQGQRARGFI 55
           MSN K  S  A  ++   +AG+ E    HP+DT+  R+     +I S A+      R   
Sbjct: 1   MSNDKKQSGIA-RVLGSASAGILEIGVFHPVDTVSKRLMSNHTKISSSAQLNSVIFREHA 59

Query: 56  GTARDISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLL-----ADRQTGV-VST 109
           G A      +    L+ GLG      I +   ++    F    L     AD        T
Sbjct: 60  GEA----LGKRLFTLFPGLGYAASYKILQRVYKYGGQPFANEFLNKNFKADFDNAFGEKT 115

Query: 110 GNTF---VAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXX 166
           G       AG   GI E V++  P++V+KI+ Q     +                     
Sbjct: 116 GKALRSATAGSLIGIGEIVLL--PLDVLKIKRQTNPESF--------------------- 152

Query: 167 XXXXENVAATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSR 226
                      K R  I+    I+K+EG   LYRG   TAAR A    A F   +  K  
Sbjct: 153 -----------KGRGFIK----ILKDEG-FGLYRGWGWTAARNAPGSFALFGGNAFAKEY 196

Query: 227 ---LQEYHQTDMLPSWETSLIGLISGALGPF-SNAPLDTIKTRLQKDKSTSKDSGWSRIL 282
              L++Y       +W  + +  I GA      +APLD IKTR+Q     + +SG+ RI+
Sbjct: 197 ILGLKDYSSA----TWSQNFVSSIVGASASLIVSAPLDVIKTRIQNRHFDNPESGF-RIV 251

Query: 283 AIGRQLIREEGFRALYKGITPRVMRVAPGQAVTFTV 318
              +  ++ EG  A +KG+TP+++   P    +F +
Sbjct: 252 ---QNTLKNEGITAFFKGLTPKLLTTGPKLVFSFAL 284

>AER366W [2867] [Homologous to ScYIL134W (FLX1) - SH]
           complement(1314627..1315508) [882 bp, 293 aa]
          Length = 293

 Score = 64.3 bits (155), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 87/329 (26%), Positives = 135/329 (41%), Gaps = 63/329 (19%)

Query: 14  LVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRAR-GFIGTARDI-STQEGFLALY 71
           +++G TAG    +  HPLD +K+           G RA   + G  RDI   Q+    LY
Sbjct: 12  VISGLTAGTITTIASHPLDLLKL-----RLQLSAGNRANTTYTGLIRDIFERQQWGRELY 66

Query: 72  KGLGAVVIGIIPKMAIRFTSYEF-----FRTLLADRQTGVVS---TGNTFVAGVG-AGIT 122
           +GLG  ++G     A+ F  Y        R L  +  TG++      + ++   G +GI 
Sbjct: 67  RGLGVNLLGNSVAWALYFGCYRCAKDIALRHLGNESATGIMDRRLPAHAYMLAAGSSGIA 126

Query: 123 EAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNA 182
            AV+  NP+ V+K R+ A                                  A P Y++ 
Sbjct: 127 TAVL-TNPIWVIKTRIMA-------------------------------TSRAGP-YKST 153

Query: 183 IQAAYVIVKEEGPRALYRGVSLTAARQATNQGA-NFTVYSTLKSRLQEYHQTDM----LP 237
               Y + + EG  A +RGV    +    +QGA  F +Y TLK     +  TD     L 
Sbjct: 154 FDGVYKLYQTEGVLAFWRGV--VPSLLGVSQGAIYFALYDTLKFHYL-HSSTDKAERRLS 210

Query: 238 SWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRAL 297
             E   I  IS  +   S  P   +K++LQ   + S       I  + + +   EG R  
Sbjct: 211 VSEIIGITCISKMISVTSVYPFQLLKSKLQDFGAPSG------ITQLVQTVYSREGIRGF 264

Query: 298 YKGITPRVMRVAPGQAVTFTVYELIRKKL 326
           Y+G++  ++R  P   +TF VYE I+ +L
Sbjct: 265 YRGLSANLLRAVPATCITFFVYENIKYRL 293

>CAGL0K02915g 259026..260054 highly similar to sp|P38702
           Saccharomyces cerevisiae YHR002w LEU5, hypothetical
           start
          Length = 342

 Score = 64.3 bits (155), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 78/354 (22%), Positives = 138/354 (38%), Gaps = 78/354 (22%)

Query: 15  VAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIG---TARDISTQEGFLALY 71
           +AGG +G        PLD IK+  Q  +      + A   +G    A+ I   +G    +
Sbjct: 23  LAGGVSGSCAKTLIAPLDRIKILFQ--TSNPHYSKYAGSLVGLYEAAKHIWINDGIRGFF 80

Query: 72  KGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNTFVAGVGAGITEAVMVVNPM 131
           +G    ++ I P  A++F +YE  R++L   +    S      +G  AG+  +V +  P+
Sbjct: 81  QGHSVTLLRIFPYAAVKFVAYEQIRSILIPSRE-YESHWRRLASGSLAGLC-SVFITYPL 138

Query: 132 EVVKIRLQ--AQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAAYVI 189
           ++ ++RL    +H R                                 K R+ ++  Y  
Sbjct: 139 DLTRVRLAYVTEHKRV--------------------------------KLRDIVKTIYHE 166

Query: 190 VKEEG-------PRAL------YRGVSLTAARQATNQGANF----TVYSTLKSRL----- 227
              EG       P+        YRG   T        G +F     ++  +KS L     
Sbjct: 167 PASEGLTSHLLVPKWFAHWCNFYRGYVPTVLGMIPYAGVSFFAHDLIHDIMKSSLMAPYA 226

Query: 228 ------------QEYHQTDMLPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSK- 274
                       ++  Q   L +W   + G +SG L   +  PL+ I+ RLQ    + + 
Sbjct: 227 VKQLSSQEELERKKLRQKTPLRTWAELVAGGLSGILSQTAAYPLEIIRRRLQVSTLSPRK 286

Query: 275 --DSGWSRILAIGRQLIREEGFRALYKGITPRVMRVAPGQAVTFTVYELIRKKL 326
             D  +  I +I R + +E+G+R  + G++   ++V P  A +F VYE ++  L
Sbjct: 287 MYDHKFQSISSIARIIYQEKGWRGFFVGLSIGYIKVTPMVACSFFVYERMKWHL 340

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 40/83 (48%), Gaps = 2/83 (2%)

Query: 13  NLVAGGTAGLFEALCCHPLDTIKVRMQI--YSRAREQGQRARGFIGTARDISTQEGFLAL 70
            LVAGG +G+      +PL+ I+ R+Q+   S  +    + +     AR I  ++G+   
Sbjct: 252 ELVAGGLSGILSQTAAYPLEIIRRRLQVSTLSPRKMYDHKFQSISSIARIIYQEKGWRGF 311

Query: 71  YKGLGAVVIGIIPKMAIRFTSYE 93
           + GL    I + P +A  F  YE
Sbjct: 312 FVGLSIGYIKVTPMVACSFFVYE 334

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 52/262 (19%), Positives = 92/262 (35%), Gaps = 65/262 (24%)

Query: 1   MSNRKNSSHPAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARD 60
           + +R+  SH    L +G  AGL      +PLD  +VR+   +  +    + R  + T   
Sbjct: 109 IPSREYESHWR-RLASGSLAGLCSVFITYPLDLTRVRLAYVTEHKR--VKLRDIVKTIYH 165

Query: 61  ISTQEG-------------FLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLAD------ 101
               EG             +   Y+G    V+G+IP   + F +++    ++        
Sbjct: 166 EPASEGLTSHLLVPKWFAHWCNFYRGYVPTVLGMIPYAGVSFFAHDLIHDIMKSSLMAPY 225

Query: 102 ----------------RQTGVVSTGNTFVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRY 145
                           RQ   + T    VAG  +GI        P+E+++ RLQ   +  
Sbjct: 226 AVKQLSSQEELERKKLRQKTPLRTWAELVAGGLSGILSQT-AAYPLEIIRRRLQVSTLS- 283

Query: 146 VPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAAYVIVKEEGPRALYRGVSLT 205
            P K                            K+++    A +I +E+G R  + G+S+ 
Sbjct: 284 -PRKMY------------------------DHKFQSISSIARIIYQEKGWRGFFVGLSIG 318

Query: 206 AARQATNQGANFTVYSTLKSRL 227
             +       +F VY  +K  L
Sbjct: 319 YIKVTPMVACSFFVYERMKWHL 340

 Score = 37.4 bits (85), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 42/88 (47%), Gaps = 2/88 (2%)

Query: 241 TSLIGLISGALGPFSNAPLDTIKTRLQ-KDKSTSKDSG-WSRILAIGRQLIREEGFRALY 298
           + L G +SG+      APLD IK   Q  +   SK +G    +    + +   +G R  +
Sbjct: 21  SGLAGGVSGSCAKTLIAPLDRIKILFQTSNPHYSKYAGSLVGLYEAAKHIWINDGIRGFF 80

Query: 299 KGITPRVMRVAPGQAVTFTVYELIRKKL 326
           +G +  ++R+ P  AV F  YE IR  L
Sbjct: 81  QGHSVTLLRIFPYAAVKFVAYEQIRSIL 108

>YHR002W (LEU5) [2287] chr8 (108806..109879) Protein with similarity
           to Grave's disease protein, member of the mitochondrial
           carrier (MCF) family of membrane transporters [1074 bp,
           357 aa]
          Length = 357

 Score = 63.9 bits (154), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 81/329 (24%), Positives = 139/329 (42%), Gaps = 34/329 (10%)

Query: 15  VAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRAR-GFIGTARDISTQEGFLALYKG 73
           +AGG +G        PLD IK+  Q  +    +   +  G +  A+ I   +G    ++G
Sbjct: 38  LAGGISGSCAKTLIAPLDRIKILFQTSNPHYTKYTGSLIGLVEAAKHIWINDGVRGFFQG 97

Query: 74  LGAVVIGIIPKMAIRFTSYEFFR-TLLADRQTGVVSTGNTFVAGVGAGITEAVMVVNPME 132
             A ++ I P  A++F +YE  R TL+  ++    S     V+G  AG+  +V +  P++
Sbjct: 98  HSATLLRIFPYAAVKFVAYEQIRNTLIPSKE--FESHWRRLVSGSLAGLC-SVFITYPLD 154

Query: 133 VVKIRL--QAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAAYVIV 190
           +V++RL  + +H R V L     G +              +N    P +       Y   
Sbjct: 155 LVRVRLAYETEHKR-VKL-----GRIIKKIYKEPASATLIKN-DYIPNWFCHWCNFY--- 204

Query: 191 KEEGPRAL----YRGVSLTAARQATN--QGANFTVYSTLK-------SRLQEYHQTDMLP 237
           +   P  L    Y GVS  A     +  +   F  YS L+        R+Q+  Q   L 
Sbjct: 205 RGYVPTVLGMIPYAGVSFFAHDLLHDVLKSPFFAPYSVLELSEDDELERVQK-KQRRPLR 263

Query: 238 SWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSK---DSGWSRILAIGRQLIREEGF 294
           +W   + G ++G     +  P + I+ RLQ    + K   D  +  I  I   + +E G 
Sbjct: 264 TWAELISGGLAGMASQTAAYPFEIIRRRLQVSALSPKTMYDHKFQSISEIAHIIFKERGV 323

Query: 295 RALYKGITPRVMRVAPGQAVTFTVYELIR 323
           R  + G++   ++V P  A +F VYE ++
Sbjct: 324 RGFFVGLSIGYIKVTPMVACSFFVYERMK 352

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 46/227 (20%), Positives = 83/227 (36%), Gaps = 43/227 (18%)

Query: 115 AGVGAGIT--EAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXEN 172
           +G+  GI+   A  ++ P++ +KI  Q  +  Y      L G V                
Sbjct: 36  SGLAGGISGSCAKTLIAPLDRIKILFQTSNPHYTKYTGSLIGLV---------------- 79

Query: 173 VAATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQ 232
                      +AA  I   +G R  ++G S T  R        F  Y  +++ L     
Sbjct: 80  -----------EAAKHIWINDGVRGFFQGHSATLLRIFPYAAVKFVAYEQIRNTLIP--S 126

Query: 233 TDMLPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQ----- 287
            +    W   + G ++G    F   PLD ++ RL  +    +      I  I ++     
Sbjct: 127 KEFESHWRRLVSGSLAGLCSVFITYPLDLVRVRLAYETEHKRVKLGRIIKKIYKEPASAT 186

Query: 288 LIREE-------GFRALYKGITPRVMRVAPGQAVTFTVYELIRKKLE 327
           LI+ +        +   Y+G  P V+ + P   V+F  ++L+   L+
Sbjct: 187 LIKNDYIPNWFCHWCNFYRGYVPTVLGMIPYAGVSFFAHDLLHDVLK 233

 Score = 32.3 bits (72), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 35/82 (42%), Gaps = 2/82 (2%)

Query: 14  LVAGGTAGLFEALCCHPLDTIKVRMQI--YSRAREQGQRARGFIGTARDISTQEGFLALY 71
           L++GG AG+      +P + I+ R+Q+   S       + +     A  I  + G    +
Sbjct: 268 LISGGLAGMASQTAAYPFEIIRRRLQVSALSPKTMYDHKFQSISEIAHIIFKERGVRGFF 327

Query: 72  KGLGAVVIGIIPKMAIRFTSYE 93
            GL    I + P +A  F  YE
Sbjct: 328 VGLSIGYIKVTPMVACSFFVYE 349

>AGR191W [4502] [Homologous to ScYDL198C (YHM1) - SH]
           complement(1114974..1115870) [897 bp, 298 aa]
          Length = 298

 Score = 63.2 bits (152), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 85/340 (25%), Positives = 139/340 (40%), Gaps = 70/340 (20%)

Query: 1   MSNRKNSSHPAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARD 60
           MSN +  S  A  +V   +AG+ E    HP+DTI  R+          Q+    +   R+
Sbjct: 1   MSNDQKQSGLA-RVVGSASAGILEIGVFHPVDTISKRLMSNHTKITNAQQLNDVV--FRE 57

Query: 61  ISTQ---EGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLL-----AD------RQTGV 106
            +++   +    L+ GLG      I +   ++    F    L     AD       +TG 
Sbjct: 58  HASKPFGQRLFTLFPGLGYAATYKIFQRVYKYGGQPFANEFLNKHFKADFDGAFGEKTGK 117

Query: 107 VSTGNTFVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXX 166
                T  AG   GI E V++  P++V+KI+ Q     +                     
Sbjct: 118 ALRSAT--AGSLIGIGEIVLL--PLDVLKIKRQTNPESF--------------------- 152

Query: 167 XXXXENVAATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSR 226
                      + R  ++    I+++EG   LYRG   TAAR A    A F   +  K  
Sbjct: 153 -----------RGRGFLR----ILRDEG-MGLYRGWGWTAARNAPGSFALFGGNAFAKEY 196

Query: 227 ---LQEYHQTDMLPSWETSLIGLISGALGPF-SNAPLDTIKTRLQKDKSTSKDSGWSRIL 282
              L++Y Q     +W  + +  I GA      +APLD IKTR+Q     S +SG++   
Sbjct: 197 ILGLKDYSQA----TWGQNFVSSIFGASASLIVSAPLDVIKTRIQSRNFESAESGFT--- 249

Query: 283 AIGRQLIREEGFRALYKGITPRVMRVAPGQAVTFTVYELI 322
            I +  ++ EG  A +KG+TP+++   P    +F + + +
Sbjct: 250 -IVKNTLKNEGATAFFKGLTPKLLTTGPKLVFSFAIAQTL 288

 Score = 30.8 bits (68), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 33/72 (45%), Gaps = 8/72 (11%)

Query: 258 PLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITPRVMRVAPGQAVTFT 317
           PLD +K + Q +  + +  G+ RIL       R+EG   LY+G      R APG    F 
Sbjct: 137 PLDVLKIKRQTNPESFRGRGFLRIL-------RDEGM-GLYRGWGWTAARNAPGSFALFG 188

Query: 318 VYELIRKKLEGL 329
                ++ + GL
Sbjct: 189 GNAFAKEYILGL 200

>CAGL0K11616g complement(1121834..1122796) highly similar to
           sp|P32332 Saccharomyces cerevisiae YKL120w, hypothetical
           start
          Length = 320

 Score = 63.2 bits (152), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 78/315 (24%), Positives = 113/315 (35%), Gaps = 39/315 (12%)

Query: 13  NLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQ-EGFLALY 71
           +  AGG A        +P++ +K+RMQ+        QR       A  +  + EG   L 
Sbjct: 21  SFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQ 80

Query: 72  KGLGAVVIGIIPKMAIRFTSYEFFR-----TLLADRQTGVV-STGNTFVAGVGAGITEAV 125
           KGL A  I  I     R   YE  R     T   D+++  V S G    AG  +GI  AV
Sbjct: 81  KGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAV 140

Query: 126 MVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQA 185
           M  +P+ +VK RLQ+                                +     Y      
Sbjct: 141 M-GSPLFLVKTRLQS--------------------------YSNAIKIGEQTHYTGVWNG 173

Query: 186 AYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPSWETSLIG 245
              I   EG + L+RG+     R          +Y+T K+ L      +  PS   +   
Sbjct: 174 LKTIYMTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLTA-S 232

Query: 246 LISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITPRV 305
            ISG        P D I TR+   K          ++    + ++ EG  ALYKG   +V
Sbjct: 233 TISGLGVAVVMNPWDVILTRIYNQKGDLYKGPIDCLV----KTVKIEGITALYKGFEAQV 288

Query: 306 MRVAPGQAVTFTVYE 320
            R+ P   +  T  E
Sbjct: 289 FRIGPHTILCLTFLE 303

 Score = 62.0 bits (149), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 60/231 (25%), Positives = 94/231 (40%), Gaps = 42/231 (18%)

Query: 107 VSTGNTFVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXX 166
           VS   +F AG G     AV V NP+EVVKIR+Q Q                         
Sbjct: 16  VSKFGSFTAG-GLAACIAVTVTNPIEVVKIRMQLQ------------------------- 49

Query: 167 XXXXENVAATPK-YRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKS 225
               E +AA  + Y N  QA  V+ + EG R L +G+      Q    G+    Y  +++
Sbjct: 50  ---GELMAANQRIYTNPFQAMGVVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRA 106

Query: 226 RL-------QEYHQTDMLPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSK---D 275
            +       QE H+   +        G  SG +G    +PL  +KTRLQ   +  K    
Sbjct: 107 VMNKTFYPDQESHKVQSVGI--NVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQ 164

Query: 276 SGWSRILAIGRQLIREEGFRALYKGITPRVMRVAPGQAVTFTVYELIRKKL 326
           + ++ +    + +   EG + L++GI   ++R   G +V   +Y   +  L
Sbjct: 165 THYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFL 215

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/137 (27%), Positives = 67/137 (48%), Gaps = 13/137 (9%)

Query: 12  INLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRAR--GFIGTARDISTQEGFLA 69
           IN+ AG  +G+  A+   PL  +K R+Q YS A + G++    G     + I   EG   
Sbjct: 126 INVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKG 185

Query: 70  LYKGLGAVVI----GIIPKMAIRFTSYEF-FRTLLADRQTGVVSTGNTFVAGVGAGITEA 124
           L++G+ A ++    G   ++ I  T+  F  R  + +    +  T +T ++G+G  +   
Sbjct: 186 LFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLTAST-ISGLGVAV--- 241

Query: 125 VMVVNPMEVVKIRLQAQ 141
             V+NP +V+  R+  Q
Sbjct: 242 --VMNPWDVILTRIYNQ 256

 Score = 35.0 bits (79), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 39/84 (46%), Gaps = 5/84 (5%)

Query: 10  PAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLA 69
           P+++L A   +GL  A+  +P D I  R  IY+   ++G   +G I         EG  A
Sbjct: 225 PSLHLTASTISGLGVAVVMNPWDVILTR--IYN---QKGDLYKGPIDCLVKTVKIEGITA 279

Query: 70  LYKGLGAVVIGIIPKMAIRFTSYE 93
           LYKG  A V  I P   +  T  E
Sbjct: 280 LYKGFEAQVFRIGPHTILCLTFLE 303

>Scas_645.9
          Length = 391

 Score = 63.5 bits (153), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 73/297 (24%), Positives = 116/297 (39%), Gaps = 47/297 (15%)

Query: 44  AREQGQRARGFIGTARDISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQ 103
            +    R  G +     I   EG   L++G+   ++  IP   + FT YE+ R    D  
Sbjct: 122 CKNSSVRFNGTLEAFNKIWKLEGITTLWRGISINLLMAIPANIVYFTGYEYLR----DNS 177

Query: 104 TGVVS--TGNTFVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXX 161
               S  T N  + G  A I  A  V  P+E++K +LQ+     +P  ++   S      
Sbjct: 178 PLATSSPTFNPLMCGAIARILAASTVA-PLELLKTKLQS-----IPRVSKSTTS------ 225

Query: 162 XXXXXXXXXENVAATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYS 221
                    + +    +    I  A          AL++G+ +T  R        +  Y 
Sbjct: 226 -----WMMVKELLKETRQEMRISGA--------SNALFKGLEITLWRDVPFSAIYWGSYE 272

Query: 222 TLKSRLQEYHQTDMLPSWETSLI-----GLISGALGPFSNAPLDTIKTRLQ------KDK 270
             K+ L  +  T    S  T  I     G ISG +      P D  KTR Q       DK
Sbjct: 273 FCKTHL--WMDTSKSHSNLTFFINSFIGGSISGTIAALVTHPFDVGKTRWQISFMGNNDK 330

Query: 271 STSKDSGWSR---ILAIGRQLIREEGFRALYKGITPRVMRVAPGQAVTFTVYELIRK 324
           S  K     +   +    R + + EG+ ALY G+ PR++++AP  A+  + YEL ++
Sbjct: 331 SVVKSPDIEQTKNMFKFLRNIWKLEGWGALYTGLVPRMVKIAPSCAIMISSYELSKR 387

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 58/241 (24%), Positives = 94/241 (39%), Gaps = 34/241 (14%)

Query: 115 AGVGAGITEAVMVVNPMEVVKIRLQAQHV------------RYVPLKAQLAGSVXXXXXX 162
           A  G+ +T   + + PM+VV+IRLQ Q +             ++P       SV      
Sbjct: 43  ASTGSLLTS--LTLTPMDVVRIRLQQQELLPDCSCETIAVKDFLPKAKTDLSSVQVSRAA 100

Query: 163 XXXXXXXXENVAATP------------KYRNAIQAAYVIVKEEGPRALYRGVSLTAARQA 210
                   +     P            ++   ++A   I K EG   L+RG+S+      
Sbjct: 101 TISTGNKNKVFWDNPCFQELNCKNSSVRFNGTLEAFNKIWKLEGITTLWRGISINLLMAI 160

Query: 211 TNQGANFTVYSTLKSRLQEYHQTDMLPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDK 270
                 FT Y  L+        +   P++   + G I+  L   + APL+ +KT+LQ   
Sbjct: 161 PANIVYFTGYEYLRDNSPLATSS---PTFNPLMCGAIARILAASTVAPLELLKTKLQSIP 217

Query: 271 STSKD-SGW---SRILAIGRQLIREEG-FRALYKGITPRVMRVAPGQAVTFTVYELIRKK 325
             SK  + W     +L   RQ +R  G   AL+KG+   + R  P  A+ +  YE  +  
Sbjct: 218 RVSKSTTSWMMVKELLKETRQEMRISGASNALFKGLEITLWRDVPFSAIYWGSYEFCKTH 277

Query: 326 L 326
           L
Sbjct: 278 L 278

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 40/95 (42%), Gaps = 8/95 (8%)

Query: 13  NLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQG--------QRARGFIGTARDISTQ 64
           + + G  +G   AL  HP D  K R QI                ++ +      R+I   
Sbjct: 295 SFIGGSISGTIAALVTHPFDVGKTRWQISFMGNNDKSVVKSPDIEQTKNMFKFLRNIWKL 354

Query: 65  EGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLL 99
           EG+ ALY GL   ++ I P  AI  +SYE  + L 
Sbjct: 355 EGWGALYTGLVPRMVKIAPSCAIMISSYELSKRLF 389

 Score = 45.1 bits (105), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 39/142 (27%), Positives = 66/142 (46%), Gaps = 10/142 (7%)

Query: 7   SSHPAIN-LVAGGTAGLFEALCCHPLDTIKVRMQI---YSRAREQGQRARGFIGTAR-DI 61
           +S P  N L+ G  A +  A    PL+ +K ++Q     S++       +  +   R ++
Sbjct: 181 TSSPTFNPLMCGAIARILAASTVAPLELLKTKLQSIPRVSKSTTSWMMVKELLKETRQEM 240

Query: 62  STQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLL----ADRQTGVVSTGNTFVAGV 117
                  AL+KGL   +   +P  AI + SYEF +T L    +   + +    N+F+ G 
Sbjct: 241 RISGASNALFKGLEITLWRDVPFSAIYWGSYEFCKTHLWMDTSKSHSNLTFFINSFIGGS 300

Query: 118 GAGITEAVMVVNPMEVVKIRLQ 139
            +G T A +V +P +V K R Q
Sbjct: 301 ISG-TIAALVTHPFDVGKTRWQ 321

>KLLA0D09889g complement(834904..835998) similar to sp|Q03829
           Saccharomyces cerevisiae YMR166c, start by similarity
          Length = 364

 Score = 62.8 bits (151), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 78/316 (24%), Positives = 124/316 (39%), Gaps = 47/316 (14%)

Query: 27  CCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGF-LALYKGLGAVVIGIIPKM 85
             H LDT+K R Q          + +  IG  R I  +EG    LY G    ++G  P  
Sbjct: 72  AMHSLDTVKTRQQ----GAPSTVKYKNMIGAYRTIILEEGLRKGLYGGYSGAMLGSFPSA 127

Query: 86  AIRFTSYEFFRTLLADRQTGVVSTGNTFVAG-VGAGITEAVMVVNPMEVVKIRLQAQHVR 144
           AI F +YE+ +  +   + G+  T +   AG +G  I+  V V  P EV+K RLQ Q   
Sbjct: 128 AIFFATYEYTKRKMIG-EWGINETFSHLTAGFLGDFISSFVYV--PSEVLKTRLQLQGRY 184

Query: 145 YVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAAYVIVKEEGPRALYRGVSL 204
             P                           +   Y+N   A   IV+ EG   L+ G   
Sbjct: 185 NNPF------------------------FRSGYNYKNLTDAVTTIVRREGWPTLFFGYKA 220

Query: 205 TAARQATNQGANFTVYSTLKSRL----QEYHQTDMLPSWETSLIGLISGALGPFSNAPLD 260
           T +R     G  F  Y   +        +    D+  S E  + G  +G L      PLD
Sbjct: 221 TLSRDLPFSGLQFAFYEKFRQLAFAVENKTFDEDLSLSNEI-ITGAAAGGLAGIITTPLD 279

Query: 261 TIKTRLQK------DKSTSKDSGWSRILAIGRQLI---REEGFRALYKGITPRVMRVAPG 311
            +KTR+Q       + S+      +   +I + ++   + EG   L+ G+ PR +  +  
Sbjct: 280 VVKTRIQTQLPDIPENSSQNLKQQTLTNSITKGMMTVYKTEGLAGLFSGVGPRFIWTSIQ 339

Query: 312 QAVTFTVYELIRKKLE 327
            ++   +Y++  K L+
Sbjct: 340 SSIMLLLYQVALKTLD 355

 Score = 41.6 bits (96), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 38/71 (53%), Gaps = 4/71 (5%)

Query: 259 LDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFR-ALYKGITPRVMRVAPGQAVTFT 317
           LDT+KTR Q   ST K   +  ++   R +I EEG R  LY G +  ++   P  A+ F 
Sbjct: 76  LDTVKTRQQGAPSTVK---YKNMIGAYRTIILEEGLRKGLYGGYSGAMLGSFPSAAIFFA 132

Query: 318 VYELIRKKLEG 328
            YE  ++K+ G
Sbjct: 133 TYEYTKRKMIG 143

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 34/137 (24%), Positives = 56/137 (40%), Gaps = 9/137 (6%)

Query: 13  NLVAGGTAGLFEALCCHPLDTIKVRMQIYSRARE----QGQRARGFIGTARDISTQEGFL 68
           +L AG       +    P + +K R+Q+  R        G   +        I  +EG+ 
Sbjct: 153 HLTAGFLGDFISSFVYVPSEVLKTRLQLQGRYNNPFFRSGYNYKNLTDAVTTIVRREGWP 212

Query: 69  ALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGV----VSTGNTFVAGVGAGITEA 124
            L+ G  A +   +P   ++F  YE FR L    +       +S  N  + G  AG    
Sbjct: 213 TLFFGYKATLSRDLPFSGLQFAFYEKFRQLAFAVENKTFDEDLSLSNEIITGAAAGGLAG 272

Query: 125 VMVVNPMEVVKIRLQAQ 141
           + +  P++VVK R+Q Q
Sbjct: 273 I-ITTPLDVVKTRIQTQ 288

>Sklu_2127.4 , Contig c2127 6322-7293
          Length = 323

 Score = 62.0 bits (149), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 67/295 (22%), Positives = 124/295 (42%), Gaps = 70/295 (23%)

Query: 29  HPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYKGLGAVVIGIIPKMAI- 87
           +PL TI  ++Q  ++  ++  + +  + T ++I  ++G L  Y GL + + G    MA+ 
Sbjct: 32  YPLVTITTKLQ--TQGNDENNQVKSKLETIKEIYRKDGLLGFYAGLESAIYG----MALT 85

Query: 88  RFTSYEFF----RTLLADRQTGVVSTGNTFVAGVGAGITEAVMVVNPMEVVKIRLQAQHV 143
            F  Y F+    R +L  R+   ++T  + + G  AG   A+   NP+ V   R+     
Sbjct: 86  NFVYYYFYELTSRNVLKVRKHKKLNTLESMLTGCVAGSVTAI-ASNPIWVANTRM----- 139

Query: 144 RYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAAYVIVKEEGPRALYRGVS 203
                                           T   + A+     IVK++  + L+ G+ 
Sbjct: 140 ------------------------------TVTKSEKTALATIIEIVKKDSAKTLFNGLK 169

Query: 204 LTAARQATNQGANFTVYSTLKSRLQEYHQTDML-PSWETSLIGLISGALGPF----SNAP 258
             A     N    +TV+  LK+ +  +++  +L PSW       + GALG      S  P
Sbjct: 170 -PALVLVMNPIVQYTVFEQLKNLVLAWNKQGILSPSW-----AFLLGALGKLAATGSTYP 223

Query: 259 LDTIKTRL---QKDKSTSKDSG---------WSRILAIGRQLIREEGFRALYKGI 301
             T+KTR+   +  K T  DSG            +L++  ++++++G   LY+G+
Sbjct: 224 YITLKTRMHLSESGKHTDDDSGKKAKGHKASSKSMLSLITEIVKKDGVSGLYRGV 278

 Score = 30.0 bits (66), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 32/64 (50%), Gaps = 1/64 (1%)

Query: 258 PLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITPRVMRVAPGQAVTFT 317
           PL TI T+LQ   +   +   S++  I +++ R++G    Y G+   +  +A    V + 
Sbjct: 33  PLVTITTKLQTQGNDENNQVKSKLETI-KEIYRKDGLLGFYAGLESAIYGMALTNFVYYY 91

Query: 318 VYEL 321
            YEL
Sbjct: 92  FYEL 95

>Scas_717.20
          Length = 356

 Score = 61.2 bits (147), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 76/342 (22%), Positives = 131/342 (38%), Gaps = 54/342 (15%)

Query: 15  VAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIG---TARDISTQEGFLALY 71
           +AGG +G        PLD IK+  Q  +      + A   +G    A+ I   +G    +
Sbjct: 37  LAGGISGSCAKTLIAPLDRIKILFQ--TSNPHYTKYAGSLVGLKEAAKHIWLNDGIRGFF 94

Query: 72  KGLGAVVIGIIPKMAIRFTSYEFFR-TLLADRQTGVVSTGNTFVAGVGAGITEAVMVVNP 130
           +G    ++ I P  A++F +YE  R TL+  ++    S     ++G  AG+  +V    P
Sbjct: 95  QGHSVTLMRIFPYAAVKFVAYEQIRNTLIPSKE--YESHWRRLMSGSLAGLC-SVFTTYP 151

Query: 131 MEVVKIRLQ--AQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAAYV 188
           ++++++RL    +H R       L G V              + +   P         Y+
Sbjct: 152 LDLIRVRLAYVTEHKR-----ISLLGLV--------------KTIYKEPASTTLEAKGYI 192

Query: 189 IVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQE------------------- 229
                     YRG + T        G +F  +  L   L+                    
Sbjct: 193 PNWFAHWCNFYRGYTPTVLGMIPYAGVSFFAHDLLHDVLKHPILAPYSVLALSESEQEER 252

Query: 230 --YHQTDMLPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDK---STSKDSGWSRILAI 284
              HQ   L +W   L G ++G     +  P + I+ RLQ      S   D  +  I  I
Sbjct: 253 HFKHQRLPLRTWAELLSGGLAGMASQTAAYPFEIIRRRLQVSTLSVSQMYDHRFQSISEI 312

Query: 285 GRQLIREEGFRALYKGITPRVMRVAPGQAVTFTVYELIRKKL 326
            + + +E G+R  + G++   ++V P  A +F VYE ++  L
Sbjct: 313 AKIIYKERGWRGFFVGLSIGYIKVTPMVACSFFVYERMKWHL 354

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 49/234 (20%), Positives = 86/234 (36%), Gaps = 57/234 (24%)

Query: 115 AGVGAGITE--AVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXEN 172
           +G+  GI+   A  ++ P++ +KI  Q  +  Y      L G                  
Sbjct: 35  SGLAGGISGSCAKTLIAPLDRIKILFQTSNPHYTKYAGSLVG------------------ 76

Query: 173 VAATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRL---QE 229
                      +AA  I   +G R  ++G S+T  R        F  Y  +++ L   +E
Sbjct: 77  ---------LKEAAKHIWLNDGIRGFFQGHSVTLMRIFPYAAVKFVAYEQIRNTLIPSKE 127

Query: 230 YHQTDMLPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLI 289
           Y        W   + G ++G    F+  PLD I+ RL       + S    +L + + + 
Sbjct: 128 YES-----HWRRLMSGSLAGLCSVFTTYPLDLIRVRLAYVTEHKRIS----LLGLVKTIY 178

Query: 290 REEGFRAL----------------YKGITPRVMRVAPGQAVTFTVYELIRKKLE 327
           +E     L                Y+G TP V+ + P   V+F  ++L+   L+
Sbjct: 179 KEPASTTLEAKGYIPNWFAHWCNFYRGYTPTVLGMIPYAGVSFFAHDLLHDVLK 232

 Score = 37.4 bits (85), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 47/252 (18%), Positives = 85/252 (33%), Gaps = 70/252 (27%)

Query: 14  LVAGGTAGLFEALCCHPLDTIKVRM----------------QIYSRAREQGQRARGFIGT 57
           L++G  AGL      +PLD I+VR+                 IY         A+G+I  
Sbjct: 135 LMSGSLAGLCSVFTTYPLDLIRVRLAYVTEHKRISLLGLVKTIYKEPASTTLEAKGYIP- 193

Query: 58  ARDISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLAD---------------- 101
               +    +   Y+G    V+G+IP   + F +++    +L                  
Sbjct: 194 ----NWFAHWCNFYRGYTPTVLGMIPYAGVSFFAHDLLHDVLKHPILAPYSVLALSESEQ 249

Query: 102 ------RQTGVVSTGNTFVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGS 155
                  Q   + T    ++G  AG+        P E+++ RLQ   +    +       
Sbjct: 250 EERHFKHQRLPLRTWAELLSGGLAGMASQT-AAYPFEIIRRRLQVSTLSVSQMYDH---- 304

Query: 156 VXXXXXXXXXXXXXXENVAATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGA 215
                                 ++++  + A +I KE G R  + G+S+   +       
Sbjct: 305 ----------------------RFQSISEIAKIIYKERGWRGFFVGLSIGYIKVTPMVAC 342

Query: 216 NFTVYSTLKSRL 227
           +F VY  +K  L
Sbjct: 343 SFFVYERMKWHL 354

 Score = 37.4 bits (85), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 39/83 (46%), Gaps = 2/83 (2%)

Query: 13  NLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQ--GQRARGFIGTARDISTQEGFLAL 70
            L++GG AG+      +P + I+ R+Q+ + +  Q    R +     A+ I  + G+   
Sbjct: 266 ELLSGGLAGMASQTAAYPFEIIRRRLQVSTLSVSQMYDHRFQSISEIAKIIYKERGWRGF 325

Query: 71  YKGLGAVVIGIIPKMAIRFTSYE 93
           + GL    I + P +A  F  YE
Sbjct: 326 FVGLSIGYIKVTPMVACSFFVYE 348

>Sklu_2430.10 YKL120W, Contig c2430 18856-19830
          Length = 324

 Score = 60.8 bits (146), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 60/239 (25%), Positives = 94/239 (39%), Gaps = 58/239 (24%)

Query: 107 VSTGNTFVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXX 166
           VS   +F+AG G     AV V NP E+VK R+Q Q                         
Sbjct: 21  VSKVGSFIAG-GLAACIAVTVTNPFELVKTRMQLQG------------------------ 55

Query: 167 XXXXENVAATPK--YRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLK 224
                 ++AT +  YRN  QA  VI K EG + L RG+      Q    G+    Y  ++
Sbjct: 56  -----EMSATNQRIYRNPFQALGVIFKNEGVKGLQRGLVSAYVYQIGLNGSRLGFYEPIR 110

Query: 225 SRLQEYHQTDMLPSWETSL-----IGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWS 279
           + L +    +  P    ++      G  SG +G    +PL  +KTR+Q          +S
Sbjct: 111 TVLNKTFFPESDPHKLQNVAVNVTAGATSGIIGAIVGSPLFLVKTRMQS---------YS 161

Query: 280 RILAIGRQ------------LIREEGFRALYKGITPRVMRVAPGQAVTFTVYELIRKKL 326
             + IG Q            + ++EG   L++G+   ++R   G +V   +Y   +  L
Sbjct: 162 NAIKIGEQTHYTSMSNGLATIFKKEGVLGLFRGVDAAILRTGAGSSVQLPIYNTTKNFL 220

 Score = 56.6 bits (135), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 76/321 (23%), Positives = 119/321 (37%), Gaps = 51/321 (15%)

Query: 13  NLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRA-RGFIGTARDISTQEGFLALY 71
           + +AGG A        +P + +K RMQ+        QR  R        I   EG   L 
Sbjct: 26  SFIAGGLAACIAVTVTNPFELVKTRMQLQGEMSATNQRIYRNPFQALGVIFKNEGVKGLQ 85

Query: 72  KGLGAVVIGIIPKMAIRFTSYEFFRTLL-------ADRQTGVVSTGNTFVAGVGAGITEA 124
           +GL +  +  I     R   YE  RT+L       +D    + +      AG  +GI  A
Sbjct: 86  RGLVSAYVYQIGLNGSRLGFYEPIRTVLNKTFFPESDPHK-LQNVAVNVTAGATSGIIGA 144

Query: 125 VMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQ 184
           + V +P+ +VK R+Q+                                +     Y +   
Sbjct: 145 I-VGSPLFLVKTRMQS--------------------------YSNAIKIGEQTHYTSMSN 177

Query: 185 AAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPSWETSLI 244
               I K+EG   L+RGV     R          +Y+T K+ L    Q D++   E + +
Sbjct: 178 GLATIFKKEGVLGLFRGVDAAILRTGAGSSVQLPIYNTTKNFLL---QNDIMK--EGTAL 232

Query: 245 GLISG-----ALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYK 299
            L+S       +G   N P D + TR+   K  +       +     + I+ EG  ALYK
Sbjct: 233 HLLSSTVTGLGVGIVMN-PWDVVLTRVYNQKGNTYKGPIDCMF----KTIKIEGIGALYK 287

Query: 300 GITPRVMRVAPGQAVTFTVYE 320
           G   ++ R+AP   +  T  E
Sbjct: 288 GFGAQLFRIAPHTILCLTFME 308

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 40/140 (28%), Positives = 69/140 (49%), Gaps = 17/140 (12%)

Query: 11  AINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDIST---QEGF 67
           A+N+ AG T+G+  A+   PL  +K RMQ YS A + G++   +   +  ++T   +EG 
Sbjct: 130 AVNVTAGATSGIIGAIVGSPLFLVKTRMQSYSNAIKIGEQTH-YTSMSNGLATIFKKEGV 188

Query: 68  LALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNTF------VAGVGAGI 121
           L L++G+ A ++      +++   Y   +  L   Q  ++  G         V G+G GI
Sbjct: 189 LGLFRGVDAAILRTGAGSSVQLPIYNTTKNFLL--QNDIMKEGTALHLLSSTVTGLGVGI 246

Query: 122 TEAVMVVNPMEVVKIRLQAQ 141
                V+NP +VV  R+  Q
Sbjct: 247 -----VMNPWDVVLTRVYNQ 261

 Score = 32.0 bits (71), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 38/83 (45%), Gaps = 5/83 (6%)

Query: 11  AINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLAL 70
           A++L++    GL   +  +P D +  R  +Y+   ++G   +G I         EG  AL
Sbjct: 231 ALHLLSSTVTGLGVGIVMNPWDVVLTR--VYN---QKGNTYKGPIDCMFKTIKIEGIGAL 285

Query: 71  YKGLGAVVIGIIPKMAIRFTSYE 93
           YKG GA +  I P   +  T  E
Sbjct: 286 YKGFGAQLFRIAPHTILCLTFME 308

>Kwal_33.15446
          Length = 305

 Score = 59.3 bits (142), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 73/337 (21%), Positives = 129/337 (38%), Gaps = 58/337 (17%)

Query: 1   MSNRKNSS----HPAINLVAGGTAGLFEALC----CHPLDTIKVRMQIYSRAREQGQRAR 52
           MS+R +S+    + A + + G  +G+F  +      HP DTIKVR+Q    +++ G R +
Sbjct: 1   MSSRSDSNAVVPNEAYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQT---SQDTG-RFK 56

Query: 53  GFIGTARDISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLAD---RQTGVVST 109
           G +        Q+G    Y G    ++G I   ++       +R LL     +    +  
Sbjct: 57  GPLDCVYQTMRQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPL 116

Query: 110 GNTFVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXX 169
               ++GV AG + +  +  P+E+ K +LQ Q+                           
Sbjct: 117 SGCILSGVLAGWSVS-FIAAPVELAKAKLQVQY--------------------------- 148

Query: 170 XENVAATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQE 229
               A T +YR  +     +   +G R +Y+G+  T   +      +F  +      L  
Sbjct: 149 ---DAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIFR-----THFVYWWGSYELLTR 200

Query: 230 YHQ--TDMLPSWETSLIGLISGALGPFSNA-PLDTIK-TRLQKDKSTSKDSGWSRILAIG 285
           + +  T++  +      G  S + G ++ A P D IK   L  DK       W    +  
Sbjct: 201 WFKANTNLSDTAINFWAGGFSASFGFWTTAYPSDVIKQVILCNDKYDGSLRSWRNAAS-- 258

Query: 286 RQLIREEGFRALYKGITPRVMRVAPGQAVTFTVYELI 322
             + R  G R  +KG  P  +R  P  A     +E +
Sbjct: 259 -DIWRTRGIRGFFKGFVPSFLRSFPANAAALASFEFV 294

>YFR045W (YFR045W) [1727] chr6 (242129..242986) Member of the
           mitochondrial carrier family (MCF) family of membrane
           transporters [858 bp, 285 aa]
          Length = 285

 Score = 58.9 bits (141), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 57/215 (26%), Positives = 89/215 (41%), Gaps = 23/215 (10%)

Query: 111 NTFVAGVGAGITEAVMVVNPMEVVKIRL-QAQHVRYVPLKAQLAGSVXXXXXXXXXXXXX 169
           N  +AG   GI E++ ++ P E +K  L Q+  + +  L+      V             
Sbjct: 77  NLLIAGTLTGIVESLFII-PFENIKTTLIQSAMIDHKKLEKN--QPVVNAKATFHKVATK 133

Query: 170 XENVAATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQE 229
              VA   K   A++  Y   +  GP A  +G + T  RQ  N    FT Y+  K  LQ 
Sbjct: 134 STPVARIEKLLPAVKHMY---QTRGPAAFVQGTTATIFRQIANTSIQFTAYTAFKRLLQA 190

Query: 230 YHQTDMLPSWETSLIGLISGALGPFS----NAPLDTIKTRLQKDKSTSKDSGWSRILAIG 285
             + D   S       +I+G    F+      P+D +KTR+    S +  + +   L   
Sbjct: 191 --RNDKASS-------VITGLATSFTLVAMTQPIDVVKTRMM---SQNAKTEYKNTLNCM 238

Query: 286 RQLIREEGFRALYKGITPRVMRVAPGQAVTFTVYE 320
            ++  +EG    +KG   R M+V     +TFTVYE
Sbjct: 239 YRIFVQEGMATFWKGSIFRFMKVGISGGLTFTVYE 273

>CAGL0K07436g complement(734496..735419) highly similar to sp|Q04013
           Saccharomyces cerevisiae YMR241w, hypothetical start
          Length = 307

 Score = 57.4 bits (137), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 67/313 (21%), Positives = 125/313 (39%), Gaps = 72/313 (23%)

Query: 13  NLVAGGTAGLFEALCC-HPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALY 71
           N++ G    L E      PL+ +K  M  +        R   F+   + + ++ G    Y
Sbjct: 14  NILLGAGLNLSEVTTLGQPLEVVKTTMAAH--------REFNFLQATKHVWSRGGIFGFY 65

Query: 72  KGL-----------GAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNTFVAGVGAG 120
           +GL           GAV++ +  +   RF            +  G+ + G   + G+  G
Sbjct: 66  QGLIPWAWIEASTKGAVLLFVSAEAEYRF------------KVLGLNNFGAGIMGGITGG 113

Query: 121 ITEAVMVVNPMEVVK-IRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKY 179
           +T+A + +     +K + +  Q    VP                             P  
Sbjct: 114 VTQAYLTMGFCTCMKTVEITRQKAANVP--------------------------GVIP-- 145

Query: 180 RNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYH----QTDM 235
           +++ Q    I K+EG R + +GV+  A RQ TN G+ F +   ++  +++      + D 
Sbjct: 146 QSSWQVFKSIYKKEGIRGINKGVNAVAIRQMTNWGSRFGLSRLVEDGIRKLTGKTGKDDK 205

Query: 236 LPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQ---LIREE 292
           L + E  +   I G L  + N P++ I+  +Q  K   +D    + L +G+    + +  
Sbjct: 206 LTALEKIMASAIGGGLSAW-NQPIEVIRVEMQSKK---EDPNRPKNLTVGKTFKYIYQSN 261

Query: 293 GFRALYKGITPRV 305
           G + LY+G+TPRV
Sbjct: 262 GLKGLYRGVTPRV 274

>Kwal_55.21338
          Length = 323

 Score = 57.4 bits (137), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 65/267 (24%), Positives = 107/267 (40%), Gaps = 54/267 (20%)

Query: 47  QGQRARG----FIGTARDISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYE-FFRTLLAD 101
           Q Q A+G       T +DI  ++G +  + GL + + G      + +  YE   R +L  
Sbjct: 51  QTQDAKGEKLSLADTIKDIYRKDGAMGFFAGLESALFGTTLSNFVYYYCYEASSRCVLRA 110

Query: 102 RQTGVVSTGNTFVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXX 161
           R T  ++T  + + G  AG   A    NP+ V   R+  Q                    
Sbjct: 111 RHTQRLTTAESMLVGSIAGSLNAT-AANPLWVANTRMTVQKSD----------------- 152

Query: 162 XXXXXXXXXENVAATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYS 221
                             R  +   + IVK+EG   L++G++  A     N    +TVY 
Sbjct: 153 ------------------RGTLSTIFDIVKDEGISGLFKGLN-PALILVINPIIQYTVYE 193

Query: 222 TLKSRLQEYHQTDML-PSWETSLIGLISGALGPF----SNAPLDTIKTRLQ--KDKSTSK 274
            LK+ +    QT  L PSW       I GA+G      S  P  T+K R+    +  +S 
Sbjct: 194 QLKNWILSSRQTRTLSPSW-----AFILGAVGKLAATGSTYPYVTMKARMHLLGEHKSST 248

Query: 275 DSGWSRILAIGRQLIREEGFRALYKGI 301
            +    +L++  ++I+++G   LY+GI
Sbjct: 249 AAPPRSLLSLMAEIIKKDGILGLYRGI 275

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 50/195 (25%), Positives = 81/195 (41%), Gaps = 37/195 (18%)

Query: 11  AINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLAL 70
           A +++ G  AG   A   +PL     RM +        +  RG + T  DI   EG   L
Sbjct: 119 AESMLVGSIAGSLNATAANPLWVANTRMTV-------QKSDRGTLSTIFDIVKDEGISGL 171

Query: 71  YKGLGAVVIGIIPKMAIRFTSYEFFRT-LLADRQTGVVSTGNTFVAGVGAGITEAVMVVN 129
           +KGL   +I +I  + I++T YE  +  +L+ RQT  +S    F+ G             
Sbjct: 172 FKGLNPALILVINPI-IQYTVYEQLKNWILSSRQTRTLSPSWAFILGA------------ 218

Query: 130 PMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAAYVI 189
              V K+        YV +KA++                   + AA P+   ++ A   I
Sbjct: 219 ---VGKLAATGSTYPYVTMKARM-----------HLLGEHKSSTAAPPRSLLSLMAE--I 262

Query: 190 VKEEGPRALYRGVSL 204
           +K++G   LYRG+ +
Sbjct: 263 IKKDGILGLYRGIGI 277

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 58/114 (50%), Gaps = 12/114 (10%)

Query: 215 ANFTVY----STLKSRLQEYHQTDMLPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDK 270
           +NF  Y    ++ +  L+  H T  L + E+ L+G I+G+L   +  PL    TR+   K
Sbjct: 92  SNFVYYYCYEASSRCVLRARH-TQRLTTAESMLVGSIAGSLNATAANPLWVANTRMTVQK 150

Query: 271 STSKDSGWSRILAIGRQLIREEGFRALYKGITPRVMRVAPGQAVTFTVYELIRK 324
           S   D G    L+    ++++EG   L+KG+ P ++ V     + +TVYE ++ 
Sbjct: 151 S---DRG---TLSTIFDIVKDEGISGLFKGLNPALILVI-NPIIQYTVYEQLKN 197

 Score = 30.8 bits (68), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 23/98 (23%), Positives = 42/98 (42%), Gaps = 6/98 (6%)

Query: 1   MSNRKNSS-HPAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQ-GQRARGFIGTA 58
           +S+R+  +  P+   + G    L      +P  T+K RM +    +       R  +   
Sbjct: 200 LSSRQTRTLSPSWAFILGAVGKLAATGSTYPYVTMKARMHLLGEHKSSTAAPPRSLLSLM 259

Query: 59  RDISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFR 96
            +I  ++G L LY+G+G  ++  I   A  F    FF+
Sbjct: 260 AEIIKKDGILGLYRGIGIKLVQSILTAAFLF----FFK 293

>Kwal_27.11419
          Length = 298

 Score = 56.6 bits (135), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 71/338 (21%), Positives = 132/338 (39%), Gaps = 74/338 (21%)

Query: 13  NLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYK 72
           + + G   GL  A+   P D +K R+        Q  ++   +   R I T      L+K
Sbjct: 10  HFIGGFVGGLTSAVILQPFDLLKTRL--------QQNKSSNLLDVVRSIETPG---QLWK 58

Query: 73  GLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGN---TFVAG-------VGAGIT 122
           G     +      A+  ++    R+ +AD++   ++  N   +F+         +   IT
Sbjct: 59  GTLPSALRTSVGSALFLSTLNIVRSAIADKRVKGIAGKNGSSSFLPQLSMYENLISGAIT 118

Query: 123 EAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNA 182
            A + V  M +  ++++ +   Y                                 Y++ 
Sbjct: 119 RAAVGVATMPITVLKVRFESTMY--------------------------------NYKSL 146

Query: 183 IQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQ----------EYHQ 232
            +AA  I + EG R L+ G   T  R A   G     Y   +S+LQ          E+++
Sbjct: 147 GEAATHIYRSEGIRGLFSGCGATVMRDAPYAGLYVLFYE--QSKLQLPRILPVWMVEHNE 204

Query: 233 TDMLPSWETSLIGLI----SGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQL 288
           + +  +  +++I  I    S +L     +P DTIKTR+Q + S      +   +   + +
Sbjct: 205 SGVFSTKTSTIINSIAAFSSASLATTITSPFDTIKTRMQLNPSQ-----YYGFIQTFKSI 259

Query: 289 IREEGFRALYKGITPRVMRVAPGQAVTFTVYELIRKKL 326
           IR E  R L+ G++ R+ R A    + + +YE + KK 
Sbjct: 260 IRYERPRNLFDGLSLRLSRKALSAGIAWGIYEELVKKF 297

>CAGL0B03883g 383602..384522 weakly similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 or sp|P38087
           Saccharomyces cerevisiae YBR104w YMC2, hypothetical
           start
          Length = 306

 Score = 56.6 bits (135), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 71/326 (21%), Positives = 121/326 (37%), Gaps = 54/326 (16%)

Query: 12  INLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALY 71
           +  VAG  +G+ +    HP DT+KVR+Q        G + +G +         +G   LY
Sbjct: 11  MGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIRGLY 70

Query: 72  KGLGAVVIGIIPKMAIRFTSYEFFRTLLADR---QTGVVSTGNTFVAGVGAGITEAVMVV 128
            G    + G I   +    S   +R LL      +   +      ++GV AG T +  + 
Sbjct: 71  LGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMAGWTVS-FIA 129

Query: 129 NPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAAYV 188
            P+E+ K +LQ Q+                               A T KY   I     
Sbjct: 130 APVELAKAKLQVQY------------------------------DAKTTKYTGPIDVVQK 159

Query: 189 IVKE--------EGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQ--TDMLPS 238
           + K+         G R+LY+G+  T   +     +NF  +      + ++ Q  T++   
Sbjct: 160 VFKQGMATNGILGGVRSLYKGLISTLIFR-----SNFVFWWGSYELITQWFQKNTNLSAP 214

Query: 239 WETSLIGLISGALGPFSNA-PLDTIK-TRLQKDKSTSKDSGWSRILAIGRQLIREEGFRA 296
                 G +S + G +++A P D +K   L  DK       W   ++    + R+ G   
Sbjct: 215 AINFWAGGLSASFGFWTSAYPSDVVKQVVLCNDKYDGSFKSWRTAVS---DIYRQRGIHG 271

Query: 297 LYKGITPRVMRVAPGQAVTFTVYELI 322
            +KG  P  +R  P  A     +E +
Sbjct: 272 FFKGFLPSFLRSFPANAAALAAFEFV 297

 Score = 28.9 bits (63), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 35/90 (38%), Gaps = 4/90 (4%)

Query: 6   NSSHPAINLVAGGTAGLFEAL-CCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQ 64
           N S PAIN  AGG +  F      +P D +K   Q+     +     + +     DI  Q
Sbjct: 210 NLSAPAINFWAGGLSASFGFWTSAYPSDVVK---QVVLCNDKYDGSFKSWRTAVSDIYRQ 266

Query: 65  EGFLALYKGLGAVVIGIIPKMAIRFTSYEF 94
            G    +KG     +   P  A    ++EF
Sbjct: 267 RGIHGFFKGFLPSFLRSFPANAAALAAFEF 296

>KLLA0B14454g complement(1268709..1269626) highly similar to
           sp|P23641 Saccharomyces cerevisiae YJR077c MIR1
           phosphate transport protein, mitochondrial (MCF), start
           by similarity
          Length = 305

 Score = 56.6 bits (135), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 74/312 (23%), Positives = 123/312 (39%), Gaps = 65/312 (20%)

Query: 30  PLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYKGLGAVVIGIIPKMAIRF 89
           P+D +K R+Q+     E     +G + + + I + EG  AL  G G  ++G   + + +F
Sbjct: 33  PIDVVKTRIQL-----EPTVYNKGMVSSFKQIISSEGAGALLTGFGPTLLGYSLQGSFKF 87

Query: 90  TSYEFFRTLLADRQ--TGVVSTGNTFVAGVGAGITE--AVMVVNPMEVVKIRLQAQHVRY 145
             YE F+ L  D       V+  NT   G  A I E  A + + P+E  +IRL +Q    
Sbjct: 88  GGYELFKKLAIDNMGYDNAVNYKNTIYIG-SAAIAEFFADIALCPLEATRIRLVSQ---- 142

Query: 146 VPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAAYV-IVKEEGPRALYRGVSL 204
                                          P + N +   +  I+KEEG  + Y G + 
Sbjct: 143 -------------------------------PTFANGLFGGFSRILKEEGVGSFYNGFTP 171

Query: 205 TAARQATNQGANFTVYSTL----------KSRLQEYHQTDMLPSWETSLIGLISGALGPF 254
              +Q     A F V+             K  + E   T +         GL +G     
Sbjct: 172 ILFKQIPYNIAKFFVFEHAANAYFGLAGPKETMSETTHTAI-----NLAAGLTAGLAAAV 226

Query: 255 SNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITPRVMRVAPGQAV 314
            + P DT+ +++ K K   K  G S I  +  QL ++ GF   + G+  R++ V    ++
Sbjct: 227 VSQPADTLLSKVNKTK---KAPGQSTI-GLLAQLAKQLGFVGSFTGLPTRLVMVGTLTSL 282

Query: 315 TFTVYELIRKKL 326
            F +Y  ++K L
Sbjct: 283 QFGIYGTLKKSL 294

 Score = 37.7 bits (86), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 46/102 (45%), Gaps = 7/102 (6%)

Query: 223 LKSRLQEYHQTDMLPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRIL 282
           + S + EY  +D     + +L G I   +   S  P+D +KTR+Q + +       S   
Sbjct: 1   MASPVPEYTVSDY---AKFALAGAIGCGITHSSMVPIDVVKTRIQLEPTVYNKGMVSSF- 56

Query: 283 AIGRQLIREEGFRALYKGITPRVMRVAPGQAVTFTVYELIRK 324
              +Q+I  EG  AL  G  P ++  +   +  F  YEL +K
Sbjct: 57  ---KQIISSEGAGALLTGFGPTLLGYSLQGSFKFGGYELFKK 95

>AGL065C [4246] [Homologous to ScYHR002W (LEU5) - SH]
           (585963..586970) [1008 bp, 335 aa]
          Length = 335

 Score = 56.6 bits (135), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 74/354 (20%), Positives = 138/354 (38%), Gaps = 47/354 (13%)

Query: 1   MSNRKNSSHP----AINLV-----AGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRA 51
           MS R+  S P    +++ +     AGG AG        PLD IK+  Q  +    Q   +
Sbjct: 1   MSGRQRGSGPVDKSSVDYIVKSGLAGGIAGSCAKTLVAPLDRIKILFQTSNPQFAQFAGS 60

Query: 52  RG-FIGTARDISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTG 110
            G  +  ++ I   +G    ++G  A ++ I P  AI+F +YE  R+++        S  
Sbjct: 61  MGGLVRASKYIMAHDGPRGFFQGHSATLLRIFPYAAIKFIAYEQIRSVVIPTWRH-ESHW 119

Query: 111 NTFVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXX 170
              ++G  AG+  +V V  P+++V++RL     R+     ++   +              
Sbjct: 120 RRLLSGSLAGLC-SVFVTYPLDLVRVRLAYVTERHDAKVRKIMACIY------------- 165

Query: 171 ENVAATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQE- 229
                  +   A++  Y+          YRG + T        G +F  +   +   +  
Sbjct: 166 -----NERPSEALRKWYIPQWFAHWSNFYRGYTPTVIGMIPYAGVSFFAHDLCQDIFRHP 220

Query: 230 ---------------YHQTDMLPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSK 274
                          Y +T  L +W   + G ++G     +  P + I+ RLQ    T  
Sbjct: 221 MLEPYSVLSPGGSSAYDRTVPLKTWAQLVAGGLAGMASQTAAYPFEIIRRRLQVSAITDP 280

Query: 275 D-SGWSRILAIGRQLIREEGFRALYKGITPRVMRVAPGQAVTFTVYELIRKKLE 327
               +  I  I + +  E G+R  + G++   ++V P  A +F +YE  +  L+
Sbjct: 281 TRRHFVGINEIAKIIYTEGGWRGFFVGLSIGYIKVTPMVACSFFIYERTKWYLQ 334

>AER450C [2950] [Homologous to ScYJR077C (MIR1) - SH]
           (1500683..1501609) [927 bp, 308 aa]
          Length = 308

 Score = 56.2 bits (134), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 64/307 (20%), Positives = 115/307 (37%), Gaps = 55/307 (17%)

Query: 30  PLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYKGLGAVVIGIIPKMAIRF 89
           P+D +K R+Q+     E  + + G +G+ R I  +EG  AL  G G  ++G   + A +F
Sbjct: 35  PIDVVKTRIQL-----EPLKYSSGMVGSFRKIVGEEGAAALLTGFGPTLLGYSMQGAFKF 89

Query: 90  TSYEFFRTLLAD---RQTGVVSTGNTFVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYV 146
             YE F+    D    +T        ++         A + + P+E  +IRL +Q     
Sbjct: 90  GGYEVFKKAFVDALGYETACQYRTPIYIGSAAIAEFFADIALCPLEATRIRLVSQ----- 144

Query: 147 PLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAAYV-IVKEEGPRALYRGVSLT 205
                                         P + N +   +  I+KEEG  + Y G +  
Sbjct: 145 ------------------------------PTFANGLVGGFARILKEEGIGSFYNGFTPI 174

Query: 206 AARQATNQGANFTVYSTLKSRL------QEYHQTDMLPSWETSLIGLISGALGPFSNAPL 259
             +Q     A F V+    +        +E   T                A    S  P 
Sbjct: 175 LFKQIPYNIAKFVVFEHAANAYFGLAGSKENLSTTAATGINLLAGLTAGLAAAVISQ-PA 233

Query: 260 DTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITPRVMRVAPGQAVTFTVY 319
           DT+ +++ K K     S +  ++ + +QL    GF   + G+  R++ V    ++ F +Y
Sbjct: 234 DTLLSKVNKTKKAPGQSTFGLLMQLAKQL----GFVGSFAGLPTRLVMVGTLTSLQFGIY 289

Query: 320 ELIRKKL 326
             +++ L
Sbjct: 290 GKLKQSL 296

 Score = 28.5 bits (62), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 30/69 (43%), Gaps = 8/69 (11%)

Query: 25  ALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYKGLGAVVIGIIPK 84
           ALC  PL+  ++R+        Q   A G +G    I  +EG  + Y G   ++   IP 
Sbjct: 130 ALC--PLEATRIRL------VSQPTFANGLVGGFARILKEEGIGSFYNGFTPILFKQIPY 181

Query: 85  MAIRFTSYE 93
              +F  +E
Sbjct: 182 NIAKFVVFE 190

>KLLA0D04290g 366536..367102 similar to sgd|S0006215 Saccharomyces
           cerevisiae YPR011c, hypothetical start
          Length = 188

 Score = 54.7 bits (130), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 55/209 (26%), Positives = 79/209 (37%), Gaps = 54/209 (25%)

Query: 114 VAGVGAGITEAV--MVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXE 171
           +A +  G+  AV   VV+P E VKI LQ Q                              
Sbjct: 13  IAFIAGGVAGAVSRTVVSPFERVKILLQVQ------------------------------ 42

Query: 172 NVAATPKYRNAI-QAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEY 230
             ++T  Y + I  A   + KEEG   L+RG  L   R        F VY   K  +   
Sbjct: 43  --SSTSAYNHGIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHV 100

Query: 231 HQT---DMLPSWETSLIGLISGALGPFSNAPLDTIKTRL--------QKDKSTSKDSG-- 277
             T   + L +W+    G + G +   +  PLD ++TRL        +  KS +KD    
Sbjct: 101 DGTVGKEQLLNWQRLSAGALCGGMSVLATYPLDLVRTRLSIQTANLAKLSKSKAKDIAKP 160

Query: 278 ---WSRILAIGRQLIREEGFRALYKGITP 303
              W  ++   +    E G R LY+GI P
Sbjct: 161 PGVWELLV---KTFKEEGGIRGLYRGIYP 186

 Score = 47.0 bits (110), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 49/201 (24%), Positives = 79/201 (39%), Gaps = 29/201 (14%)

Query: 11  AINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLAL 70
           +I  +AGG AG        P + +K+ +Q+ S          G I     +  +EG   L
Sbjct: 12  SIAFIAGGVAGAVSRTVVSPFERVKILLQVQSSTSAYNH---GIINAVGQVYKEEGVAGL 68

Query: 71  YKGLGAVVIGIIPKMAIRFTSYEFFRTLL--ADRQTGVVSTGNT--FVAGVGAGITEAVM 126
           ++G G   + I P  A++F  YE+ +  +   D   G     N     AG   G   +V+
Sbjct: 69  FRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCG-GMSVL 127

Query: 127 VVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAA 186
              P+++V+ RL  Q      L    A                 +++A  P     +   
Sbjct: 128 ATYPLDLVRTRLSIQTANLAKLSKSKA-----------------KDIAKPPGVWELLVKT 170

Query: 187 YVIVKEEGP-RALYRGVSLTA 206
           +   KEEG  R LYRG+  T+
Sbjct: 171 F---KEEGGIRGLYRGIYPTS 188

 Score = 42.0 bits (97), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 44/82 (53%), Gaps = 2/82 (2%)

Query: 245 GLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITPR 304
           G ++GA+     +P + +K  LQ   STS  +    I A+G Q+ +EEG   L++G    
Sbjct: 18  GGVAGAVSRTVVSPFERVKILLQVQSSTSAYNH-GIINAVG-QVYKEEGVAGLFRGNGLN 75

Query: 305 VMRVAPGQAVTFTVYELIRKKL 326
            +R+ P  AV F VYE  +K +
Sbjct: 76  CVRIFPYSAVQFVVYEWCKKHI 97

>CAGL0H10538g 1027739..1028632 highly similar to tr|Q07534
           Saccharomyces cerevisiae YDL119c, hypothetical start
          Length = 297

 Score = 56.2 bits (134), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 75/343 (21%), Positives = 125/343 (36%), Gaps = 82/343 (23%)

Query: 13  NLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIG-TARDISTQEGFLALY 71
           +L+ G   GL  A+   PLD +K R Q         Q   G +  T + + T      L+
Sbjct: 7   HLIGGFAGGLSSAVALQPLDLLKTRFQ---------QTKGGTLWQTVKSLDTP---WQLW 54

Query: 72  KGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNTFVAGVGAGITEAVMVVN-- 129
           +G     I      A+  +S    RT LA R+     T ++ V G  + + +  M  N  
Sbjct: 55  RGTLPSAIRTSVGSALYLSSLNLMRTALAKRKQ--FDTADSVVTGKSSNLPQLSMYENLV 112

Query: 130 --------------PMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAA 175
                         P+ ++K+R ++                                   
Sbjct: 113 TGAFARGTVGYITMPITIIKVRYESTLY-------------------------------- 140

Query: 176 TPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRL-------- 227
              Y++  +AA  I  +EG R  +RG   T  R A   G    +Y  LK  L        
Sbjct: 141 --NYKSIAEAAKSIAAQEGIRGFFRGFGPTCLRDAPYSGLYVLLYEKLKHTLPTILPKSL 198

Query: 228 ----QEYHQTDMLPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILA 283
                E   T    +   S   ++S ++     AP DTIKTR+Q + +  K + WS +  
Sbjct: 199 LQLDSEGRYTAYTSTAINSTSAILSASMATTVTAPFDTIKTRMQLEPTKFK-TFWSTLTT 257

Query: 284 IGRQLIREEGFRALYKGITPRVMRVAPGQAVTFTVYELIRKKL 326
           I    + +E    ++ G++ R+ R A    + + +YE + K  
Sbjct: 258 I----VTQEHPIKIFSGLSMRLTRKALSAGIAWGIYEELIKHF 296

 Score = 34.7 bits (78), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 50/239 (20%), Positives = 84/239 (35%), Gaps = 64/239 (26%)

Query: 5   KNSSHPAI----NLVAGGTAGLFEALCCHPLDTIKVRMQ--IYSRAREQGQRARGFIGTA 58
           K+S+ P +    NLV G  A         P+  IKVR +  +Y+         +     A
Sbjct: 98  KSSNLPQLSMYENLVTGAFARGTVGYITMPITIIKVRYESTLYNY--------KSIAEAA 149

Query: 59  RDISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLAD-------------RQTG 105
           + I+ QEG    ++G G   +   P   +    YE  +  L               R T 
Sbjct: 150 KSIAAQEGIRGFFRGFGPTCLRDAPYSGLYVLLYEKLKHTLPTILPKSLLQLDSEGRYTA 209

Query: 106 VVSTG-NTFVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXX 164
             ST  N+  A + A +  A  V  P + +K R+Q +  ++    + L            
Sbjct: 210 YTSTAINSTSAILSASM--ATTVTAPFDTIKTRMQLEPTKFKTFWSTLT----------- 256

Query: 165 XXXXXXENVAATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTL 223
                                   IV +E P  ++ G+S+   R+A + G  + +Y  L
Sbjct: 257 -----------------------TIVTQEHPIKIFSGLSMRLTRKALSAGIAWGIYEEL 292

>YMR241W (YHM2) [4197] chr13 (751960..752904) Suppressor of abf1
           mutant that affects mitochondrial HMG-like DNA-binding
           protein, member of the mitochondrial carrier family
           (MCF) of membrane transporters [945 bp, 314 aa]
          Length = 314

 Score = 56.2 bits (134), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 68/312 (21%), Positives = 128/312 (41%), Gaps = 71/312 (22%)

Query: 13  NLVAGGTAGLFEALCC-HPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALY 71
           N++ G    L E      PL+ +K  M           R   F+ + + + ++ G L  Y
Sbjct: 22  NILLGACLNLSEVTTLGQPLEVVKTTMA--------ANRNFTFLESVKHVWSRGGILGYY 73

Query: 72  KGL-----------GAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNTFVAGVGAG 120
           +GL           GAV++ +  +   RF S             G+ +  +  + GV  G
Sbjct: 74  QGLIPWAWIEASTKGAVLLFVSAEAEYRFKSL------------GLNNFASGILGGVTGG 121

Query: 121 ITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYR 180
           +T+A + +     +K     +H      K+  AG V                 ++   ++
Sbjct: 122 VTQAYLTMGFCTCMKTVEITRH------KSASAGGVPQ---------------SSWSVFK 160

Query: 181 NAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEY----HQTDML 236
           N       I K+EG R + +GV+  A RQ TN G+ F +   ++  +++     ++ D L
Sbjct: 161 N-------IYKKEGIRGINKGVNAVAIRQMTNWGSRFGLSRLVEDGIRKITGKTNKDDKL 213

Query: 237 PSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQ---LIREEG 293
             +E      + G L  + N P++ I+  +Q  K   +D    + L +G+    + +  G
Sbjct: 214 NPFEKIGASALGGGLSAW-NQPIEVIRVEMQSKK---EDPNRPKNLTVGKTFKYIYQSNG 269

Query: 294 FRALYKGITPRV 305
            + LY+G+TPR+
Sbjct: 270 LKGLYRGVTPRI 281

>KLLA0E02750g 260854..261768 similar to ca|CA6127|IPF149 Candida
           albicans peroxisomal membrane protein (by homology),
           start by similarity
          Length = 304

 Score = 56.2 bits (134), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 71/309 (22%), Positives = 121/309 (39%), Gaps = 58/309 (18%)

Query: 15  VAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYKGL 74
           +AG   G       +PL TI   +Q       +   AR  + T ++I  + G +  + GL
Sbjct: 16  IAGSLGGAASIAVTYPLVTITTNLQ------TKENEARPKLETIKEIYNKNGIIGYFLGL 69

Query: 75  GAVVIGIIPKMAIRFTSYEFF----RTLLADRQTGVVSTGNTFVAGVGAGITEAVMVVNP 130
            + V G+     + +  YE+     RTL   +    +ST  + +A   AG   AV   NP
Sbjct: 70  ESAVYGMATTNFVYYYFYEWCAKTARTLTTKQY---LSTWESILASTIAGSMTAV-ASNP 125

Query: 131 MEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAAYVIV 190
           + V   R+      +  L+  +                                    IV
Sbjct: 126 IWVANTRMTVAKSNHSTLRTVID-----------------------------------IV 150

Query: 191 KEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDML-PSWETSLIGLISG 249
           K +GP  L  G+   A    +N    +TVY  LK+ +    +  +L PSW   L+G I  
Sbjct: 151 KTDGPLTLLNGLK-PALVLVSNPIIQYTVYEQLKNLVLRLQRKKVLSPSW-AFLLGAIGK 208

Query: 250 ALGPFSNAPLDTIKTR--LQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITPRVMR 307
                +  P  T+KTR  L ++    + S WS I+    ++++++G   LY G+  ++++
Sbjct: 209 LAATGTTYPYITLKTRMHLMQNDPKHQKSMWSLIV----EIVKKDGVSGLYNGVAVKLVQ 264

Query: 308 VAPGQAVTF 316
                A  F
Sbjct: 265 SIMTAAFLF 273

 Score = 30.8 bits (68), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 21/88 (23%), Positives = 42/88 (47%), Gaps = 7/88 (7%)

Query: 236 LPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFR 295
           L +WE+ L   I+G++   ++ P+    TR+   KS          L     +++ +G  
Sbjct: 103 LSTWESILASTIAGSMTAVASNPIWVANTRMTVAKSNHST------LRTVIDIVKTDGPL 156

Query: 296 ALYKGITPRVMRVAPGQAVTFTVYELIR 323
            L  G+ P ++ V+    + +TVYE ++
Sbjct: 157 TLLNGLKPALVLVS-NPIIQYTVYEQLK 183

>Scas_718.24
          Length = 337

 Score = 56.2 bits (134), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 67/335 (20%), Positives = 136/335 (40%), Gaps = 41/335 (12%)

Query: 1   MSNRKNSSHPAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQG---QRARGFIGT 57
           MS  K  S+ AI+ + GG +         P++ +K+ +Q  +   +QG    + +G +  
Sbjct: 33  MSTEKPQSNFAIDFLMGGVSAAVAKTAASPIERVKLLIQNQNEMLKQGTLDTKYKGIVDC 92

Query: 58  ARDISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQT---GVVSTGNTFV 114
            R  + QEG ++ ++G  A VI   P  A+ F   +  + +   ++    G    GN   
Sbjct: 93  FRRTAQQEGIISFWRGNTANVIRYFPTQALNFAFKDKIKLMFGFKKEDGYGKWFAGNLAS 152

Query: 115 AGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVA 174
            G   G++  ++ V  ++  + RL A        K+   G                    
Sbjct: 153 GGAAGGLS--LLFVYSLDFARTRLAADS------KSSKKG-------------------- 184

Query: 175 ATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKS-RLQEYHQT 233
            + ++   I      +K +G   LYRG   +       +G  F +Y ++K   L    + 
Sbjct: 185 GSRQFNGLIDVYKKTLKSDGVAGLYRGFLPSVVGIIVYRGLYFGLYDSIKPVLLTGSLEG 244

Query: 234 DMLPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEG 293
             L S+   L+G +        + PLDT++ ++    ++ +   +       ++++  EG
Sbjct: 245 SFLASF---LLGWVVTTGASTCSYPLDTVRRKMM--MTSGQAVKYKGAFDCFKKIVAAEG 299

Query: 294 FRALYKGITPRVMRVAPGQAVTFTVYELIRKKLEG 328
             +L+KG    ++R   G  V  ++Y+ ++  L G
Sbjct: 300 VASLFKGCGANILRGVAGAGVI-SMYDQLQMILFG 333

>YMR056C (AAC1) [4016] chr13 complement(387314..388243) ADP/ATP
           carrier protein of the mitochondrial carrier family
           (MCF) of membrane transporters [930 bp, 309 aa]
          Length = 309

 Score = 55.8 bits (133), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 62/312 (19%), Positives = 124/312 (39%), Gaps = 49/312 (15%)

Query: 8   SHPAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQ---RARGFIGTARDISTQ 64
           SH  ++ + GG +         P++ +K+ MQ      +QG    R +G +   +  +T 
Sbjct: 11  SHFGVDFLMGGVSAAIAKTGAAPIERVKLLMQNQEEMLKQGSLDTRYKGILDCFKRTATH 70

Query: 65  EGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLA-DRQTGVVS---TGNTFVAGVGAG 120
           EG ++ ++G  A V+   P  A+ F   +  ++LL+ DR+    +    GN F  G   G
Sbjct: 71  EGIVSFWRGNTANVLRYFPTQALNFAFKDKIKSLLSYDRERDGYAKWFAGNLFSGGAAGG 130

Query: 121 ITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYR 180
           ++  ++ V  ++  + RL A                                  +  ++ 
Sbjct: 131 LS--LLFVYSLDYARTRLAAD--------------------------ARGSKSTSQRQFN 162

Query: 181 NAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLK-----SRLQEYHQTDM 235
             +      +K +G   LYRG   +       +G  F +Y + K       L+       
Sbjct: 163 GLLDVYKKTLKTDGLLGLYRGFVPSVLGIIVYRGLYFGLYDSFKPVLLTGALEGSFVASF 222

Query: 236 LPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFR 295
           L  W  ++     GA    ++ PLDT++ R+    ++ +   +   L   R+++++EG  
Sbjct: 223 LLGWVITM-----GA--STASYPLDTVRRRMM--MTSGQTIKYDGALDCLRKIVQKEGAY 273

Query: 296 ALYKGITPRVMR 307
           +L+KG    + R
Sbjct: 274 SLFKGCGANIFR 285

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 38/161 (23%), Positives = 66/161 (40%), Gaps = 10/161 (6%)

Query: 178 KYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLP 237
           +Y+  +         EG  + +RG +    R    Q  NF     +KS L    + D   
Sbjct: 56  RYKGILDCFKRTATHEGIVSFWRGNTANVLRYFPTQALNFAFKDKIKSLLSYDRERDGYA 115

Query: 238 SWETS--LIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSG---WSRILAIGRQLIREE 292
            W       G  +G L       LD  +TRL  D   SK +    ++ +L + ++ ++ +
Sbjct: 116 KWFAGNLFSGGAAGGLSLLFVYSLDYARTRLAADARGSKSTSQRQFNGLLDVYKKTLKTD 175

Query: 293 GFRALYKGITPRVMRVAPGQAVTFTVYE-----LIRKKLEG 328
           G   LY+G  P V+ +   + + F +Y+     L+   LEG
Sbjct: 176 GLLGLYRGFVPSVLGIIVYRGLYFGLYDSFKPVLLTGALEG 216

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 43/89 (48%), Gaps = 4/89 (4%)

Query: 243 LIGLISGALGPFSNAPLDTIKTRLQKD----KSTSKDSGWSRILAIGRQLIREEGFRALY 298
           L+G +S A+     AP++ +K  +Q      K  S D+ +  IL   ++    EG  + +
Sbjct: 18  LMGGVSAAIAKTGAAPIERVKLLMQNQEEMLKQGSLDTRYKGILDCFKRTATHEGIVSFW 77

Query: 299 KGITPRVMRVAPGQAVTFTVYELIRKKLE 327
           +G T  V+R  P QA+ F   + I+  L 
Sbjct: 78  RGNTANVLRYFPTQALNFAFKDKIKSLLS 106

>KLLA0E18788g complement(1661093..1662238) similar to sp|P38702
           Saccharomyces cerevisiae YHR002w, start by similarity
          Length = 381

 Score = 55.8 bits (133), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 73/352 (20%), Positives = 142/352 (40%), Gaps = 50/352 (14%)

Query: 2   SNRKNSSHPAINLVAGGTAGLFEALCCHPLDTIKVRMQIYS-RAREQGQRARGFIGTARD 60
           ++++N  +   + +AGG AG        PLD IK+  Q  +    +     +G +     
Sbjct: 45  TSKQNFDYILKSGLAGGVAGSCAKTLIAPLDRIKILFQTSNPHYVKYAGSFQGLLNAGVH 104

Query: 61  ISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNTFVAGVGAG 120
           I +++    +++G  A ++ I P  A++F +YE  R ++   +    +      +G  AG
Sbjct: 105 IWSRDRLRGVFQGHSATLLRIFPYAAVKFIAYEQIRNVIIPSKE-YETHFRRLCSGSLAG 163

Query: 121 ITEAVMVVNPMEVVKIRL----QAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAAT 176
           +  +V    P++++++RL    +   VR  PL  Q+                   + A  
Sbjct: 164 LC-SVFCTYPLDLIRVRLAYVTEHHKVRVWPLVKQIYSE---------PASEALSSKAYV 213

Query: 177 PK--------YRNAIQAAYVIVKEEGPRALYRGVSLTAARQATN--QGANFTVYSTLKSR 226
           PK        YR  I     ++        Y GVS  A     +  +      YS L  R
Sbjct: 214 PKWFAQWCNFYRGYIPTVIGMIP-------YAGVSFFAHDLFHDILRHPVIAPYSVL--R 264

Query: 227 LQEYHQTDM--------------LPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKST 272
           + +    D+              L +W   L G ++G     +  P + I+ RLQ    T
Sbjct: 265 VDDLDADDLKVDVQTTRTGKRIPLNTWAELLAGGLAGMASQTAAYPFEIIRRRLQVGAVT 324

Query: 273 SK-DSGWSRILAIGRQLIREEGFRALYKGITPRVMRVAPGQAVTFTVYELIR 323
           +  +  ++ +  + + +  E G+R  + G++   ++V P  A +F VYE ++
Sbjct: 325 NPLEHKFTSMSEMAKIIFHERGWRGFFVGLSIGYIKVTPMVACSFFVYERMK 376

>KLLA0F08547g 796328..797254 similar to sp|Q04013 Saccharomyces
           cerevisiae YMR241w YHM2 yeast suppressor gene of HM
           (mitochondrial histone) mutant (ABF2) singleton, start
           by similarity
          Length = 308

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 39/135 (28%), Positives = 67/135 (49%), Gaps = 15/135 (11%)

Query: 182 AIQAAYVIVKE----EGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEY----HQT 233
           A Q+++   KE    EG R + +GV+  A RQ TN G+ F     ++  L+++    +  
Sbjct: 145 AKQSSWAAFKEIYNKEGIRGINKGVNAVAIRQMTNWGSRFGFSRLVEEGLRKFTGKTNPD 204

Query: 234 DMLPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIG---RQLIR 290
           D L + E      I G L  + N P++ I+  +Q   S + D    + L +G   R + +
Sbjct: 205 DKLTALEKIFASAIGGGLSAW-NQPIEVIRVEMQ---SKTNDPNRPKDLTVGKAFRYIYQ 260

Query: 291 EEGFRALYKGITPRV 305
             G + LY+G+TPR+
Sbjct: 261 SNGVKGLYRGVTPRI 275

>ABL023W [569] [Homologous to ScYKL120W (OAC1) - SH]
           complement(355977..356906) [930 bp, 309 aa]
          Length = 309

 Score = 54.7 bits (130), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 74/305 (24%), Positives = 117/305 (38%), Gaps = 56/305 (18%)

Query: 29  HPLDTIKVRMQIYSRAREQGQRARG----FIGTARDIST---QEGFLALYKGLGAVVIGI 81
           +P++T+K R+Q+      QG+   G    + G A+ +S     EG   L +GL       
Sbjct: 30  NPIETVKTRLQL------QGELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGLACAYAYQ 83

Query: 82  IPKMAIRFTSYEFFR-----TLLADRQTGVVSTGNTFVAGVGAGITEAVMVVNPMEVVKI 136
           I     R   Y+  R      +L+DR+T   +          A       + +P+++VK 
Sbjct: 84  ILLNGSRLGLYDPLRAALGGCVLSDRRTYGTAALAVNATAGAAAGMIGAALGSPLQLVKT 143

Query: 137 RLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAAYVIVKEEGPR 196
           R+QA   R VP    L G +                           +    + K+ G R
Sbjct: 144 RMQALAPRRVP---PLPGRMG--------------------------RRLVALFKDRGVR 174

Query: 197 ALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPSWETSLIGLISGALGPFSN 256
            LY+GV     R          VYS  K  L   H  D +  +  +L   +S      + 
Sbjct: 175 GLYQGVDAALLRTGVGSAVQLAVYSHAKEALSR-HVPDGMALY--TLASALSSVAVCIAM 231

Query: 257 APLDTIKTRLQKDKSTSKDSGWSR-ILAIGRQLIREEGFRALYKGITPRVMRVAPGQAVT 315
            P D   TR+   +      G  R  L    + +R+EGF ALYKG   +++R+AP   + 
Sbjct: 232 NPFDVAMTRMYHHRG-----GLYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILC 286

Query: 316 FTVYE 320
            T+ E
Sbjct: 287 LTLME 291

 Score = 43.9 bits (102), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 51/208 (24%), Positives = 79/208 (37%), Gaps = 40/208 (19%)

Query: 129 NPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPK-YRNAIQAAY 187
           NP+E VK RLQ Q                             E VA   + Y    QA  
Sbjct: 30  NPIETVKTRLQLQ----------------------------GELVAGVSRLYSGPAQAVS 61

Query: 188 VIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPSWETSLIGLI 247
           +I + EG R L +G++   A Q    G+   +Y  L++ L     +D       +L    
Sbjct: 62  LIYRTEGLRGLQQGLACAYAYQILLNGSRLGLYDPLRAALGGCVLSDRRTYGTAALAVNA 121

Query: 248 SGALGPFSN-----APLDTIKTRLQKDKSTSKDSGWSRILAIGRQLI---REEGFRALYK 299
           +             +PL  +KTR+Q            R+   GR+L+   ++ G R LY+
Sbjct: 122 TAGAAAGMIGAALGSPLQLVKTRMQALAPRRVPPLPGRM---GRRLVALFKDRGVRGLYQ 178

Query: 300 GITPRVMRVAPGQAVTFTVYELIRKKLE 327
           G+   ++R   G AV   VY   ++ L 
Sbjct: 179 GVDAALLRTGVGSAVQLAVYSHAKEALS 206

>AFR542W [3734] [Homologous to ScYMR241W (YHM2) - SH]
           complement(1408478..1409410) [933 bp, 310 aa]
          Length = 310

 Score = 54.7 bits (130), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 68/298 (22%), Positives = 115/298 (38%), Gaps = 76/298 (25%)

Query: 29  HPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYKGL-----------GAV 77
            PL+  K  M           R  GF    R + ++ G    Y+GL           GAV
Sbjct: 36  QPLEVTKTTMA--------ANRQFGFSQAVRHVWSRGGVFGFYQGLIPWAWIEASTKGAV 87

Query: 78  VIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNTFVAGVGAGITEAVMVVN---PMEVV 134
           ++ +  +       Y+F       R+ G+ + G   + GV  G+ +A + +     M+ V
Sbjct: 88  LLFVSAE-----AEYQF-------RRLGLSNFGAGILGGVSGGVAQAYLTMGFCTCMKTV 135

Query: 135 KI-RLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAAYVIVKEE 193
           +I R +A     VP+ + L                               Q    I   E
Sbjct: 136 EITRSKAASAPGVPVPSSL-------------------------------QVFKQIFAAE 164

Query: 194 GPRALYRGVSLTAARQATNQGANFTVYSTLKS---RLQEYHQTDMLPSWETSLIGLISGA 250
           G R + +GV+  A RQ TN G+ F +   ++    R+      + L + E  +   + G 
Sbjct: 165 GLRGINKGVNAVAIRQMTNWGSRFGLSRLVEDGIRRVTHKRSDEKLSAMEKIVASALGGG 224

Query: 251 LGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIG---RQLIREEGFRALYKGITPRV 305
           L  + N P++ I+  +Q   S + D    + L +G   R +    G R LY+G+TPR+
Sbjct: 225 LSAW-NQPIEVIRVEMQ---SRTNDPNRPKNLTVGKTFRYIYENNGLRGLYRGVTPRI 278

>Kwal_26.7972
          Length = 358

 Score = 54.7 bits (130), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 69/316 (21%), Positives = 126/316 (39%), Gaps = 24/316 (7%)

Query: 15  VAGGTAGLFEALCCHPLDTIKVRMQIYS-RAREQGQRARGFIGTARDISTQEGFLALYKG 73
           +AGG AG        PLD IK+  Q  +    +      G I     I+  +G    Y+G
Sbjct: 32  LAGGIAGSCAKTLIAPLDRIKILFQTSNPHYLKYSGSTMGLIRAGAHINAHDGIRGFYQG 91

Query: 74  LGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNTFVAGVGAGITEAVMVVNPMEV 133
             A +I I P  AI+F +YE  R  +   +    +      +G  AG+  +V +  P+++
Sbjct: 92  HSATLIRIFPYAAIKFIAYEQIRHFMIPSKE-YETHARRLASGSMAGLC-SVFMTYPLDL 149

Query: 134 VKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAAYVIVKEE 193
           +++RL      YV  ++++                   + +  P++       Y   +  
Sbjct: 150 IRVRLA-----YVTDRSRIKMLPVIKQIYTERASESLTSKSYVPRWFAHWCNFY---RGF 201

Query: 194 GPRAL----YRGVSLTAARQATN--QGANFTVYSTLKSRLQEY------HQTDMLPSWET 241
            P  L    Y GVS  A     +  +    + YS L    +E         +  L +W  
Sbjct: 202 TPTVLGMIPYAGVSFFAHDLCGDILRSGALSPYSVLPISDEELTIRSKKQSSRPLKTWAE 261

Query: 242 SLIGLISGALGPFSNAPLDTIKTRLQKD-KSTSKDSGWSRILAIGRQLIREEGFRALYKG 300
            + G ++G     ++ P + I+ RLQ    S +    +  I  + R + +E G+R  + G
Sbjct: 262 LVAGGLAGMASQTASYPFEIIRRRLQVSVVSPTSIHNFQTIPDMIRIIYKERGWRGFFVG 321

Query: 301 ITPRVMRVAPGQAVTF 316
           ++   ++V P  A +F
Sbjct: 322 LSIGYIKVTPMVACSF 337

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 42/85 (49%), Gaps = 2/85 (2%)

Query: 241 TSLIGLISGALGPFSNAPLDTIKTRLQ-KDKSTSKDSGWSR-ILAIGRQLIREEGFRALY 298
           + L G I+G+      APLD IK   Q  +    K SG +  ++  G  +   +G R  Y
Sbjct: 30  SGLAGGIAGSCAKTLIAPLDRIKILFQTSNPHYLKYSGSTMGLIRAGAHINAHDGIRGFY 89

Query: 299 KGITPRVMRVAPGQAVTFTVYELIR 323
           +G +  ++R+ P  A+ F  YE IR
Sbjct: 90  QGHSATLIRIFPYAAIKFIAYEQIR 114

 Score = 37.7 bits (86), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 41/161 (25%), Positives = 64/161 (39%), Gaps = 34/161 (21%)

Query: 183 IQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPS--WE 240
           I+A   I   +G R  Y+G S T  R        F  Y  ++          M+PS  +E
Sbjct: 73  IRAGAHINAHDGIRGFYQGHSATLIRIFPYAAIKFIAYEQIRHF--------MIPSKEYE 124

Query: 241 TSLIGLISGALG----PFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRA 296
           T    L SG++      F   PLD I+ RL    +   D    ++L + +Q+  E    +
Sbjct: 125 THARRLASGSMAGLCSVFMTYPLDLIRVRL----AYVTDRSRIKMLPVIKQIYTERASES 180

Query: 297 L----------------YKGITPRVMRVAPGQAVTFTVYEL 321
           L                Y+G TP V+ + P   V+F  ++L
Sbjct: 181 LTSKSYVPRWFAHWCNFYRGFTPTVLGMIPYAGVSFFAHDL 221

 Score = 34.7 bits (78), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 39/90 (43%), Gaps = 3/90 (3%)

Query: 3   NRKNSSHPA---INLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTAR 59
           ++K SS P      LVAGG AG+      +P + I+ R+Q+   +       +      R
Sbjct: 248 SKKQSSRPLKTWAELVAGGLAGMASQTASYPFEIIRRRLQVSVVSPTSIHNFQTIPDMIR 307

Query: 60  DISTQEGFLALYKGLGAVVIGIIPKMAIRF 89
            I  + G+   + GL    I + P +A  F
Sbjct: 308 IIYKERGWRGFFVGLSIGYIKVTPMVACSF 337

 Score = 34.3 bits (77), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 37/164 (22%), Positives = 63/164 (38%), Gaps = 44/164 (26%)

Query: 14  LVAGGTAGLFEALCCHPLDTIKVRM----------------QIYSRAREQGQRARGFIGT 57
           L +G  AGL      +PLD I+VR+                QIY+    +   ++ ++  
Sbjct: 130 LASGSMAGLCSVFMTYPLDLIRVRLAYVTDRSRIKMLPVIKQIYTERASESLTSKSYV-- 187

Query: 58  ARDISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLL-------------ADRQT 104
            R  +    F   Y+G    V+G+IP   + F +++    +L             +D + 
Sbjct: 188 PRWFAHWCNF---YRGFTPTVLGMIPYAGVSFFAHDLCGDILRSGALSPYSVLPISDEEL 244

Query: 105 GVVS---------TGNTFVAGVGAGITEAVMVVNPMEVVKIRLQ 139
            + S         T    VAG  AG+        P E+++ RLQ
Sbjct: 245 TIRSKKQSSRPLKTWAELVAGGLAGMASQT-ASYPFEIIRRRLQ 287

>Scas_667.4
          Length = 308

 Score = 54.7 bits (130), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 64/317 (20%), Positives = 123/317 (38%), Gaps = 40/317 (12%)

Query: 5   KNSSHPAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQG---QRARGFIGTARDI 61
           K  S+ AI+ + GG +         P++ +K+ +Q      +QG    + +G I   +  
Sbjct: 8   KKESNFAIDFLMGGVSAAVAKTAASPIERVKLLIQNQDEMIKQGSLDSKYKGIIECFQRT 67

Query: 62  STQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQT---GVVSTGNTFVAGVG 118
           +  EG +A ++G  A VI   P  A+ F   +  + +   ++    G    GN    G  
Sbjct: 68  AKTEGIIAFWRGNTANVIRYFPTQALNFAFKDKIKAMFGFKKEEGYGKWFAGNLASGGAA 127

Query: 119 AGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPK 178
            G++  ++ V  ++  + RL A                                   + +
Sbjct: 128 GGLS--LLFVYSLDYARTRLAAD--------------------------AKSSKKGGSRQ 159

Query: 179 YRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLK-SRLQEYHQTDMLP 237
           Y+  I      +  +G   LYRG   +       +G  F +Y +LK + L    +   L 
Sbjct: 160 YKGLIDVYKQTLATDGMAGLYRGFLPSVVGIIVYRGLYFGLYDSLKPAVLTGSLEGSFLA 219

Query: 238 SWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRAL 297
           S+   L+G I       ++ PLDT++ R+    ++ +   +       R+++  EG  +L
Sbjct: 220 SF---LLGWIVTTGASTASYPLDTVRRRMM--MTSGQAVKYDGAFDCFRKVVAAEGVSSL 274

Query: 298 YKGITPRVMRVAPGQAV 314
           +KG    ++R   G  V
Sbjct: 275 FKGCGANILRGVAGAGV 291

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 36/152 (23%), Positives = 65/152 (42%), Gaps = 6/152 (3%)

Query: 177 PKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDML 236
            KY+  I+      K EG  A +RG +    R    Q  NF     +K+    + + +  
Sbjct: 55  SKYKGIIECFQRTAKTEGIIAFWRGNTANVIRYFPTQALNFAFKDKIKAMFG-FKKEEGY 113

Query: 237 PSWETSLI--GLISGALGPFSNAPLDTIKTRLQKDKSTSKDSG---WSRILAIGRQLIRE 291
             W    +  G  +G L       LD  +TRL  D  +SK  G   +  ++ + +Q +  
Sbjct: 114 GKWFAGNLASGGAAGGLSLLFVYSLDYARTRLAADAKSSKKGGSRQYKGLIDVYKQTLAT 173

Query: 292 EGFRALYKGITPRVMRVAPGQAVTFTVYELIR 323
           +G   LY+G  P V+ +   + + F +Y+ ++
Sbjct: 174 DGMAGLYRGFLPSVVGIIVYRGLYFGLYDSLK 205

>Scas_696.9
          Length = 312

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 33/121 (27%), Positives = 57/121 (47%), Gaps = 5/121 (4%)

Query: 189 IVKEEGPRALYRGVSLTAARQATNQGANF----TVYSTLKSRLQEYHQTDMLPSWETSLI 244
           I  +EG R +Y+GV+  A RQ TN G+ F     V   ++    +    D L +WE    
Sbjct: 160 IYAKEGLRGIYKGVNAVAIRQMTNWGSRFGFSRLVEDWVRKATGKTKPEDRLNAWEKIGA 219

Query: 245 GLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITPR 304
             + G L  + N P++ I+  +Q  K          +    + +++  G + LY+G+TPR
Sbjct: 220 TAVGGGLSAW-NQPIEVIRVEMQSKKEDPNRPKNLTVAKTFKYIMKTNGVKGLYRGVTPR 278

Query: 305 V 305
           +
Sbjct: 279 I 279

>Kwal_23.5757
          Length = 307

 Score = 54.3 bits (129), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 67/306 (21%), Positives = 118/306 (38%), Gaps = 58/306 (18%)

Query: 30  PLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYKGLGAVVIGIIPKMAIRF 89
           PLD +K R Q+           +  +   R I   EG   ++ G+GA  IG   + A ++
Sbjct: 39  PLDLVKCRRQV------DASLYKSNLDGWRQIVRSEGATKVFTGVGATAIGYSLQGAFKY 92

Query: 90  TSYEFFR---TLLADRQTGVVSTGNTFVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYV 146
             YEFF+   + L   +T        F+A   +    A + + P E +K+R Q      V
Sbjct: 93  GGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAIKVRQQTA----V 148

Query: 147 PLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAAYVIVKEEGPRALYRGVSLTA 206
           P                             P  RN   A   +V  EG  +LY+G++   
Sbjct: 149 P----------------------------PPFARNVFDAYSKMVGAEGFASLYKGITPLW 180

Query: 207 ARQATNQGANFT--------VYSTLKSRLQEYHQTDMLPSWETSLI-GLISGALGPFSNA 257
            RQ       FT        +Y+ L +  +E  Q   +     S   G ++G L    + 
Sbjct: 181 FRQIPYTMCKFTSFERIVEMIYARLPTPKREMSQLGQI---SVSFAGGYLAGILCAVVSH 237

Query: 258 PLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITPRVMRVAPGQAVTFT 317
           P D + +++  +    + SG S + A  R +  + GF  L+ G+  R++ +    +  + 
Sbjct: 238 PADVMVSKVNNE----RKSGESTLQATSR-IYGKIGFPGLWNGLAVRILMIGTLTSFQWL 292

Query: 318 VYELIR 323
           +Y+  +
Sbjct: 293 IYDSFK 298

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 40/138 (28%), Positives = 57/138 (41%), Gaps = 16/138 (11%)

Query: 6   NSSHPAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQE 65
           +S    I L A  +A     +   P + IKVR Q           AR        +   E
Sbjct: 112 HSYRTGIFLAASASAEFIADIFLCPWEAIKVRQQ----TAVPPPFARNVFDAYSKMVGAE 167

Query: 66  GFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADR---------QTGVVSTGNTFVAG 116
           GF +LYKG+  +    IP    +FTS+E    ++  R         Q G +S   +F  G
Sbjct: 168 GFASLYKGITPLWFRQIPYTMCKFTSFERIVEMIYARLPTPKREMSQLGQISV--SFAGG 225

Query: 117 VGAGITEAVMVVNPMEVV 134
             AGI  AV V +P +V+
Sbjct: 226 YLAGILCAV-VSHPADVM 242

 Score = 35.8 bits (81), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 43/93 (46%), Gaps = 13/93 (13%)

Query: 241 TSLIGLISGALGPFSNA--PLDTIKTRLQKDKSTSKDS--GWSRILAIGRQLIREEGFRA 296
            +L GL+  A GP  +A  PLD +K R Q D S  K +  GW       RQ++R EG   
Sbjct: 22  CTLGGLV--ACGPTHSAVTPLDLVKCRRQVDASLYKSNLDGW-------RQIVRSEGATK 72

Query: 297 LYKGITPRVMRVAPGQAVTFTVYELIRKKLEGL 329
           ++ G+    +  +   A  +  YE  + +   L
Sbjct: 73  VFTGVGATAIGYSLQGAFKYGGYEFFKHQYSQL 105

>KLLA0E08877g complement(791157..792041) similar to sgd|S0002277
           Saccharomyces cerevisiae YDL119c, start by similarity
          Length = 294

 Score = 53.5 bits (127), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 72/345 (20%), Positives = 131/345 (37%), Gaps = 78/345 (22%)

Query: 4   RKNSSHPAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDIST 63
           R+ ++H    L+ G + GL  A+   P D +K R+Q          +      T + I T
Sbjct: 5   RRATTH----LIGGFSGGLVSAIILQPFDLLKTRLQ--------QDKTSTLWKTLKSIET 52

Query: 64  QEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLAD-RQTGVVSTGNTFVAGVG---- 118
                 L++G     I      A+  T     R  ++  + TG  STG++++  +     
Sbjct: 53  PS---QLWRGALPSCIRTSVGSAMYLTMLNSIRQAISKGKNTG--STGSSYLPQLNMYEN 107

Query: 119 ---AGITEAV--MVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENV 173
                +T A+  ++  P+ V+K+R ++   +Y  L+                        
Sbjct: 108 MFSGAVTRALTGLITMPITVIKVRYESTLYQYTSLR------------------------ 143

Query: 174 AATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLK--------S 225
                      A   I + EG R  +RG   TA R A   G     Y  +K        S
Sbjct: 144 ----------YATSHIFRTEGLRGFFRGFGATALRDAPYAGLYMLFYDRMKVLVPTLLPS 193

Query: 226 RLQEYHQTDMLPSWETSLI----GLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRI 281
            + + +  +   ++ ++LI       +  +     AP DT+KTR+Q +      + +   
Sbjct: 194 NVVKLNSDNRYSTYASTLINGSSAFSAAVIATSITAPFDTVKTRMQLE-----PAKFHSF 248

Query: 282 LAIGRQLIREEGFRALYKGITPRVMRVAPGQAVTFTVYELIRKKL 326
            +    +  +E  R L+ GI+ R+ R A    + + +YE I KK 
Sbjct: 249 TSTFWHIATKESVRNLFAGISLRLTRKAFSAGIAWGIYEEIVKKF 293

>Sklu_2260.5 YER053C, Contig c2260 6981-7889 reverse complement
          Length = 302

 Score = 53.1 bits (126), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 61/309 (19%), Positives = 115/309 (37%), Gaps = 65/309 (21%)

Query: 30  PLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYKGLGAVVIGIIPKMAIRF 89
           PLD +K R+Q+        Q  R  +   + I   EG   ++ G+GA  IG   + A ++
Sbjct: 35  PLDLVKCRLQV------NPQLYRSNLDGWKTIVRSEGLSKVFTGVGATFIGYSLQGACKY 88

Query: 90  TSYEFFR----TLLADRQTGVVSTGNTFVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRY 145
             YE+F+     LL+        T     A   A     +++  P E +K++ Q      
Sbjct: 89  GGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADILLC-PWEAIKVKQQTT---- 143

Query: 146 VPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAAYVIVKEEGPRALYRGVSLT 205
           +P                             P  +N ++    I   EG   LY+G++  
Sbjct: 144 IP-----------------------------PFCKNFLEGWSKITAAEGLSGLYKGITPL 174

Query: 206 AARQATNQGANFT--------VYSTLKSRLQEYHQTDMLPSWETSLI---GLISGALGPF 254
             RQ       FT        +Y+ L    QE     M PS +  +    G ++G L   
Sbjct: 175 WCRQIPYTMCKFTSFERIVEMIYAKLPRSKQE-----MSPSQQIGVSFVGGYLAGILCAV 229

Query: 255 SNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITPRVMRVAPGQAV 314
            + P D + +++  D+   +      ++   +++    GF  L+ G+  R+  +    + 
Sbjct: 230 VSHPADVMVSKVNADRKQGES-----MVEASKRIYSRIGFGGLWNGLPVRIFMIGTLTSF 284

Query: 315 TFTVYELIR 323
            + +Y+  +
Sbjct: 285 QWLIYDSFK 293

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 59/138 (42%), Gaps = 13/138 (9%)

Query: 11  AINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLAL 70
           A+ L A  +A     +   P + IKV+ Q            + F+     I+  EG   L
Sbjct: 113 AVYLCASASAEFLADILLCPWEAIKVKQQT-----TIPPFCKNFLEGWSKITAAEGLSGL 167

Query: 71  YKGLGAVVIGIIPKMAIRFTSYE-----FFRTLLADRQTGVVS--TGNTFVAGVGAGITE 123
           YKG+  +    IP    +FTS+E      +  L   +Q    S   G +FV G  AGI  
Sbjct: 168 YKGITPLWCRQIPYTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILC 227

Query: 124 AVMVVNPMEVVKIRLQAQ 141
           AV V +P +V+  ++ A 
Sbjct: 228 AV-VSHPADVMVSKVNAD 244

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 22/94 (23%), Positives = 45/94 (47%), Gaps = 6/94 (6%)

Query: 12  INLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALY 71
           ++ V G  AG+  A+  HP D +  ++   +  R+QG+     +  ++ I ++ GF  L+
Sbjct: 215 VSFVGGYLAGILCAVVSHPADVMVSKV---NADRKQGES---MVEASKRIYSRIGFGGLW 268

Query: 72  KGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTG 105
            GL   +  I    + ++  Y+ F+  +    TG
Sbjct: 269 NGLPVRIFMIGTLTSFQWLIYDSFKAYIGLPTTG 302

>KLLA0E09680g complement(860245..861168) similar to ca|CA5146|CaYMC2
           Candida albicans Carnitine/acylcarnitine translocase (by
           homology), start by similarity
          Length = 307

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 66/316 (20%), Positives = 116/316 (36%), Gaps = 46/316 (14%)

Query: 12  INLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALY 71
           +  VAG  +G+ +    HP DTIKVR+Q      +   R +G +         +G    Y
Sbjct: 25  MGFVAGVFSGVAKNAVGHPFDTIKVRLQ----TSQNETRFKGPLDCVYKTFRNQGIRGFY 80

Query: 72  KGLGAVVIGIIPKMAIRFTSYEFFRTLLADR---QTGVVSTGNTFVAGVGAGITEAVMVV 128
            G    ++G I   ++       +R L+          +      ++GV AG + +  + 
Sbjct: 81  LGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVS-FIA 139

Query: 129 NPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAAYV 188
            P+E+ K +LQ Q+ +                               T +Y+  +     
Sbjct: 140 PPIELAKAKLQVQYDK------------------------------TTTRYKGPLDVIKK 169

Query: 189 IVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPSWETSLIGLIS 248
           I   +G R LY+G+  T   + T+    +  Y  L    +E   T M  +      G  S
Sbjct: 170 IYSAQGIRGLYKGLISTLIFR-THFVYWWGSYELLTRWFRE--NTKMSEAAINFWAGGFS 226

Query: 249 GALGPFSNA-PLDTIK-TRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITPRVM 306
            + G ++ A P D +K   L  DK       W   +   + + + +G    +KG  P  +
Sbjct: 227 ASFGFWTTAYPSDVVKQVVLCNDKYDGSFKSWRTAV---KDIYQSKGINGFFKGFVPSFL 283

Query: 307 RVAPGQAVTFTVYELI 322
           R  P  A     +E +
Sbjct: 284 RSFPANAAALAAFEFV 299

>YER053C (PIC2) [1481] chr5 complement(258736..259638) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, has similarity to C. elegans mitochondrial
           phosphate carrier protein [903 bp, 300 aa]
          Length = 300

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 57/305 (18%), Positives = 119/305 (39%), Gaps = 62/305 (20%)

Query: 30  PLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYKGLGAVVIGIIPKMAIRF 89
           PLD +K R+Q+    +      +GF    R I   EG+  +Y G GA  +G   + A ++
Sbjct: 38  PLDLVKCRLQV--NPKLYTSNLQGF----RKIIANEGWKKVYTGFGATFVGYSLQGAGKY 91

Query: 90  TSYEFFRTLLADRQTGVVSTGNTFVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLK 149
             YE+F+ L +   +  V+     +A   A     +M+  P E +K++ Q          
Sbjct: 92  GGYEYFKHLYSSWLSPGVTV--YLMASATAEFLADIMLC-PFEAIKVKQQ---------- 138

Query: 150 AQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAAYVIVKEE--GPRALYRGVSLTAA 207
                                      P + N +   +  +  E  G +A Y+G+     
Sbjct: 139 ------------------------TTMPPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWC 174

Query: 208 RQATNQGANFT--------VYSTLKSRLQEYHQTDMLPSWETSLI-GLISGALGPFSNAP 258
           RQ       FT        +YS L  + +E +    +     S + G ++G L    + P
Sbjct: 175 RQIPYTMCKFTSFEKIVQKIYSVLPKKKEEMNALQQI---SVSFVGGYLAGILCAAVSHP 231

Query: 259 LDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITPRVMRVAPGQAVTFTV 318
            D + +++  ++  ++      +    +++ ++ GF  L+ G+  R++ +    +  + +
Sbjct: 232 ADVMVSKINSERKANES-----MSVASKRIYQKIGFTGLWNGLMVRIVMIGTLTSFQWLI 286

Query: 319 YELIR 323
           Y+  +
Sbjct: 287 YDSFK 291

 Score = 36.6 bits (83), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 38/160 (23%), Positives = 60/160 (37%), Gaps = 25/160 (15%)

Query: 177 PK-YRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDM 235
           PK Y + +Q    I+  EG + +Y G   T    +      +  Y   K          +
Sbjct: 50  PKLYTSNLQGFRKIIANEGWKKVYTGFGATFVGYSLQGAGKYGGYEYFK---------HL 100

Query: 236 LPSWETS--LIGLISGALGPFSN----APLDTIKTRLQKDKSTSKDS---GWSRILAIGR 286
             SW +    + L++ A   F       P + IK + Q       ++   GW ++ A   
Sbjct: 101 YSSWLSPGVTVYLMASATAEFLADIMLCPFEAIKVKQQTTMPPFCNNVVDGWKKMYA--- 157

Query: 287 QLIREEGFRALYKGITPRVMRVAPGQAVTFTVYELIRKKL 326
                 G +A YKGI P   R  P     FT +E I +K+
Sbjct: 158 ---ESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKI 194

 Score = 30.4 bits (67), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 22/95 (23%), Positives = 42/95 (44%), Gaps = 6/95 (6%)

Query: 11  AINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLAL 70
           +++ V G  AG+  A   HP D +  ++    +A E    A      ++ I  + GF  L
Sbjct: 212 SVSFVGGYLAGILCAAVSHPADVMVSKINSERKANESMSVA------SKRIYQKIGFTGL 265

Query: 71  YKGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTG 105
           + GL   ++ I    + ++  Y+ F+  +    TG
Sbjct: 266 WNGLMVRIVMIGTLTSFQWLIYDSFKAYVGLPTTG 300

>Kwal_34.15907
          Length = 312

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 65/312 (20%), Positives = 125/312 (40%), Gaps = 71/312 (22%)

Query: 13  NLVAGGTAGLFEALCC-HPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALY 71
           N++ G    L EA     PL+ IK  M           R   F  + + + ++ G    Y
Sbjct: 20  NILLGAGLNLCEATTLGQPLEVIKTTMA--------ANRNLNFGQSVKHVWSRGGVFGFY 71

Query: 72  KGL-----------GAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNTFVAGVGAG 120
           +GL           GAV++ +  +       Y+F R  L +   G++        GV  G
Sbjct: 72  QGLIPWAWIEASTKGAVLLFVSAE-----AEYQFKRLGLGNFGAGIM-------GGVSGG 119

Query: 121 ITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYR 180
           + +A + +     +K       V     K+ +AG++                       +
Sbjct: 120 VAQAYLTMGFCTCMKT------VEITKAKSAVAGAIP----------------------Q 151

Query: 181 NAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEY----HQTDML 236
           ++  A   I  +EG + + +GV+  A RQ TN G+ F +   ++  ++++    +  D L
Sbjct: 152 SSWSAFKEIYSKEGIKGINKGVNAVAIRQMTNWGSRFGLSRLVEQGIRDFTGKTNPDDKL 211

Query: 237 PSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIG---RQLIREEG 293
            + E      + G L  + N P++ I+  +Q  K   +D    + L +G   + + +  G
Sbjct: 212 TALEKIFASALGGGLSAW-NQPIEVIRVEMQSKK---EDPNRPKKLTVGSAFKYIYQSSG 267

Query: 294 FRALYKGITPRV 305
            + LY+G+ PR+
Sbjct: 268 IKGLYRGVAPRI 279

>CAGL0D04774g complement(467712..468680) similar to tr|Q06497
           Saccharomyces cerevisiae YPR128c, start by similarity
          Length = 322

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 81/341 (23%), Positives = 123/341 (36%), Gaps = 73/341 (21%)

Query: 17  GGTAGLFEALCCHPLDTIKVRMQIYSRAREQG-----QRARGFIGTARDISTQEGFLALY 71
           G  A    A   +PLD  K  +Q   +  + G     ++ +  I     I  + GFL LY
Sbjct: 10  GAVASSLAATTVYPLDLAKTLIQTQHKNADSGDSKEEEKYKNVIDCIIKIFKKRGFLGLY 69

Query: 72  KGLGAVVIGIIPKMAIRFTSYEFFRT-----------LLADRQTGVVSTGNTFVAGVGAG 120
           +GL   V     +  I F  Y   R+           L  D +   +ST      G+ AG
Sbjct: 70  QGLATNVAANFVQNFIYFFWYSLIRSNYFVFKAGRLQLKDDSKFIELSTIEELALGMSAG 129

Query: 121 ITEAVMVVNPMEVVKIRLQ-AQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKY 179
               V V NP+ V+  R Q  +      LKA                             
Sbjct: 130 AMTQV-VTNPISVISTRQQLTKDGEDASLKA----------------------------- 159

Query: 180 RNAIQAAYVIVKEEGP---RALYRGVSLTAARQATNQGANFTVYSTLKSRLQ-------E 229
              I+  Y    EE      A ++G  + A   +TN    +  Y  LKS +         
Sbjct: 160 --VIKQIY----EESNGDLTAFWKGFKV-ALVLSTNPAITYGSYQKLKSMILTAKGLSGS 212

Query: 230 YHQTDMLPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLI 289
              +  L + E  L+G+ S  +  F   PL   K  LQ      K S +     + + + 
Sbjct: 213 QKISTQLSAGENFLLGMFSKMISTFVTQPLIVAKITLQ-----GKGSKFKTFQEVLQHIY 267

Query: 290 REEGFRALYKGITPRVMRVAPGQAVTFT----VYELIRKKL 326
           + EGF +L+KG+ P+V +    Q + FT    +  +IRK L
Sbjct: 268 QNEGFLSLWKGVIPQVSKGVIVQGLLFTYKDEIVRVIRKLL 308

>AGR383W [4694] [Homologous to ScYDL119C - SH]
           complement(1436769..1437650) [882 bp, 293 aa]
          Length = 293

 Score = 51.6 bits (122), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 43/161 (26%), Positives = 68/161 (42%), Gaps = 18/161 (11%)

Query: 179 YRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPS 238
           Y    +A   I + EG R  ++G + T  R A   G    +Y   K  L       +L +
Sbjct: 139 YNGLAEATRHIWRSEGARGFFKGAAATTLRDAPYAGLYVLLYEQAKEMLPRALPATLLGA 198

Query: 239 WETSLI------------GLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGR 286
            E+  +              +S +L     AP DTIKTR+Q     S   G+ + L   R
Sbjct: 199 DESGKLTAPASAMVNGVSAFLSASLATTLTAPFDTIKTRMQLQ---SHPVGFVQTL---R 252

Query: 287 QLIREEGFRALYKGITPRVMRVAPGQAVTFTVYELIRKKLE 327
            ++ EE  R L+ G++ R+ R A    + + +YE + K L 
Sbjct: 253 HIVCEERARTLFDGLSLRLCRKAMSACIAWGIYEELLKLLH 293

 Score = 35.4 bits (80), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 42/86 (48%), Gaps = 16/86 (18%)

Query: 246 LISGALGPFSNA----PLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIRE-EGFRALYKG 300
           L+SG  G  ++     PLD +KTRLQ+ +++S            R ++RE    R L++G
Sbjct: 12  LVSGFFGGLASVCALQPLDLLKTRLQQAQASSL-----------RSVLREVRTTRELWRG 60

Query: 301 ITPRVMRVAPGQAVTFTVYELIRKKL 326
             P  +R + G A+  ++    R  L
Sbjct: 61  TLPSALRTSIGSALYLSLLNYSRSAL 86

 Score = 33.1 bits (74), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 50/225 (22%), Positives = 78/225 (34%), Gaps = 57/225 (25%)

Query: 13  NLVAGGTAGLFEALCCHPLDTIKVRMQ--IYSRAREQGQRARGFIGTARDISTQEGFLAL 70
           NL+ G  +     L   P+  IKVR +  +Y+          G     R I   EG    
Sbjct: 107 NLLTGALSRAAVGLVTMPITVIKVRYESTLYAY--------NGLAEATRHIWRSEGARGF 158

Query: 71  YKGLGAVVIGIIPKMAIRFTSYEFFRTLL----------ADRQTGVVSTGNTFVAGVGAG 120
           +KG  A  +   P   +    YE  + +L          AD    + +  +  V GV A 
Sbjct: 159 FKGAAATTLRDAPYAGLYVLLYEQAKEMLPRALPATLLGADESGKLTAPASAMVNGVSAF 218

Query: 121 ITE--AVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPK 178
           ++   A  +  P + +K R+Q        L++   G V                      
Sbjct: 219 LSASLATTLTAPFDTIKTRMQ--------LQSHPVGFV---------------------- 248

Query: 179 YRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTL 223
                Q    IV EE  R L+ G+SL   R+A +    + +Y  L
Sbjct: 249 -----QTLRHIVCEERARTLFDGLSLRLCRKAMSACIAWGIYEEL 288

 Score = 32.7 bits (73), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 32/68 (47%), Gaps = 10/68 (14%)

Query: 10  PAINLVAGGTAGLFEALCC---HPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEG 66
           PA  +V G +A L  +L      P DTIK RMQ+ S          GF+ T R I  +E 
Sbjct: 207 PASAMVNGVSAFLSASLATTLTAPFDTIKTRMQLQS-------HPVGFVQTLRHIVCEER 259

Query: 67  FLALYKGL 74
              L+ GL
Sbjct: 260 ARTLFDGL 267

>CAGL0F04213g 419473..420393 highly similar to sp|P18239
           Saccharomyces cerevisiae YBL030c AAC2 ADP/ATP carrier
           protein, hypothetical start
          Length = 306

 Score = 51.6 bits (122), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 64/336 (19%), Positives = 131/336 (38%), Gaps = 49/336 (14%)

Query: 4   RKNSSHPAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQG---QRARGFIGTARD 60
           +K  S+ AI+ + GG +         P++ +K+ +Q      +QG    R +G +   + 
Sbjct: 5   KKPQSNFAIDFLMGGVSAAVAKTAASPIERVKLLIQNQDEMIKQGSLDHRYKGIVDCFQR 64

Query: 61  ISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLA-DRQTGVVS--TGNTFVAGV 117
            + QEG ++ ++G  A VI   P  A+ F   +  + +    ++ G      GN    G+
Sbjct: 65  TARQEGIISFWRGNTANVIRYFPTQALNFAFKDQIKAMFGFKKEEGYAKWFAGNLASGGI 124

Query: 118 GAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATP 177
             G++  +M V  ++  + RL A                                     
Sbjct: 125 AGGLS--LMFVYSLDYARTRLAAD--------------------------AKSSKKGGER 156

Query: 178 KYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLP 237
           ++   +      +  +G   LYRG   +       +G  F +Y + K  L       +  
Sbjct: 157 QFNGLVDVYKKTIASDGVAGLYRGFLPSVIGIVVYRGLYFGLYDSCKPLL-------LTG 209

Query: 238 SWETS-----LIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREE 292
           S E S     L+G +       ++ PLDT++ R+    ++ +   +   +   ++++  E
Sbjct: 210 SLEGSFIASFLLGWVVTTGASTASYPLDTVRRRMM--MTSGQAVKYKGAMDCLQKIVAAE 267

Query: 293 GFRALYKGITPRVMRVAPGQAVTFTVYELIRKKLEG 328
           G  +L+KG    ++R   G  V  ++Y+ ++  L G
Sbjct: 268 GVSSLFKGCGANILRGVAGAGVI-SLYDQLQMILFG 302

>AER184W [2686] [Homologous to ScYBL030C (PET9) - SH; ScYBR085W
           (AAC3) - SH] complement(978781..979698) [918 bp, 305 aa]
          Length = 305

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 69/342 (20%), Positives = 133/342 (38%), Gaps = 55/342 (16%)

Query: 1   MSNRKNSSHPAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQG---QRARGFIGT 57
           MS+ K S+   IN + GG +         P++ +K+ +Q      +QG   +R  G +  
Sbjct: 1   MSDNKQSNF-LINFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMLKQGSLDRRYNGIVDC 59

Query: 58  ARDISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQ--TGVVS--TGNTF 113
            +  +  EG ++ ++G  A VI   P  A+ F   +  + +   R+   G      GN  
Sbjct: 60  FKRTAASEGVISFWRGNTANVIRYFPTQALNFAFKDKIKAMFGFRKEVDGYAKWFAGNLA 119

Query: 114 VAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENV 173
             G   G++  ++ V  ++  + RL A        K+   G                   
Sbjct: 120 SGGAAGGLS--LLFVYSLDYARTRLAADS------KSAKKG------------------- 152

Query: 174 AATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLK-----SRLQ 228
               ++   +      +  +G   LYRG   +       +G  F +Y +LK       L+
Sbjct: 153 -GERQFNGLVDVYKKTLASDGIAGLYRGFLPSVVGIVVYRGLYFGMYDSLKPLLLTGNLE 211

Query: 229 EYHQTDMLPSWETSLIGLISGALGPFSNAPLDTIKTRLQ--KDKSTSKDSGWSRILAIGR 286
                  L  W  +     +GA    ++ PLDT++ R+     ++   D  +       R
Sbjct: 212 SSFIASFLLGWAVT-----TGA--STASYPLDTVRRRMMMTSGQAVKYDGAFDAF----R 260

Query: 287 QLIREEGFRALYKGITPRVMRVAPGQAVTFTVYELIRKKLEG 328
           +++  EG ++L+KG    ++R   G  V  ++Y+ ++  L G
Sbjct: 261 KIVAAEGVKSLFKGCGANILRGVAGAGVI-SLYDQLQLVLFG 301

>YBL030C (PET9) [164] chr2 complement(163006..163962) ADP/ATP
           carrier protein of the mitochondrial carrier family
           (MCF) of membrane transporters [957 bp, 318 aa]
          Length = 318

 Score = 51.2 bits (121), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 65/328 (19%), Positives = 127/328 (38%), Gaps = 41/328 (12%)

Query: 8   SHPAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRAR---GFIGTARDISTQ 64
           S+  I+ + GG +         P++ +K+ +Q      +QG   R   G +   +  +TQ
Sbjct: 21  SNFLIDFLMGGVSAAVAKTAASPIERVKLLIQNQDEMLKQGTLDRKYAGILDCFKRTATQ 80

Query: 65  EGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLA-DRQTGVVSTGNTFVAGVGAGITE 123
           EG ++ ++G  A VI   P  A+ F   +  + +    ++ G        +A  GA    
Sbjct: 81  EGVISFWRGNTANVIRYFPTQALNFAFKDKIKAMFGFKKEEGYAKWFAGNLASGGAAGAL 140

Query: 124 AVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAI 183
           +++ V  ++  + RL A                                     ++   I
Sbjct: 141 SLLFVYSLDYARTRLAADS--------------------------KSSKKGGARQFNGLI 174

Query: 184 QAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYH-QTDMLPSWETS 242
                 +K +G   LYRG   +       +G  F +Y +LK  L     +   L S+   
Sbjct: 175 DVYKKTLKSDGVAGLYRGFLPSVVGIVVYRGLYFGMYDSLKPLLLTGSLEGSFLASF--- 231

Query: 243 LIGLISGALGPFSNAPLDTIKTRLQ--KDKSTSKDSGWSRILAIGRQLIREEGFRALYKG 300
           L+G +        + PLDT++ R+     ++   D  +  +    R+++  EG  +L+KG
Sbjct: 232 LLGWVVTTGASTCSYPLDTVRRRMMMTSGQAVKYDGAFDCL----RKIVAAEGVGSLFKG 287

Query: 301 ITPRVMRVAPGQAVTFTVYELIRKKLEG 328
               ++R   G  V  ++Y+ ++  L G
Sbjct: 288 CGANILRGVAGAGVI-SMYDQLQMILFG 314

>YBR085W (AAC3) [275] chr2 (415940..416863) ADP/ATP transporter
           protein, member of the mitochondrial carrier family
           (MCF) of membrane transporters [924 bp, 307 aa]
          Length = 307

 Score = 50.8 bits (120), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 66/332 (19%), Positives = 136/332 (40%), Gaps = 41/332 (12%)

Query: 4   RKNSSHPAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQG---QRARGFIGTARD 60
           ++  ++ AIN + GG +         P++ +K+ +Q      +QG   ++  G +   + 
Sbjct: 6   KQQETNFAINFLMGGVSAAIAKTAASPIERVKILIQNQDEMIKQGTLDKKYSGIVDCFKR 65

Query: 61  ISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQT---GVVSTGNTFVAGV 117
            + QEG ++ ++G  A VI   P  A+ F   +  + +   ++    G    GN  +A  
Sbjct: 66  TAKQEGLISFWRGNTANVIRYFPTQALNFAFKDKIKLMFGFKKEEGYGKWFAGN--LASG 123

Query: 118 GAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATP 177
           GA    +++ V  ++  + RL A        K+   G                +    T 
Sbjct: 124 GAAGALSLLFVYSLDFARTRLAADA------KSSKKGGA-------------RQFNGLTD 164

Query: 178 KYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSR-LQEYHQTDML 236
            Y+  +       K +G   LYRG   +       +G  F ++ +LK   L        L
Sbjct: 165 VYKKTL-------KSDGIAGLYRGFMPSVVGIVVYRGLYFGMFDSLKPLVLTGSLDGSFL 217

Query: 237 PSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRA 296
            S+   L+G +        + PLDT++ R+    ++ +   ++  +   ++++  EG  +
Sbjct: 218 ASF---LLGWVVTTGASTCSYPLDTVRRRMM--MTSGQAVKYNGAIDCLKKIVASEGVGS 272

Query: 297 LYKGITPRVMRVAPGQAVTFTVYELIRKKLEG 328
           L+KG    ++R   G  V  ++Y+ ++  L G
Sbjct: 273 LFKGCGANILRSVAGAGVI-SMYDQLQMILFG 303

>Kwal_27.12481
          Length = 304

 Score = 50.1 bits (118), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 64/339 (18%), Positives = 129/339 (38%), Gaps = 49/339 (14%)

Query: 1   MSNRKNSSHPAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTA-- 58
           M++ K  S+ A++ + GG +         P++ +K+ +Q      +QG   R + G    
Sbjct: 1   MADSKKQSNFAVDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKQGSLDRRYTGIGEC 60

Query: 59  -RDISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLA-DRQTGVVS--TGNTFV 114
            +  +  EG  + ++G  A VI   P  A+ F   +  + +    ++ G      GN   
Sbjct: 61  FKRTAANEGIASFWRGNTANVIRYFPTQALNFAFKDKIKAMFGFKKEEGYAKWFAGNLAS 120

Query: 115 AGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVA 174
            G   G++  +M V  ++  + RL A                                  
Sbjct: 121 GGAAGGLS--LMFVYSLDYARTRLAADS--------------------------KGAKKG 152

Query: 175 ATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLK-----SRLQE 229
              ++   +      +  +G   LYRG   +       +G  F  Y +LK       L+ 
Sbjct: 153 GERQFNGLVDVYKKTLASDGIAGLYRGFLPSVVGIVVYRGLYFGGYDSLKPLLLTGSLEG 212

Query: 230 YHQTDMLPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLI 289
                 L  W  +     +GA    ++ PLDT++ R+    ++ +   ++      R+++
Sbjct: 213 SFLASFLLGWAVT-----TGA--STASYPLDTVRRRMM--MTSGQAVKYNGAFDAFRKIV 263

Query: 290 REEGFRALYKGITPRVMRVAPGQAVTFTVYELIRKKLEG 328
             EG ++L+KG    ++R   G  V  ++Y+ ++  L G
Sbjct: 264 AAEGIKSLFKGCGANILRGVAGAGVI-SMYDQLQMILFG 301

>Sklu_2194.3 YMR241W, Contig c2194 5245-6183
          Length = 312

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 59/292 (20%), Positives = 115/292 (39%), Gaps = 64/292 (21%)

Query: 29  HPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYKGL-----------GAV 77
            PL+ IK  M           R+  F    + + ++ G    Y+GL           GAV
Sbjct: 37  QPLEVIKTTMA--------ANRSFSFFNAIKHVWSRGGVFGFYQGLIPWAWIEASTKGAV 88

Query: 78  VIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNTFVAGVGAGITEAVMVVNPMEVVKIR 137
           ++ +  +     + Y+F R  L++  +G++        GV  G+ +A + +     +K  
Sbjct: 89  LLFVSAE-----SEYQFKRMGLSNFGSGIM-------GGVTGGVAQAYLTMGFCTCMKT- 135

Query: 138 LQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAAYVIVKEEGPRA 197
                V     K+  AG++                       +++  A   I K++G + 
Sbjct: 136 -----VEITKKKSAGAGAIP----------------------QSSWGAFKEIYKKDGIKG 168

Query: 198 LYRGVSLTAARQATNQGANF----TVYSTLKSRLQEYHQTDMLPSWETSLIGLISGALGP 253
           + +GV+  A RQ TN G+ F     V   +++   + +  D L + E      I G L  
Sbjct: 169 INKGVNAVAIRQMTNWGSRFGFSRLVEEGIRNATGKTNPDDKLTALEKIAASAIGGGLSA 228

Query: 254 FSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITPRV 305
           + N P++ I+  +Q  K          + +  + + +  G + LY+G+ PR+
Sbjct: 229 W-NQPIEVIRVEMQSKKEDPNRPKNLTVSSAFKYIYQSSGIKGLYRGVAPRI 279

>Scas_715.45
          Length = 305

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 59/305 (19%), Positives = 113/305 (37%), Gaps = 61/305 (20%)

Query: 30  PLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYKGLGAVVIGIIPKMAIRF 89
           PLD IK R+Q+            G I     I  +EG   L+ G+GA  IG   + A ++
Sbjct: 36  PLDLIKCRLQVDPTLYRS--NTSGII----QILKKEGLGKLFTGVGATCIGYSLQGAGKY 89

Query: 90  TSYEFFR-----TLLADRQTGVVSTGNTFVAGVGAGITEAVMVVNPMEVVKIRLQAQHVR 144
             YE F+      L+ D  T      + ++         A +++ P E +K++ Q     
Sbjct: 90  GGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFEAIKVKQQT---- 145

Query: 145 YVPLKAQLAGSVXXXXXXXXXXXXXXENVAATPKYRNAIQAAYVIVKEEGPRALYRGVSL 204
                                           P   N I+    +  +EG    Y+G++ 
Sbjct: 146 -----------------------------TMPPWCNNVIEGWKKMYAKEGLNGFYKGITP 176

Query: 205 TAARQATNQGANFT--------VYSTLKSRLQEYHQTDMLPSWETSLI-GLISGALGPFS 255
              RQ       FT        +Y+ L ++  E      +     S + G ++G L    
Sbjct: 177 LWCRQIPYTMCKFTSFERIVEAIYARLPTKKSEMSALQQI---SVSFVGGYMAGILCAIV 233

Query: 256 NAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITPRVMRVAPGQAVT 315
           + P D + +++  ++  ++    S  +A+ R +    GF  L+ G+  R++ +    +  
Sbjct: 234 SHPADVMVSKINNERKVNE----SMNVALKR-IYSRIGFVGLWNGLPVRILMIGTLTSFQ 288

Query: 316 FTVYE 320
           + +Y+
Sbjct: 289 WLIYD 293

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 39/152 (25%), Positives = 60/152 (39%), Gaps = 15/152 (9%)

Query: 179 YRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPS 238
           YR+       I+K+EG   L+ GV  T    +      +  Y   K     +   D   +
Sbjct: 51  YRSNTSGIIQILKKEGLGKLFTGVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATA 110

Query: 239 WE--TSLIGLISGALGPFSN---APLDTIKTRLQKDKSTSKDS---GWSRILAIGRQLIR 290
           ++  TS+  L S     F++    P + IK + Q       ++   GW ++ A       
Sbjct: 111 YKYRTSIYLLSSATAEFFADIMLCPFEAIKVKQQTTMPPWCNNVIEGWKKMYA------- 163

Query: 291 EEGFRALYKGITPRVMRVAPGQAVTFTVYELI 322
           +EG    YKGITP   R  P     FT +E I
Sbjct: 164 KEGLNGFYKGITPLWCRQIPYTMCKFTSFERI 195

 Score = 36.6 bits (83), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 54/131 (41%), Gaps = 13/131 (9%)

Query: 11  AINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLAL 70
           +I L++  TA  F  +   P + IKV+ Q               I   + +  +EG    
Sbjct: 116 SIYLLSSATAEFFADIMLCPFEAIKVKQQ-----TTMPPWCNNVIEGWKKMYAKEGLNGF 170

Query: 71  YKGLGAVVIGIIPKMAIRFTSYEFFRTLLADR-------QTGVVSTGNTFVAGVGAGITE 123
           YKG+  +    IP    +FTS+E     +  R        + +     +FV G  AGI  
Sbjct: 171 YKGITPLWCRQIPYTMCKFTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILC 230

Query: 124 AVMVVNPMEVV 134
           A+ V +P +V+
Sbjct: 231 AI-VSHPADVM 240

 Score = 31.2 bits (69), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 40/77 (51%), Gaps = 7/77 (9%)

Query: 250 ALGPFSNA--PLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITPRVMR 307
           A GP  ++  PLD IK RLQ D +  + S  S I+    Q++++EG   L+ G+    + 
Sbjct: 26  ACGPTHSSVTPLDLIKCRLQVDPTLYR-SNTSGII----QILKKEGLGKLFTGVGATCIG 80

Query: 308 VAPGQAVTFTVYELIRK 324
            +   A  +  YEL ++
Sbjct: 81  YSLQGAGKYGGYELFKR 97

>Scas_705.9
          Length = 323

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 72/326 (22%), Positives = 116/326 (35%), Gaps = 62/326 (19%)

Query: 15  VAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQ---------RARGFIGTARDISTQE 65
           + G  A     +  +PLD  K  +Q  ++A+E  +         R    I     I  + 
Sbjct: 8   ITGAIASTMANVIVYPLDVAKTVIQSETKAKETDELSEKDKRILRQENVIRCLIRIFRKR 67

Query: 66  GFLALYKGLGAVVIGIIPKMAIRFTSYEFFR------TLLADRQT---GVVSTGNTFVAG 116
           G   LY+G+   V     +    F  Y F R       LL + Q      +ST    + G
Sbjct: 68  GLRGLYQGMSTSVFSKFVQSFCYFFWYSFLRRKYFSLKLLRNTQARPINSISTVEELIVG 127

Query: 117 VGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAAT 176
           VGA     V V NP+EV+  + Q    +                          +NV   
Sbjct: 128 VGAAALTQV-VNNPIEVILTKQQTTDDK--------------------------DNV--- 157

Query: 177 PKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRL------QEY 230
             + + ++  Y  V+  G  + Y      +     N    F  Y   K  L       E 
Sbjct: 158 -DFYSVLKQIY--VESNGKLSSYWKGFKVSLILTVNPSITFAAYQRFKDILLKQVSNSEK 214

Query: 231 HQTDMLPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIR 290
             +  L   +  ++G ++  +      PL   K  LQ  +S SK   +  +L   R L +
Sbjct: 215 SYSGQLTVNQNFILGALAKIISTIITQPLIVAKVSLQ--RSNSKFKHFEEVL---RYLYK 269

Query: 291 EEGFRALYKGITPRVMRVAPGQAVTF 316
           EEG  AL+KG+ P++ +    Q + F
Sbjct: 270 EEGVLALWKGVGPQLTKGVLVQGLVF 295

 Score = 34.3 bits (77), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 36/151 (23%), Positives = 66/151 (43%), Gaps = 17/151 (11%)

Query: 181 NAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSR---LQEYHQTDMLP 237
           N I+    I ++ G R LY+G+S +   +       F  YS L+ +   L+    T   P
Sbjct: 55  NVIRCLIRIFRKRGLRGLYQGMSTSVFSKFVQSFCYFFWYSFLRRKYFSLKLLRNTQARP 114

Query: 238 -----SWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREE 292
                + E  ++G+ + AL    N P++ I T+ Q    T+ D       ++ +Q+  E 
Sbjct: 115 INSISTVEELIVGVGAAALTQVVNNPIEVILTKQQ----TTDDKDNVDFYSVLKQIYVES 170

Query: 293 G--FRALYKGI-TPRVMRVAPGQAVTFTVYE 320
                + +KG     ++ V P  ++TF  Y+
Sbjct: 171 NGKLSSYWKGFKVSLILTVNP--SITFAAYQ 199

 Score = 33.9 bits (76), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 44/100 (44%), Gaps = 10/100 (10%)

Query: 236 LPSWETSLIGLISGALGPFSNAPLDTIKTRLQK-------DKSTSKDSGWSRILAIGRQL 288
           + + E+++ G I+  +      PLD  KT +Q        D+ + KD    R   + R L
Sbjct: 1   MSNLESAITGAIASTMANVIVYPLDVAKTVIQSETKAKETDELSEKDKRILRQENVIRCL 60

Query: 289 IR---EEGFRALYKGITPRVMRVAPGQAVTFTVYELIRKK 325
           IR   + G R LY+G++  V          F  Y  +R+K
Sbjct: 61  IRIFRKRGLRGLYQGMSTSVFSKFVQSFCYFFWYSFLRRK 100

 Score = 32.7 bits (73), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 28/63 (44%), Gaps = 6/63 (9%)

Query: 13  NLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYK 72
           N + G  A +   +   PL   KV +Q          + + F    R +  +EG LAL+K
Sbjct: 225 NFILGALAKIISTIITQPLIVAKVSLQ------RSNSKFKHFEEVLRYLYKEEGVLALWK 278

Query: 73  GLG 75
           G+G
Sbjct: 279 GVG 281

>YPR128C (ANT1) [5547] chr16 complement(791212..792198)
           Peroxisome-localized protein involved in adenine
           nucleotide transport, medium-chain fatty acid
           metabolism, and peroxisome proliferation, has similarity
           to ADP/ATP carrier proteins [987 bp, 328 aa]
          Length = 328

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 69/341 (20%), Positives = 124/341 (36%), Gaps = 66/341 (19%)

Query: 15  VAGGTAGLFEALCCHPLDTIK--VRMQIYSRAREQ--------GQRARGFIGTARDISTQ 64
           + G  A     +  +PLD  K  ++ Q+   + E          +R +  +    +I  +
Sbjct: 8   LTGAVASAMANIAVYPLDLSKTIIQSQVSPSSSEDSNEGKVLPNRRYKNVVDCMINIFKE 67

Query: 65  EGFLALYKGLGAVVIGIIPKMAIRFTSYEFFR-TLLADRQTGVVSTGN-----------T 112
           +G L LY+G+    +    +  + F  Y F R + +  +  G+ S  N            
Sbjct: 68  KGILGLYQGMTVTTVATFVQNFVYFFWYTFIRKSYMKHKLLGLQSLKNRDGPITPSTIEE 127

Query: 113 FVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXEN 172
            V GV A  + + +  +PM VV  R Q  H                              
Sbjct: 128 LVLGVAAA-SISQLFTSPMAVVATRQQTVHS----------------------------- 157

Query: 173 VAATPKYRNAIQAAYVIVKEEGPR--ALYRGVSLTAARQATNQGANFTVYSTLKSRLQEY 230
            A + K+ N I+  Y   +E      A ++G+  T      N    +  +  LK      
Sbjct: 158 -AESAKFTNVIKDIY---RENNGDITAFWKGLR-TGLALTINPSITYASFQRLKEVFFHD 212

Query: 231 HQTDM--LPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQL 288
           H  D   L + +  ++G++S  +      PL   K  LQ     S  S ++        L
Sbjct: 213 HSNDAGSLSAVQNFILGVLSKMISTLVTQPLIVAKAMLQ-----SAGSKFTTFQEALLYL 267

Query: 289 IREEGFRALYKGITPRVMRVAPGQAVTFTVYELIRKKLEGL 329
            + EG ++L+KG+ P++ +    Q + F     + K L+ L
Sbjct: 268 YKNEGLKSLWKGVLPQLTKGVIVQGLLFAFRGELTKSLKRL 308

>KLLA0D04312g 367160..367471 highly similar to sgd|S0006215
           Saccharomyces cerevisiae YPR011c, hypothetical start
          Length = 103

 Score = 42.7 bits (99), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 45/86 (52%), Gaps = 4/86 (4%)

Query: 244 IGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLI---REEGFRALYKG 300
           +G ISG +      P D ++ R Q       + G+ R  ++   LI   + EG +  YKG
Sbjct: 16  MGAISGGVAQTLVYPFDLLRRRFQVLAMGGNELGF-RYKSVSDALITIGKTEGPKGYYKG 74

Query: 301 ITPRVMRVAPGQAVTFTVYELIRKKL 326
           +T  + +V P  AV++ VYE+IR+ +
Sbjct: 75  LTANLFKVIPSTAVSWLVYEVIREAM 100

 Score = 38.1 bits (87), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 42/100 (42%), Gaps = 5/100 (5%)

Query: 3   NRKNSSHPAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRA-REQGQRARGFIGTARDI 61
           N  N    A+  ++GG A        +P D ++ R Q+ +    E G R +        I
Sbjct: 7   NLANLYKLAMGAISGGVA----QTLVYPFDLLRRRFQVLAMGGNELGFRYKSVSDALITI 62

Query: 62  STQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLAD 101
              EG    YKGL A +  +IP  A+ +  YE  R  + +
Sbjct: 63  GKTEGPKGYYKGLTANLFKVIPSTAVSWLVYEVIREAMVE 102

 Score = 29.6 bits (65), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 12/53 (22%), Positives = 27/53 (50%)

Query: 178 KYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEY 230
           +Y++   A   I K EGP+  Y+G++    +   +   ++ VY  ++  + E+
Sbjct: 51  RYKSVSDALITIGKTEGPKGYYKGLTANLFKVIPSTAVSWLVYEVIREAMVEW 103

>KLLA0E12353g complement(1092303..1093220)
           gi|1351895|sp|P49382|ADT_KLULA Kluyveromyces lactis ADP,
           ATP carrier protein (ADP/ATP translocase) (Adenine
           nucleotide translocator) (ANT), start by similarity
          Length = 305

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 66/339 (19%), Positives = 130/339 (38%), Gaps = 49/339 (14%)

Query: 1   MSNRKNSSHPAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQG---QRARGFIGT 57
           MS  K  S+ AI+ + GG +         P++ +K+ +Q      +QG   +R  G +  
Sbjct: 1   MSTDKKQSNFAIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKQGSLDRRYTGIVEC 60

Query: 58  ARDISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLA-DRQTGVVSTGNTFVAG 116
            +  +  EG  + ++G  A VI   P  A+ F   +  + +    ++ G        +A 
Sbjct: 61  FKRTAADEGVASFWRGNTANVIRYFPTQALNFAFKDKIKAMFGFKKEEGYAKWFAGNLAS 120

Query: 117 VGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAAT 176
            G     +++ V  ++  + RL A        K+   G                      
Sbjct: 121 GGLAGGLSLLFVYSLDYARTRLAADS------KSAKKG--------------------GE 154

Query: 177 PKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLK-----SRLQEYH 231
            ++   +      +  +G   LYRG   +       +G  F +Y +LK       L+   
Sbjct: 155 RQFNGLVDVYKKTLASDGVAGLYRGFLPSVVGIVVYRGLYFGLYDSLKPLLLTGSLENSF 214

Query: 232 QTDMLPSWETSLIGLISGALGPFSNAPLDTIKTRLQ--KDKSTSKDSGWSRILAIGRQLI 289
               L  W  +     +GA    ++ PLDT++ R+     ++   D  +       R+++
Sbjct: 215 LASFLLGWAVT-----TGA--STASYPLDTVRRRMMMTSGQAVKYDGAFDAF----RKIV 263

Query: 290 REEGFRALYKGITPRVMRVAPGQAVTFTVYELIRKKLEG 328
             EG ++L+KG    ++R   G  V  ++Y+ ++  L G
Sbjct: 264 AAEGIKSLFKGCGANILRGVAGAGVI-SMYDQLQVILFG 301

>KLLA0E22880g complement(2033077..2034387) similar to
           ca|CA2800|IPF11366 Candida albicans unknown function,
           hypothetical start
          Length = 436

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 40/85 (47%)

Query: 245 GLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITPR 304
           G ++GA     +AP+D I TR   D+  S    +  +    R  IRE G    + G    
Sbjct: 167 GFLAGAAQAIVSAPIDAIYTRANIDELLSSAKKYDNLWLYSRDKIREIGLIGCFGGFGLS 226

Query: 305 VMRVAPGQAVTFTVYELIRKKLEGL 329
            +R + G A+ FT +E+IR  +  L
Sbjct: 227 FIRESFGFALYFTTFEMIRGPIRQL 251

>Sklu_2435.2 YPR128C, Contig c2435 2489-3523 reverse complement
          Length = 344

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 34/154 (22%), Positives = 74/154 (48%), Gaps = 9/154 (5%)

Query: 178 KYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKS---RLQEYHQTD 234
           +Y +   A Y I K+EG R LY+G++ +         + F  YS ++    R++  ++ +
Sbjct: 74  QYNSTFDAIYKIYKQEGIRGLYQGLTTSVMAGFFQTFSYFFWYSFVRKCYFRVKLINRKN 133

Query: 235 M-LPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREE- 292
               + E  L+G+++ A       P+  I  R Q  +    D+ +   L + +++ +E+ 
Sbjct: 134 TKFTTIEELLLGIVAAATSQIFTNPISLISARQQTRQGIDGDNDF---LTVAKEIYKEQR 190

Query: 293 GFRALYKGITPRVMRVAPGQAVTFTVYELIRKKL 326
             +  +KG+   +M +    ++T+T YE ++  L
Sbjct: 191 SIKGFWKGLKVSLM-LTINPSITYTSYEKLKDAL 223

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 55/272 (20%), Positives = 100/272 (36%), Gaps = 55/272 (20%)

Query: 61  ISTQEGFLALYKGLGAVVIGIIPKMAIRFTSYEF-----FRTLLADRQTGVVSTGNTFVA 115
           I  QEG   LY+GL   V+    +    F  Y F     FR  L +R+    +T    + 
Sbjct: 85  IYKQEGIRGLYQGLTTSVMAGFFQTFSYFFWYSFVRKCYFRVKLINRKNTKFTTIEELLL 144

Query: 116 GVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXXXXXXXXXENVAA 175
           G+ A  T  +   NP+ ++  R Q +          + G                     
Sbjct: 145 GIVAAATSQIFT-NPISLISARQQTRQ--------GIDGD-------------------- 175

Query: 176 TPKYRNAIQAAYVIVKEE-GPRALYRGVSLTAARQATNQGANFTVYSTLKSRL------- 227
                + +  A  I KE+   +  ++G+ ++      N    +T Y  LK  L       
Sbjct: 176 ----NDFLTVAKEIYKEQRSIKGFWKGLKVSLML-TINPSITYTSYEKLKDALFTTDTMN 230

Query: 228 ---QEYHQTDMLPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAI 284
              +    +  L  ++   +G++S  +      PL   K  LQ++      S +S    +
Sbjct: 231 LKKELVDSSSQLSPYQNFTLGVLSKMISAIITMPLIISKAWLQRN-----GSNFSSFQQV 285

Query: 285 GRQLIREEGFRALYKGITPRVMRVAPGQAVTF 316
              L + EG R+ +KG++P++ +    Q + F
Sbjct: 286 LYYLYKNEGLRSWWKGLSPQLAKGVLVQGLLF 317

>ADR036C [1777] [Homologous to ScYPR128C (ANT1) - SH]
           (771097..772119) [1023 bp, 340 aa]
          Length = 340

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 37/157 (23%), Positives = 74/157 (47%), Gaps = 10/157 (6%)

Query: 175 ATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKS---RLQEYH 231
           A  +Y+ A+ A   I   EG   LYRG+  +         + F  Y+ ++    RL++  
Sbjct: 68  AAEQYKGALDALQRIYGAEGVAGLYRGLGSSTVAGFIQSFSYFFWYTLVRKHYFRLKQAR 127

Query: 232 QTDM-LPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIR 290
             D    + E  ++G+++ A       P++ + TR Q   +  + +G + +  + R++  
Sbjct: 128 GGDARFSTPEELVLGIVAAATSQLFVNPINVVATRQQ---TRGQAAGAADMRTVAREVHA 184

Query: 291 EEGFRALYKGI-TPRVMRVAPGQAVTFTVYELIRKKL 326
           E G+R  + G+    V+ V P  ++T+  YE +R+ L
Sbjct: 185 ENGWRGFWAGLKVSLVLTVNP--SITYATYERLREAL 219

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 78/359 (21%), Positives = 125/359 (34%), Gaps = 81/359 (22%)

Query: 13  NLVAGGTAGLFEALCCHPLDTIKVRMQ-----------------------------IYSR 43
           N V G TA     +  +PLD  K  +Q                             I  R
Sbjct: 5   NAVIGATASSLANIAVYPLDLAKTLVQTQLKDEFVEAGEEAGEERAGSRRQNRIKPIALR 64

Query: 44  AREQGQRARGFIGTARDISTQEGFLALYKGLG-AVVIGIIPKMAIRF----TSYEFFRTL 98
           + +  ++ +G +   + I   EG   LY+GLG + V G I   +  F        +FR  
Sbjct: 65  SPQAAEQYKGALDALQRIYGAEGVAGLYRGLGSSTVAGFIQSFSYFFWYTLVRKHYFRLK 124

Query: 99  LADRQTGVVSTGNTFVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXX 158
            A       ST    V G+ A  T   + VNP+ VV  R Q         + Q AG+   
Sbjct: 125 QARGGDARFSTPEELVLGIVAAATSQ-LFVNPINVVATRQQT--------RGQAAGAA-- 173

Query: 159 XXXXXXXXXXXXENVAATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFT 218
                                 +    A  +  E G R  + G+ ++      N    + 
Sbjct: 174 ----------------------DMRTVAREVHAENGWRGFWAGLKVSLVL-TVNPSITYA 210

Query: 219 VYSTLKSRL-----QEYHQTD---MLPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDK 270
            Y  L+  L        H  D   +L   +  ++G++S  +      PL   K  LQ+  
Sbjct: 211 TYERLREALFPTPAAASHLVDSAALLSPGQNFVMGVLSKIVSTVLTQPLIIAKASLQRSG 270

Query: 271 STSKDSGWSRILAIGRQLIREEGFRALYKGITPRVMRVAPGQAVTFTVYELIRKKLEGL 329
           S  +D  + ++L     L   EG  +L+KG+ P++ +    Q + F     + K L  L
Sbjct: 271 SCFQD--FHQVL---HHLYSTEGPLSLWKGLGPQITKGVLVQGLLFMFKGELTKMLRKL 324

>YDL119C (YDL119C) [751] chr4 complement(246689..247612) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [924 bp, 307 aa]
          Length = 307

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 41/85 (48%), Gaps = 14/85 (16%)

Query: 246 LISGALGPFSNA----PLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGI 301
           LI G  G  ++A    PLD +KTR+Q+DK   K + W  +  I   L        L++G 
Sbjct: 14  LIGGFFGGLTSAVALQPLDLLKTRIQQDK---KATLWKNLKEIDSPL-------QLWRGT 63

Query: 302 TPRVMRVAPGQAVTFTVYELIRKKL 326
            P  +R + G A+  +   L+R  L
Sbjct: 64  LPSALRTSIGSALYLSCLNLMRSSL 88

 Score = 38.1 bits (87), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 40/82 (48%), Gaps = 5/82 (6%)

Query: 245 GLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITPR 304
            ++S +L     AP DTIKTR+Q + S   +S           +++ E    L+ G++ R
Sbjct: 230 AVLSASLATTVTAPFDTIKTRMQLEPSKFTNS-----FNTFTSIVKNENVLKLFSGLSMR 284

Query: 305 VMRVAPGQAVTFTVYELIRKKL 326
           + R A    + + +YE + K+ 
Sbjct: 285 LARKAFSAGIAWGIYEELVKRF 306

 Score = 35.8 bits (81), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 38/163 (23%), Positives = 64/163 (39%), Gaps = 33/163 (20%)

Query: 5   KNSSHPAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQ 64
           +NSSH    L+ G   GL  A+   PLD +K R+Q       Q ++A  +    +++   
Sbjct: 9   RNSSH----LIGGFFGGLTSAVALQPLDLLKTRIQ-------QDKKATLW----KNLKEI 53

Query: 65  EGFLALYKGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGN--TFVAGVGAGIT 122
           +  L L++G     +      A+  +     R+ LA R+  V S  N    V    + + 
Sbjct: 54  DSPLQLWRGTLPSALRTSIGSALYLSCLNLMRSSLAKRRNAVPSLTNDSNIVYNKSSSLP 113

Query: 123 EAVMVVN----------------PMEVVKIRLQAQHVRYVPLK 149
              M  N                P+ V+K+R ++    Y  LK
Sbjct: 114 RLTMYENLLTGAFARGLVGYITMPITVIKVRYESTLYNYSSLK 156

 Score = 30.4 bits (67), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 25/50 (50%)

Query: 178 KYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRL 227
           K+ N+      IVK E    L+ G+S+  AR+A + G  + +Y  L  R 
Sbjct: 257 KFTNSFNTFTSIVKNENVLKLFSGLSMRLARKAFSAGIAWGIYEELVKRF 306

>Scas_613.24
          Length = 177

 Score = 36.6 bits (83), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 43/87 (49%), Gaps = 14/87 (16%)

Query: 244 IGLISGALGPFSNA----PLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYK 299
           + L+SG +G  S+A    PLD +KTR+Q+ K  +    WS I  I   +         ++
Sbjct: 10  VHLVSGFIGGLSSAVTLQPLDLLKTRIQQHKGATL---WSAIKDIKDPI-------QFWR 59

Query: 300 GITPRVMRVAPGQAVTFTVYELIRKKL 326
           G  P  +R + G A+  +   ++R +L
Sbjct: 60  GTLPSALRTSIGSALYLSCLNIMRTQL 86

 Score = 30.0 bits (66), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 24/39 (61%), Gaps = 2/39 (5%)

Query: 1  MSNRKNSSHPAINLVAGGTAGLFEALCCHPLDTIKVRMQ 39
          MS++  S   +++LV+G   GL  A+   PLD +K R+Q
Sbjct: 1  MSDK--SPKTSVHLVSGFIGGLSSAVTLQPLDLLKTRIQ 37

>Scas_328.1
          Length = 227

 Score = 36.6 bits (83), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 32/136 (23%), Positives = 60/136 (44%), Gaps = 7/136 (5%)

Query: 174 AATPKYRNAIQAAYV-IVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKS-RLQEYH 231
           +  P+  N I   Y   +  +G   LYRG   +       +G  F +Y +LK   L    
Sbjct: 73  SGAPRKFNGILDVYKKTLFTDGVLGLYRGFLPSVVGIMVYRGLYFGLYDSLKPVLLTGSF 132

Query: 232 QTDMLPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIRE 291
           +   LPS+       IS +    ++ PLDT++ R+    ++ +   +   +   +Q++ +
Sbjct: 133 ENAFLPSFLLGWAVTISAST---TSYPLDTVRRRMMM--TSGQAVKYKGAIDCFQQIVSQ 187

Query: 292 EGFRALYKGITPRVMR 307
           EG  +L+KG    + R
Sbjct: 188 EGVYSLFKGCGANIFR 203

 Score = 36.2 bits (82), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 30/51 (58%), Gaps = 3/51 (5%)

Query: 29  HPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYKGLGAVVI 79
           +PLDT++ RM + S    Q  + +G I   + I +QEG  +L+KG GA + 
Sbjct: 155 YPLDTVRRRMMMTS---GQAVKYKGAIDCFQQIVSQEGVYSLFKGCGANIF 202

>Scas_671.1*
          Length = 123

 Score = 34.3 bits (77), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 47/102 (46%), Gaps = 10/102 (9%)

Query: 230 YHQTDMLPSWETSLI-----GLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAI 284
           +++ DM  S  TS +      + S +L     AP DTIKTR+Q      K   ++     
Sbjct: 26  HYKEDMKFSTSTSTVVNSVSAIASASLATAITAPFDTIKTRMQL-----KPKVFTNFFTT 80

Query: 285 GRQLIREEGFRALYKGITPRVMRVAPGQAVTFTVYELIRKKL 326
              + + E    L+ G++ R+ R A    + + +YE + K++
Sbjct: 81  LVLITKNESIFQLFSGLSMRLTRKALSAGIAWGIYEDLIKRI 122

>KLLA0B11319g 988293..989360 similar to sgd|S0006332 Saccharomyces
           cerevisiae YPR128c, start by similarity
          Length = 355

 Score = 35.8 bits (81), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 61/282 (21%), Positives = 104/282 (36%), Gaps = 54/282 (19%)

Query: 49  QRARGFIGTARDISTQEGFLALYKGLGAVVIGIIPKMAIRFTSY-----EFFRTLLADRQ 103
           QR +  +     +   EGF  LY GL A ++G   +    F  Y      +FR      +
Sbjct: 85  QRYKHALDVIVKVYRNEGFGGLYHGLSASLLGTFIQSFSYFFWYTLIRRHYFRVKKVKGE 144

Query: 104 TGVVSTGNTFVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVXXXXXXX 163
               ST    +  + A  T   +  NP+ +V  + Q         +  L G         
Sbjct: 145 AARFSTIEELLLSMLAAATSQ-LFTNPINIVSTKQQT--------RRGLEGD-------- 187

Query: 164 XXXXXXXENVAATPKYRNAIQA-AYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYST 222
                            N+ +A A  +  E+G    ++ + ++      N    +     
Sbjct: 188 -----------------NSFKAIAKEVYDEDGITGFWKSLKVSLVL-TINPSITYASAEK 229

Query: 223 LKSRLQ--EYHQTDM------LPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSK 274
           LK  L   E++  D+      L   +  LIG++S  +      PL   K  LQ+  S+SK
Sbjct: 230 LKDILYHVEWNAKDLNDSSLQLKPGQNFLIGVLSKIISTCLTHPLIVAKASLQR--SSSK 287

Query: 275 DSGWSRILAIGRQLIREEGFRALYKGITPRVMRVAPGQAVTF 316
            + +  +L     L R EG  AL+KG+ P++ +    Q + F
Sbjct: 288 FTSFQEVLTY---LYRHEGAHALWKGLLPQLTKGVIVQGLLF 326

>AEL060C [2446] [Homologous to NOHBY] (525069..526358) [1290 bp, 429
           aa]
          Length = 429

 Score = 36.2 bits (82), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 39/79 (49%)

Query: 245 GLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITPR 304
           G ++G     ++AP+D I TR   +   S    ++ +   G   ++E G    + G    
Sbjct: 163 GFMAGVAQAVASAPIDAIYTRSTANDLLSSAKKYNSLWLYGIDKLKEIGLVGCFGGFGLS 222

Query: 305 VMRVAPGQAVTFTVYELIR 323
           +++ + G AV FT +EL++
Sbjct: 223 LVKESVGFAVYFTTFELLK 241

>Kwal_55.21106
          Length = 328

 Score = 35.8 bits (81), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 35/149 (23%), Positives = 66/149 (44%), Gaps = 12/149 (8%)

Query: 178 KYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYH----QT 233
           +Y++++ A   I K +G   LY+G+  +         + F  YS ++     Y     + 
Sbjct: 59  RYKHSLDALIKIFKTKGVLGLYQGLWTSIIAGFLQSFSYFFWYSIVRKSFFRYKLLRGRL 118

Query: 234 DMLPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREE- 292
               + E  L+G+++ A+     +P+  I TR Q   S SK  G+  +L    Q+  E+ 
Sbjct: 119 GKFSTPEELLLGIVAAAVSQIFTSPIGVISTRQQTSTSGSKG-GFREVL---HQIYSEQN 174

Query: 293 GFRALYKGI-TPRVMRVAPGQAVTFTVYE 320
                ++G     ++ V P  ++TF  YE
Sbjct: 175 NITGFWRGFKVSLILTVNP--SITFASYE 201

>YOR084W (YOR084W) [4890] chr15 (480588..481751) Peroxisomal matrix
           protein of unknown molecular function, has low
           similarity to C. albicans Orf6.1403p [1164 bp, 387 aa]
          Length = 387

 Score = 31.2 bits (69), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 12/22 (54%), Positives = 16/22 (72%)

Query: 7   SSHPAINLVAGGTAGLFEALCC 28
            SHPA+N+V G + G F+AL C
Sbjct: 133 DSHPALNVVIGHSMGGFQALAC 154

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.134    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,680,906
Number of extensions: 314171
Number of successful extensions: 2547
Number of sequences better than 10.0: 213
Number of HSP's gapped: 1688
Number of HSP's successfully gapped: 905
Length of query: 329
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 227
Effective length of database: 13,065,073
Effective search space: 2965771571
Effective search space used: 2965771571
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 62 (28.5 bits)