Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_47.181921307128867140.0
AAL060W1305130037790.0
YDR301W (CFT1)1357133836900.0
Scas_588.131340132036360.0
CAGL0H01463g1361133933730.0
KLLA0C10274g1300129833510.0
Kwal_27.100391284142830.17
AFR382W1288109741.7
KLLA0F22583g534131687.6
Kwal_56.2331627858679.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_47.18192
         (1288 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_47.18192                                                        2590   0.0  
AAL060W [127] [Homologous to ScYDR301W (CFT1) - SH] complement(2...  1460   0.0  
YDR301W (CFT1) [1129] chr4 (1063344..1067417) Component of pre-m...  1425   0.0  
Scas_588.13                                                          1405   0.0  
CAGL0H01463g 142420..146505 similar to tr|Q06632 Saccharomyces c...  1303   0.0  
KLLA0C10274g complement(879403..883305) similar to sgd|S0002709 ...  1295   0.0  
Kwal_27.10039                                                          37   0.17 
AFR382W [3574] [Homologous to ScYML049C (RSE1) - SH] complement(...    33   1.7  
KLLA0F22583g 2107305..2108909 highly similar to sp|P39077 Saccha...    31   7.6  
Kwal_56.23316                                                          30   9.1  

>Kwal_47.18192
          Length = 1307

 Score = 2590 bits (6714), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1259/1288 (97%), Positives = 1259/1288 (97%)

Query: 1    MNVYDEIFDATTVSHALLGHFTSEKYDQLIAARTNVLSVYKTDHEKLVLLHEYKLHGRIT 60
            MNVYDEIFDATTVSHALLGHFTSEKYDQLIAARTNVLSVYKTDHEKLVLLHEYKLHGRIT
Sbjct: 1    MNVYDEIFDATTVSHALLGHFTSEKYDQLIAARTNVLSVYKTDHEKLVLLHEYKLHGRIT 60

Query: 61   GMVLVPQLRSPLDCLMISTGKAKLSLVRFDPNMPIWLETISLHYYEAQFSEKSILELAES 120
            GMVLVPQLRSPLDCLMISTGKAKLSLVRFDPNMPIWLETISLHYYEAQFSEKSILELAES
Sbjct: 61   GMVLVPQLRSPLDCLMISTGKAKLSLVRFDPNMPIWLETISLHYYEAQFSEKSILELAES 120

Query: 121  SKLRIDPEKRCVFLFNTDMLAILPLTGHEDEDDDNQDHSHQAKKQKVGNDASRSLTGQSL 180
            SKLRIDPEKRCVFLFNTDMLAILPLTGHEDEDDDNQDHSHQAKKQKVGNDASRSLTGQSL
Sbjct: 121  SKLRIDPEKRCVFLFNTDMLAILPLTGHEDEDDDNQDHSHQAKKQKVGNDASRSLTGQSL 180

Query: 181  VMRVSELHEDIKNVVDIQFLNSFNNPTLAILYQPRLAWTGNEKVVSKTPMKFMALTLQDN 240
            VMRVSELHEDIKNVVDIQFLNSFNNPTLAILYQPRLAWTGNEKVVSKTPMKFMALTLQDN
Sbjct: 181  VMRVSELHEDIKNVVDIQFLNSFNNPTLAILYQPRLAWTGNEKVVSKTPMKFMALTLQDN 240

Query: 241  KSTTIYHMKGIPHDVHSIIPLTNSCVLVGVNEIMSVDNTGALQSTIQLNSFASKLPGSKQ 300
            KSTTIYHMKGIPHDVHSIIPLTNSCVLVGVNEIMSVDNTGALQSTIQLNSFASKLPGSKQ
Sbjct: 241  KSTTIYHMKGIPHDVHSIIPLTNSCVLVGVNEIMSVDNTGALQSTIQLNSFASKLPGSKQ 300

Query: 301  IDKSSLQVMFNEPVVWTSAMVSKDKEILIIMDHRADLYSVISQSEGRLLLDFTLVKLPIA 360
            IDKSSLQVMFNEPVVWTSAMVSKDKEILIIMDHRADLYSVISQSEGRLLLDFTLVKLPIA
Sbjct: 301  IDKSSLQVMFNEPVVWTSAMVSKDKEILIIMDHRADLYSVISQSEGRLLLDFTLVKLPIA 360

Query: 361  SDIFKAHYLPTCILPLSGGIQMKMCQFFIGFSSGNALMVKFNNLRSAFESNEIQAIELPH 420
            SDIFKAHYLPTCILPLSGGIQMKMCQFFIGFSSGNALMVKFNNLRSAFESNEIQAIELPH
Sbjct: 361  SDIFKAHYLPTCILPLSGGIQMKMCQFFIGFSSGNALMVKFNNLRSAFESNEIQAIELPH 420

Query: 421  XXXXXXXXXXXXXXXXXRPAVENMTTVEASIPFSIDLMDFLINVGPITSLAVGKVSSANP 480
                             RPAVENMTTVEASIPFSIDLMDFLINVGPITSLAVGKVSSANP
Sbjct: 421  DEDEDYDALYGDDDDLARPAVENMTTVEASIPFSIDLMDFLINVGPITSLAVGKVSSANP 480

Query: 481  NIEGLPNPNRNEIALVSSSGHGIGAYINVMEPSVPPLVQQALKFTSVTKIWALKIRKKDK 540
            NIEGLPNPNRNEIALVSSSGHGIGAYINVMEPSVPPLVQQALKFTSVTKIWALKIRKKDK
Sbjct: 481  NIEGLPNPNRNEIALVSSSGHGIGAYINVMEPSVPPLVQQALKFTSVTKIWALKIRKKDK 540

Query: 541  YLITTDSGAEKSDVFEIGQKITSIKPKHFKKNVSTVEIAKVGGGKRIVQVTTKAVYLFNL 600
            YLITTDSGAEKSDVFEIGQKITSIKPKHFKKNVSTVEIAKVGGGKRIVQVTTKAVYLFNL
Sbjct: 541  YLITTDSGAEKSDVFEIGQKITSIKPKHFKKNVSTVEIAKVGGGKRIVQVTTKAVYLFNL 600

Query: 601  GFKKLMTISFDFEVVHVSIFDPFILLTNSKGEIKIYELEPKHRNKLNKVPLPEVLEEMII 660
            GFKKLMTISFDFEVVHVSIFDPFILLTNSKGEIKIYELEPKHRNKLNKVPLPEVLEEMII
Sbjct: 601  GFKKLMTISFDFEVVHVSIFDPFILLTNSKGEIKIYELEPKHRNKLNKVPLPEVLEEMII 660

Query: 661  TSGVILKSSICNQYMSGLEDPDKDQLLFTFVAADNQIILFPKEHHDRVFQLNGVDILNDM 720
            TSGVILKSSICNQYMSGLEDPDKDQLLFTFVAADNQIILFPKEHHDRVFQLNGVDILNDM
Sbjct: 661  TSGVILKSSICNQYMSGLEDPDKDQLLFTFVAADNQIILFPKEHHDRVFQLNGVDILNDM 720

Query: 721  LFVSTYQLPEQIIPDPSIKQVMINNLGKNNKEEYLTVLTFGGEIYMYKKIGNKFFKSMRC 780
            LFVSTYQLPEQIIPDPSIKQVMINNLGKNNKEEYLTVLTFGGEIYMYKKIGNKFFKSMRC
Sbjct: 721  LFVSTYQLPEQIIPDPSIKQVMINNLGKNNKEEYLTVLTFGGEIYMYKKIGNKFFKSMRC 780

Query: 781  NEFQITGAPGNAYAKGVSSIERIAHYVKYFNGYSIILVTGSVPYMIIKEDFSTPKIFKFG 840
            NEFQITGAPGNAYAKGVSSIERIAHYVKYFNGYSIILVTGSVPYMIIKEDFSTPKIFKFG
Sbjct: 781  NEFQITGAPGNAYAKGVSSIERIAHYVKYFNGYSIILVTGSVPYMIIKEDFSTPKIFKFG 840

Query: 841  NIPLVSLTPWGADSVLCVDDIKNARIVTLNNEFSYGNRLPVRRIKIGDATNEFQSITGVA 900
            NIPLVSLTPWGADSVLCVDDIKNARIVTLNNEFSYGNRLPVRRIKIGDATNEFQSITGVA
Sbjct: 841  NIPLVSLTPWGADSVLCVDDIKNARIVTLNNEFSYGNRLPVRRIKIGDATNEFQSITGVA 900

Query: 901  FHERTGMYIASYTKXXXXXXXXXXXXKLIGCDDSVPHAKGYQSGIILLNPKTWNIIDLAD 960
            FHERTGMYIASYTK            KLIGCDDSVPHAKGYQSGIILLNPKTWNIIDLAD
Sbjct: 901  FHERTGMYIASYTKEIEYEAISEEGEKLIGCDDSVPHAKGYQSGIILLNPKTWNIIDLAD 960

Query: 961  YGKNSLINDMKTMLIQTNSRMKRKREYLVVGNTFVRDEDIGTMGSFYLYDITEVVPEPGK 1020
            YGKNSLINDMKTMLIQTNSRMKRKREYLVVGNTFVRDEDIGTMGSFYLYDITEVVPEPGK
Sbjct: 961  YGKNSLINDMKTMLIQTNSRMKRKREYLVVGNTFVRDEDIGTMGSFYLYDITEVVPEPGK 1020

Query: 1021 PDTNYKLKQIFHEEFRGAVSSVCEVSGRFLISQSQKVLVRDVQEDNSVVPVAFLDIPVFV 1080
            PDTNYKLKQIFHEEFRGAVSSVCEVSGRFLISQSQKVLVRDVQEDNSVVPVAFLDIPVFV
Sbjct: 1021 PDTNYKLKQIFHEEFRGAVSSVCEVSGRFLISQSQKVLVRDVQEDNSVVPVAFLDIPVFV 1080

Query: 1081 TDSKSCGNLLIIGDAMQGFQFVGFDAEPYRMIPLGRSVSKFEVMSLEFLMNNGNIYFLVS 1140
            TDSKSCGNLLIIGDAMQGFQFVGFDAEPYRMIPLGRSVSKFEVMSLEFLMNNGNIYFLVS
Sbjct: 1081 TDSKSCGNLLIIGDAMQGFQFVGFDAEPYRMIPLGRSVSKFEVMSLEFLMNNGNIYFLVS 1140

Query: 1141 DRSNILHVLKYAPDEPNSLSGQKLVHCTSFNLHSTNTCMKLLLKNSEFKAANDLPAFQAI 1200
            DRSNILHVLKYAPDEPNSLSGQKLVHCTSFNLHSTNTCMKLLLKNSEFKAANDLPAFQAI
Sbjct: 1141 DRSNILHVLKYAPDEPNSLSGQKLVHCTSFNLHSTNTCMKLLLKNSEFKAANDLPAFQAI 1200

Query: 1201 GAQTDGSIFKVVPLSENTYRRLYMVEQQLIEKDIQLCGLNPKMERLQNDFYQLGHSLRPM 1260
            GAQTDGSIFKVVPLSENTYRRLYMVEQQLIEKDIQLCGLNPKMERLQNDFYQLGHSLRPM
Sbjct: 1201 GAQTDGSIFKVVPLSENTYRRLYMVEQQLIEKDIQLCGLNPKMERLQNDFYQLGHSLRPM 1260

Query: 1261 LDFTVIKNYGALASNKRKQVAAKAGRQA 1288
            LDFTVIKNYGALASNKRKQVAAKAGRQA
Sbjct: 1261 LDFTVIKNYGALASNKRKQVAAKAGRQA 1288

>AAL060W [127] [Homologous to ScYDR301W (CFT1) - SH]
            complement(241008..244925) [3918 bp, 1305 aa]
          Length = 1305

 Score = 1460 bits (3779), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 713/1300 (54%), Positives = 957/1300 (73%), Gaps = 29/1300 (2%)

Query: 1    MNVYDEIFDATTVSHALLGHFTSEKYDQLIAARTNVLSVYKTDHE-KLVLLHEYKLHGRI 59
            MNV+DE+ +AT V++++ GHFT+   ++LI  RTN+LSV   D+E +LVL +E+KL GR+
Sbjct: 1    MNVFDEVINATVVNNSVTGHFTTTLREELIITRTNLLSVLHKDNEGRLVLAYEWKLSGRV 60

Query: 60   TGMVLVPQLRSPLDCLMISTGKAKLSLVRFDPNMPIWLETISLHYYEAQFSEKSILELAE 119
             G+ LVP  +S L  L + TG+ ++S+VRFD      LET SLHYY+A+F E S L +  
Sbjct: 61   HGLSLVPH-KSGLGRLAVLTGRGRVSIVRFDAENQT-LETESLHYYDAKFEELSALTVGA 118

Query: 120  SSKLRIDPEKRCVFLFNTDMLAILPLTGHEDEDDDNQDHS-HQAKKQKVGNDASRSLTGQ 178
            + +L  +P  RC+ + N D LA+LPL GHE+E ++ ++   H AK+ +   DA   L G 
Sbjct: 119  APRLEQEPAARCLLVHNGDCLAVLPLRGHEEEGEEAEEEEEHPAKRART--DADGRLVGA 176

Query: 179  SLVMRVSELHEDIKNVVDIQFLNSFNNPTLAILYQPRLAWTGNEKVVSKTPMKF--MALT 236
            S VM  S LH DIKNV D++FL   N   + +LYQP+L+W GNEK+  +T MKF  ++L 
Sbjct: 177  STVMPASHLHSDIKNVKDMRFLRGLNKSAVGVLYQPQLSWCGNEKLTRQT-MKFIILSLD 235

Query: 237  LQDNKSTTIYHMKGIPHDVHSIIPLTNSCVLVGVNEIMSVDNTGALQSTIQLNSFASKLP 296
            L D KST I  ++G+P+ +H+IIPL+N CVL GVNE++ VDNTGALQ  I LN+F++   
Sbjct: 236  LDDEKSTVINMLQGLPNTLHTIIPLSNGCVLAGVNELLYVDNTGALQGAISLNAFSNSGL 295

Query: 297  GSKQIDKSSLQVMFNEPVVWTSAMVSKDKEILIIMDHRADLYSVISQSEGRLLLDFTLVK 356
             ++  D S LQ  F +P+ +  A  S  ++IL++MD +A +Y+VI ++EGRLL  F  V+
Sbjct: 296  NTRIQDNSKLQAFFEQPLCYF-ATQSNGRDILLLMDEKARMYNVIIEAEGRLLTTFNCVQ 354

Query: 357  LPIASDIFKAHYLPTCILPLSGGIQMKMCQFFIGFSSGNALMVKFNNLRSAFESNEIQAI 416
            LPI ++IFK + +PT I    G + ++    FIGF SG+A+ V+ NNL+S+ E     + 
Sbjct: 355  LPIVNEIFKRNMMPTSI---CGNMNLETGSLFIGFQSGDAMHVRLNNLKSSLEHKGTVSE 411

Query: 417  ELPHXXXXXXXXXXXXXXXXXRPAVENMTTVEASIPFSIDLMDFLINVGPITSLAVGKVS 476
             L                     A +    +E   PF I+ +D L+N+GP+TSLAVGK S
Sbjct: 412  TLE--------TDEDYMELYGNNAEKEKKNLETESPFDIECLDRLLNIGPVTSLAVGKAS 463

Query: 477  SANPNIEGLPNPNRNEIALVSSSGHGIGAYINVMEPSVPPLVQQALKFTSVTKIWALKIR 536
            S    +  L NPN++E+++V++SG+G G+++ ++E ++ P VQQALKF SVT+IW LKI+
Sbjct: 464  SIEHTVAKLANPNKDELSIVATSGNGTGSHLTILENTIVPTVQQALKFISVTQIWNLKIK 523

Query: 537  KKDKYLITTDSGAEKSDVFEIGQKITSIKPKHFKKNVSTVEIAKVGGGKRIVQVTTKAVY 596
             KDKYL+TTDS   +SD++ I +     K   F+KN +TV  A  GGGKRIVQVT+K V+
Sbjct: 524  GKDKYLVTTDSSQTRSDIYSIDRDFKPFKAADFRKNDTTVSTAVTGGGKRIVQVTSKGVH 583

Query: 597  LFNLGFKKLMTISFDFEVVHVSIFDPFILLTNSKGEIKIYELEPKHRNKLNKVPLPEVLE 656
            LF++ FK++MT++FDFEVVHV I DPF+LLTNSKG+IKIYELEPKH+ K  K  LP+ L+
Sbjct: 584  LFDINFKRMMTMNFDFEVVHVCIKDPFLLLTNSKGDIKIYELEPKHKKKFVKTVLPDALK 643

Query: 657  EMIITSGVILKSSICNQYMSGLEDPDKDQLLFTFVAADNQIILFPKEHHDRVFQLNGVDI 716
            E+IIT GVIL+S++CN+Y++GLE  ++ QLLFTFV ADNQI+ F K+H+DR+FQLNG+D 
Sbjct: 644  EIIITFGVILESNMCNKYINGLEKSEEPQLLFTFVTADNQIVFFTKDHNDRIFQLNGIDD 703

Query: 717  LNDMLFVSTYQLPEQIIPDPSIKQVMINNLGKNNKEEYLTVLTFGGEIYMYKKIGNKFFK 776
                LF+STYQLPE I PDPSIKQV+I+ LG  +K+EYLT+LTFGGE+Y+Y+K  +   +
Sbjct: 704  FRQKLFISTYQLPEDINPDPSIKQVIISRLGHKHKQEYLTILTFGGEVYLYRKCIDNPDR 763

Query: 777  SMRCN-EFQITGAPGNAYAKGVSSIERIAHYVKYFNGYSIILVTGSVPYMIIKEDFSTPK 835
             ++C+ E  ITGAP NAY KGV  +ER+AHY++ +NGYS+I +TG+VPY+IIKED S P+
Sbjct: 764  FIKCDHELLITGAPENAYPKGVQGVERVAHYIEDYNGYSVIFITGTVPYIIIKEDNSVPR 823

Query: 836  IFKFGNIPLVSLTPWGADSVLCVDDIKNARIVTLN--NEFSYGNRLPVRRIKIGDATNEF 893
            IF F NI LVS+T WG +SV+CVDD+KNARI+TLN   +  YGN++ + +I + D   +F
Sbjct: 824  IFPFANITLVSMTRWGENSVMCVDDVKNARIMTLNLDRDRYYGNKMSLAKIYLEDPLEDF 883

Query: 894  QSITGVAFHERTGMYIASYTKXXXXXXXXXXXXKLIGCDDSVPHAKGYQSGIILLNPKTW 953
            Q++  + +HERT  +I SY K             L+G +    HA G+QSGIILL+PK+W
Sbjct: 884  QTLNNITYHERTQTFIVSYAKSIDYVALSEEDEPLVGYNPDKIHAMGFQSGIILLSPKSW 943

Query: 954  NIIDLADYGKNSLINDMKTMLIQTNSRMKRKREYLVVGNTFVRDEDIGTMGSFYLYDITE 1013
             IID  +YGKNSLINDM+TM+IQ NS  KR+REYLVVGNT+VRDEDIG  GSFYLYDITE
Sbjct: 944  EIIDKIEYGKNSLINDMRTMMIQLNSNTKRRREYLVVGNTYVRDEDIGGTGSFYLYDITE 1003

Query: 1014 VVPEPGKPDTNYKLKQIFHEEFRGAVSSVCEVSGRFLISQSQKVLVRDVQEDNSVVPVAF 1073
            VVPEPGKPDTNYK K IF E+ RG VS+VCE+SGRF+ISQS K +VRD+QEDNSVVPVAF
Sbjct: 1004 VVPEPGKPDTNYKFKDIFQEDIRGTVSTVCEISGRFMISQSSKAMVRDIQEDNSVVPVAF 1063

Query: 1074 LDIPVFVTDSKSCGNLLIIGDAMQGFQFVGFDAEPYRMIPLGRSVSKFEVMSLEFLMNNG 1133
            LD+PVF+TD+KS GNL+IIGD+MQGF F+GFDAEPYRM+ LG+SVSK E M +EFL+NNG
Sbjct: 1064 LDMPVFITDAKSFGNLMIIGDSMQGFSFLGFDAEPYRMLTLGKSVSKLETMCVEFLVNNG 1123

Query: 1134 NIYFLVSDRSNILHVLKYAPDEPNSLSGQKLVHCTSFNLHSTNTCMKLLLKNSEFKAAND 1193
            ++YFLV+DR+N++HVLKYAPDEPNSLSGQ+LVHCTSFNLHSTNTCM+L+ KN EF   + 
Sbjct: 1124 DVYFLVTDRNNLMHVLKYAPDEPNSLSGQRLVHCTSFNLHSTNTCMRLIKKNDEFGKVSR 1183

Query: 1194 -----LPAFQAIGAQTDGSIFKVVPLSENTYRRLYMVEQQLIEKDIQLCGLNPKMERLQN 1248
                 +P+FQ IG+Q DG+IFKVVPLSE +YR LY+++QQLI+K++QLCGLNP+MERL+N
Sbjct: 1184 GFGIYMPSFQCIGSQADGTIFKVVPLSEASYRSLYLIQQQLIDKEVQLCGLNPRMERLEN 1243

Query: 1249 DFYQLGHSLRPMLDFTVIKNYGALASNKRKQVAAKAGRQA 1288
             FYQ+GH LRPMLDFTV+K +  L+   R  +A+KAGRQA
Sbjct: 1244 PFYQMGHILRPMLDFTVLKRFATLSIPTRMTMASKAGRQA 1283

>YDR301W (CFT1) [1129] chr4 (1063344..1067417) Component of pre-mRNA
            cleavage factor II [4074 bp, 1357 aa]
          Length = 1357

 Score = 1425 bits (3690), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 708/1338 (52%), Positives = 962/1338 (71%), Gaps = 53/1338 (3%)

Query: 1    MNVYDEIFDATTVSHALLGHFTSEKYDQLIAARTNVLSVYK-TDHEKLVLLHEYKLHGRI 59
            MNVYD++ DAT VSH+L  HFT+  Y++L+  RTN+LSVY+ T   KL L  E+K HG I
Sbjct: 1    MNVYDDVLDATVVSHSLATHFTTSDYEELLVVRTNILSVYRPTRDGKLYLTDEFKFHGLI 60

Query: 60   TGMVLVPQLRSPLDCLMISTGKAKLSLVRFDPNMPIWLETISLHYYEAQFSEKSILELAE 119
            T + L+PQ  SPL CL++ TG AK+S+++F+  +   ++T+SLHYYE +F  KS++ELA+
Sbjct: 61   TDIGLIPQKDSPLSCLLLCTGVAKISILKFN-TLTNSIDTLSLHYYEGKFKGKSLVELAK 119

Query: 120  SSKLRIDPEKRCVFLFNTDMLAILPLTGHEDEDDDNQD------------HSHQAKKQKV 167
             S LR+DP   C  LFN D++A LP   ++++DD+ ++            HS   K Q  
Sbjct: 120  ISTLRMDPGSSCALLFNNDIIAFLPFHVNKNDDDEEEEDEDENIDDSELIHSMNQKSQGT 179

Query: 168  G--NDASRS-----LTGQSLVMRVSELHEDIKNVVDIQFLNSFNNPTLAILYQPRLAWTG 220
               N   R+      T  S+V+  SEL+E  KN++DIQFL +F  PT+A+LYQP+L W G
Sbjct: 180  NTFNKRKRTKLGDKFTAPSVVLVASELYEGAKNIIDIQFLKNFTKPTIALLYQPKLVWAG 239

Query: 221  NEKVVSKTPMKFMALTLQDN--------KSTTIYHMKGIPHDVHSIIPLTNSCVLVGVNE 272
            N   +SK P +++ LTL           +STTI  +K +P D+H+I+P++N  ++VG NE
Sbjct: 240  N-TTISKLPTQYVILTLNIQPAESATKIESTTIAFVKELPWDLHTIVPVSNGAIIVGTNE 298

Query: 273  IMSVDNTGALQSTIQLNSFASK-LPGSKQIDKSSLQVMFNEP---VVWTSAMVSKD---- 324
            +  +DNTG LQST+ LNSFA K L  +K I+ SSL++MF E     +W  +  SK+    
Sbjct: 299  LAFLDNTGVLQSTVLLNSFADKELQKTKIINNSSLEIMFREKNTTSIWIPSSKSKNGGSN 358

Query: 325  -KEILIIMDHRADLYSVISQSEGRLLLDFTLVKLPIASDIFKAHYLPTCILPLSGGIQMK 383
              E L++MD ++++Y +  ++EGRLL+ F + KLPI +D+ K +  P CI  L+     K
Sbjct: 359  NDETLLLMDLKSNIYYIQMEAEGRLLIKFDIFKLPIVNDLLKENSNPKCITRLNATNSNK 418

Query: 384  MCQFFIGFSSGNALMVKFNNLRSAFESNEIQ--AIELPHXXXXXXXXXXXXXXXXXRPAV 441
                FIGF SGNAL+++ NNL+S  E+ E    +                        A 
Sbjct: 419  NMDLFIGFGSGNALVLRLNNLKSTIETREAHNPSSGTNSLMDINDDDDEEMDDLYADEAP 478

Query: 442  EN-------MTTVEASIPFSIDLMDFLINVGPITSLAVGKVSSANPNIEGLPNPNRNEIA 494
            EN         TVE   PF I+L+  L NVGPITSL VGKVSS +  ++GLPNPN+NE +
Sbjct: 479  ENGLTTNDSKGTVETVQPFDIELLSSLRNVGPITSLTVGKVSSIDDVVKGLPNPNKNEYS 538

Query: 495  LVSSSGHGIGAYINVMEPSVPPLVQQALKFTSVTKIWALKIRKKDKYLITTDSGAEKSDV 554
            LV++SG+G G+++ V++ SV P ++ ALKF S+T+IW LKI+ +D+YLITTDS   +SD+
Sbjct: 539  LVATSGNGSGSHLTVIQTSVQPEIELALKFISITQIWNLKIKGRDRYLITTDSTKSRSDI 598

Query: 555  FEIGQKITSIKPKHFKKNVSTVEIAKVGGGKRIVQVTTKAVYLFNLGFKKLMTISFDFEV 614
            +E        K    +++ +TV I+  G  KRI+QVTT  +YL++  F++L TI FD+EV
Sbjct: 599  YESDNNFKLHKGGRLRRDATTVYISMFGEEKRIIQVTTNHLYLYDTHFRRLTTIKFDYEV 658

Query: 615  VHVSIFDPFILLTNSKGEIKIYELEPKHRNKLNKVPLPEVLEEMIITSGVILKSSICNQY 674
            +HVS+ DP+IL+T S+G+IKI+ELE K++ KL KV LPE+L EM+ITSG+ILKS++CN++
Sbjct: 659  IHVSVMDPYILVTVSRGDIKIFELEEKNKRKLLKVDLPEILNEMVITSGLILKSNMCNEF 718

Query: 675  MSGLEDPDKDQLLFTFVAADNQIILFPKEHHDRVFQLNGVDILNDMLFVSTYQLPEQIIP 734
            + GL    ++QLLFTFV ADNQII F K+H+DR+FQLNGVD LN+ L++STYQL ++I+P
Sbjct: 719  LIGLSKSQEEQLLFTFVTADNQIIFFTKDHNDRIFQLNGVDQLNESLYISTYQLGDEIVP 778

Query: 735  DPSIKQVMINNLGKNNKEEYLTVLTFGGEIYMYKKI---GNKFFKSMRCNEFQITGAPGN 791
            DPSIKQVMIN LG +NKEEYLT+LTFGGEIY Y+K+    ++F++++  N+  ITGAP N
Sbjct: 779  DPSIKQVMINKLGHDNKEEYLTILTFGGEIYQYRKLPQRRSRFYRNVTRNDLAITGAPDN 838

Query: 792  AYAKGVSSIERIAHYVKYFNGYSIILVTGSVPYMIIKEDFSTPKIFKFGNIPLVSLTPWG 851
            AYAKGVSSIERI HY   +NGYS+I VTGSVPY++IKED STPKIFKFGNIPLVS+TPW 
Sbjct: 839  AYAKGVSSIERIMHYFPDYNGYSVIFVTGSVPYILIKEDDSTPKIFKFGNIPLVSVTPWS 898

Query: 852  ADSVLCVDDIKNARIVTLNNE-FSYGNRLPVRRIKIGDATNEFQSITGVAFHERTGMYIA 910
              SV+CVDDIKNAR+ TL  +   YGN+LP+++IKI +  ++++++  + +HER  +++ 
Sbjct: 899  ERSVMCVDDIKNARVYTLTTDNMYYGNKLPLKQIKISNVLDDYKTLQKLVYHERAQLFLV 958

Query: 911  SYTKXXXXXXXXXXXXKLIGCDDSVPHAKGYQSGIILLNPKTWNIIDLADYGKNSLINDM 970
            SY K            K+IG D++VPHA+G+QSGI+L+NPK+W +ID  D+ KNS++N+M
Sbjct: 959  SYCKRVPYEALGEDGEKVIGYDENVPHAEGFQSGILLINPKSWKVIDKIDFPKNSVVNEM 1018

Query: 971  KTMLIQTNSRMKRKREYLVVGNTFVRDEDIGTMGSFYLYDITEVVPEPGKPDTNYKLKQI 1030
            ++ +IQ NS+ KRKREY++ G      ED    G+F++YD+ EVVPEPGKPDTNYKLK+I
Sbjct: 1019 RSSMIQINSKTKRKREYIIAGVANATTEDTPPTGAFHIYDVIEVVPEPGKPDTNYKLKEI 1078

Query: 1031 FHEEFRGAVSSVCEVSGRFLISQSQKVLVRDVQEDNSVVPVAFLDIPVFVTDSKSCGNLL 1090
            F EE  G VS+VCEVSGRF+ISQSQKVLVRD+QEDNSV+PVAFLDIPVFVTDSKS GNLL
Sbjct: 1079 FQEEVSGTVSTVCEVSGRFMISQSQKVLVRDIQEDNSVIPVAFLDIPVFVTDSKSFGNLL 1138

Query: 1091 IIGDAMQGFQFVGFDAEPYRMIPLGRSVSKFEVMSLEFLMNNGNIYFLVSDRSNILHVLK 1150
            IIGDAMQGFQF+GFDAEPYRMI LGRS+SKF+ MSLEFL+N G++YF  +D    +HVLK
Sbjct: 1139 IIGDAMQGFQFIGFDAEPYRMISLGRSMSKFQTMSLEFLVNGGDMYFAATDADRNVHVLK 1198

Query: 1151 YAPDEPNSLSGQKLVHCTSFNLHSTNTCMKLLLKNSEFKAANDLPAFQAIGAQTDGSIFK 1210
            YAPDEPNSLSGQ+LVHC+SF LHSTN+CM LL +N EF  +  +P+FQ +G Q DGS+FK
Sbjct: 1199 YAPDEPNSLSGQRLVHCSSFTLHSTNSCMMLLPRNEEF-GSPQVPSFQNVGGQVDGSVFK 1257

Query: 1211 VVPLSENTYRRLYMVEQQLIEKDIQLCGLNPKMERLQNDFYQLGHSLRPMLDFTVIKNYG 1270
            +VPLSE  YRRLY+++QQ+I++++QL GLNP+MERL NDFYQ+GHS+RPMLDF VI+ + 
Sbjct: 1258 IVPLSEEKYRRLYVIQQQIIDRELQLGGLNPRMERLANDFYQMGHSMRPMLDFNVIRRFC 1317

Query: 1271 ALASNKRKQVAAKAGRQA 1288
             LA ++RK +A KAGR A
Sbjct: 1318 GLAIDRRKSIAQKAGRHA 1335

>Scas_588.13
          Length = 1340

 Score = 1405 bits (3636), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 689/1320 (52%), Positives = 952/1320 (72%), Gaps = 34/1320 (2%)

Query: 1    MNVYDEIFDATTVSHALLGHFTSEKYDQLIAARTNVLSVYKT-DHEKLVLLHEYKLHGRI 59
            MN+Y+++  AT VSH++ GHFTS    +LI  RTN++SVY T D  KL L+ E+ L+ +I
Sbjct: 1    MNIYEDVLTATVVSHSITGHFTSTSQRELIIVRTNIISVYNTTDDGKLNLVEEFNLNAKI 60

Query: 60   TGMVLVPQLRSPLDCLMISTGKAKLSLVRFDPNMPIWLETISLHYYEAQFSEKSILELAE 119
            T + L+PQ +SPL CL+I++G AK+S+VRFD  +   LET+SLHYYE + S+ S++ LA+
Sbjct: 61   TDIALIPQEKSPLSCLVIASGVAKISIVRFDA-VTNSLETLSLHYYEDKLSDISLVTLAK 119

Query: 120  SSKLRIDPEKRCVFLFNTDMLAILPL--TGHEDEDDDNQDHSHQAKKQKVGNDASRS--- 174
            +SKLR+DP  R + LFN D +A+LPL    HEDED+D+++  +   + +V    S+    
Sbjct: 120  TSKLRVDPMNRALLLFNNDSIALLPLFSGNHEDEDEDDEEDDYDVTRGEVTTKRSKKNEK 179

Query: 175  LTGQSLVMRVSELHEDIKNVVDIQFLNSFNNPTLAILYQPRLAWTGNEKVVSKTPMKFM- 233
              GQS +  V ELH++++NV+DIQFLN F  PTLA+LYQP+L W GN ++ +  P  FM 
Sbjct: 180  HVGQSKIFHVKELHQELQNVLDIQFLNDFTKPTLAVLYQPKLTWVGNTEL-NPQPTSFMI 238

Query: 234  -ALTLQDNKSTTIYH------MKGIPHDVHSIIPLTNSCVLVGVNEIMSVDNTGALQSTI 286
              L L+ N+  T +       +  +  D   ++P++  CV++G NE+  +DNTG LQS I
Sbjct: 239  FTLNLRTNELETAFDVVIIATLHDLSWDWFQLLPISRGCVVMGNNEMAYIDNTGVLQSII 298

Query: 287  QLNSFASK-LPGSKQIDKSSLQVMFNEPVV--WTSAMVSK--DKEILIIMDHRADLYSVI 341
             LNSFA K L  ++ ID++ L+V FNE V   W+++   K  D E L+I+D  A+LY V 
Sbjct: 299  HLNSFADKSLQRARIIDETELEVFFNEKVTYFWSASTDKKNIDDETLLIIDASANLYYVR 358

Query: 342  SQSEGRLLLDFTLVKLPIASDIFKAHYLPTCILPLSGGIQMKMCQFFIGFSSGNALMVKF 401
             ++EGRLL  F L+KLPI +D  K    PTC+  +           FIG+ SG++L+V+ 
Sbjct: 359  LEAEGRLLTKFDLIKLPIVNDALKDTSNPTCVARVDPNSSNSSMDLFIGYLSGDSLVVRL 418

Query: 402  NNLRSAFESNE--------IQAIELPHXXXXXXXXXXXXXXXXXRPAVENMTTVEASIPF 453
            NNL+SA E+ E            +                        +N   ++   PF
Sbjct: 419  NNLKSAIETREEHKESKQIFTGYDDDDDDEDNLYSDDESKEKIDEELPDNKQLIQTVQPF 478

Query: 454  SIDLMDFLINVGPITSLAVGKVSSANPNIEGLPNPNRNEIALVSSSGHGIGAYINVMEPS 513
             I+ +  L N+GPITSL  GKV+S +PN++GL NPN NE ++V++SG G G+++  ++PS
Sbjct: 479  DIEQLTSLRNIGPITSLVAGKVTSVDPNVKGLQNPNSNEYSMVATSGSGTGSHLTAIQPS 538

Query: 514  VPPLVQQALKFTSVTKIWALKIRKKDKYLITTDSGAEKSDVFEIGQKITSIKPKHFKKNV 573
            V PLV+ ALKF SVT+IW LK++ KDKYL+TTDS   KSD++EI  K    K    +++ 
Sbjct: 539  VQPLVELALKFISVTQIWKLKMKNKDKYLVTTDSTKSKSDIYEIDNKFALHKEGRLRRDA 598

Query: 574  STVEIAKVGGGKRIVQVTTKAVYLFNLGFKKLMTISFDFEVVHVSIFDPFILLTNSKGEI 633
            +T+ I+  G G RIVQVTT  +YLF+  F++L  I FDFEVVHVS+ DP+IL+T  +G+I
Sbjct: 599  TTIHISMFGEGTRIVQVTTNHLYLFDTDFRRLTAIKFDFEVVHVSVMDPYILITVLRGDI 658

Query: 634  KIYELEPKHRNKLNKVPLPEVLEEMIITSGVILKSSICNQYMSGLEDPDKDQLLFTFVAA 693
            KIYEL+   + KL +V LPE+L+EM++TSGVILKS++CN+Y+ G ED +++QLLFTFV A
Sbjct: 659  KIYELDALQKRKLFRVDLPEILKEMVVTSGVILKSNMCNEYLHGHEDSEEEQLLFTFVTA 718

Query: 694  DNQIILFPKEHHDRVFQLNGVDILNDMLFVSTYQLPEQIIPDPSIKQVMINNLGKNNKEE 753
            DNQII F +EH+DR+FQL GVD L + LF+STYQLPE+++PDPSIKQVMIN LG NNKEE
Sbjct: 719  DNQIIFFLREHNDRIFQLCGVDQLKEGLFISTYQLPEEVVPDPSIKQVMINKLGHNNKEE 778

Query: 754  YLTVLTFGGEIYMYKKIGNK---FFKSMRCNEFQITGAPGNAYAKGVSSIERIAHYVKYF 810
            YLT+LTFGGEIY YKK   +   FFK+       ITGAP NAYAKGVSSIERI HY+  +
Sbjct: 779  YLTILTFGGEIYQYKKSRTRHSCFFKNTGSTGMCITGAPDNAYAKGVSSIERIMHYIPDY 838

Query: 811  NGYSIILVTGSVPYMIIKEDFSTPKIFKFGNIPLVSLTPWGADSVLCVDDIKNARIVTLN 870
            +GYS+I +TGSVPY+I++ED S+PKIF+F N+ +VSL  WG +SV+ VDDIKNAR+ +L+
Sbjct: 839  SGYSVIFLTGSVPYIIMREDDSSPKIFRFANLSIVSLAQWGKNSVMAVDDIKNARVYSLD 898

Query: 871  NEFSY-GNRLPVRRIKIGDATNEFQSITGVAFHERTGMYIASYTKXXXXXXXXXXXXKLI 929
            N+ SY GN LP+++IKI D+  +F ++T + +HE++ +++ SY K             ++
Sbjct: 899  NKDSYYGNSLPLKKIKISDSLEDFMTLTKITYHEKSQLFLVSYAKEREYEALGEDGEIIV 958

Query: 930  GCDDSVPHAKGYQSGIILLNPKTWNIIDLADYGKNSLINDMKTMLIQTNSRMKRKREYLV 989
            G +D VPHAK +QSGI+L+NP+TWN+ID  D+  NS+I+DM++MLIQ +S+ ++KREY+V
Sbjct: 959  GSNDQVPHAKSFQSGILLINPRTWNVIDRVDFEVNSIISDMRSMLIQLDSKSRKKREYIV 1018

Query: 990  VGNTFVRDEDIGTMGSFYLYDITEVVPEPGKPDTNYKLKQIFHEEFRGAVSSVCEVSGRF 1049
             G TF+  ED+ + G+F++YD+TEV+PEPGKPDTN+KLK+IF E+ RG+V+SVC++SGRF
Sbjct: 1019 AGITFIGTEDLPSTGAFHIYDLTEVIPEPGKPDTNFKLKEIFKEDIRGSVNSVCDISGRF 1078

Query: 1050 LISQSQKVLVRDVQEDNSVVPVAFLDIPVFVTDSKSCGNLLIIGDAMQGFQFVGFDAEPY 1109
            LI+QSQK++VRDVQEDNSVVPVAF D P+FV+D+KS GN LI+GD+MQGFQF+GFDAEPY
Sbjct: 1079 LINQSQKIMVRDVQEDNSVVPVAFYDTPIFVSDAKSFGNFLILGDSMQGFQFLGFDAEPY 1138

Query: 1110 RMIPLGRSVSKFEVMSLEFLMNNGNIYFLVSDRSNILHVLKYAPDEPNSLSGQKLVHCTS 1169
            RMIPLGRSVS FE +S+EFL+N G I F ++DR +ILHVLKYAPDEPN+LSGQKLVHC+S
Sbjct: 1139 RMIPLGRSVSSFETVSVEFLINAGEINFAITDREDILHVLKYAPDEPNTLSGQKLVHCSS 1198

Query: 1170 FNLHSTNTCMKLLLKNSEFKAANDL-PAFQAIGAQTDGSIFKVVPLSENTYRRLYMVEQQ 1228
            FNL+S+NTCM +L +N EF+ ++   P FQAIG Q DG IFK++PL E+TYRRLY+V+QQ
Sbjct: 1199 FNLYSSNTCMLMLPRNDEFETSDKAPPKFQAIGGQVDGGIFKIIPLKEDTYRRLYVVQQQ 1258

Query: 1229 LIEKDIQLCGLNPKMERLQNDFYQLGHSLRPMLDFTVIKNYGALASNKRKQVAAKAGRQA 1288
            +I+K++QL GLNP+MERL NDFYQL H +RPM+DF +I+ +  L+  +R   A KAGR+A
Sbjct: 1259 IIDKEVQLGGLNPRMERLDNDFYQLTHVMRPMIDFNIIRRFSELSIERRTHFAQKAGRRA 1318

>CAGL0H01463g 142420..146505 similar to tr|Q06632 Saccharomyces
            cerevisiae YDR301w CFT1 pre-mRNA 3 -end processing factor
            CF II, start by similarity
          Length = 1361

 Score = 1303 bits (3373), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 661/1339 (49%), Positives = 912/1339 (68%), Gaps = 53/1339 (3%)

Query: 1    MNVYDEIFDATTVSHALLGHFTSEKYDQLIAARTNVLSVYKTDHE-KLVLLHEYKLHGRI 59
            MNVYD++ D T VSH++ GHFT+  Y +LI  RT+VLS+YK     +L L+ E+KL GRI
Sbjct: 1    MNVYDDVIDPTVVSHSVCGHFTTTDYLELIVIRTDVLSIYKPIRSGRLYLMEEHKLSGRI 60

Query: 60   TGMVLVPQLRSP-------LDCLMISTGKAKLSLVRFDPNMPIWLETISLHYYEAQFSEK 112
              + L+P+  +        L  L++STG AKLSL+ ++ NM   +ETISLH+YE +F   
Sbjct: 61   NDVALIPKHSNGSNGNGINLSYLLLSTGVAKLSLLMYN-NMTSSIETISLHFYEDKFESA 119

Query: 113  SILELAESSKLRIDPEKRCVFLFNTDMLAILPL-TG-HEDEDDD---------NQDHSHQ 161
            ++L+LA +S+LRI+P      LFN D+LAILP  TG +EDED+D         N +    
Sbjct: 120  TMLDLARNSQLRIEPNGNYAMLFNNDVLAILPFYTGINEDEDEDYINNDKSKINDNSKKS 179

Query: 162  AKKQKVGNDASRSLTGQSLVMRVSELHEDIKNVVDIQFLNSFNNPTLAILYQPRLAWTGN 221
              K+K G   +  +T  S+++  SEL   IKN+ DIQFL  F   T+ +LYQP+LAW GN
Sbjct: 180  LFKRKKGKTQNNKVTHPSIIINCSELGPQIKNIKDIQFLCGFTKSTIGVLYQPQLAWCGN 239

Query: 222  EKVVSKTPMKFMALTLQDNKS--------TTIYHMKGIPHDVHSIIPLTNSCVLVGVNEI 273
             ++V   P  +  ++L    S          I  +  +P D H+I P  +  +++GVNEI
Sbjct: 240  SQLVP-LPTNYAIISLDMKFSIDATTFDKAIISEISQLPSDWHTIAPTLSGSLILGVNEI 298

Query: 274  MSVDNTGALQSTIQLNSFASK-LPGSKQIDKSSLQVMFNEPVVWT---SAMVSKDKEILI 329
              +DNTG LQS + LNS++ K LP  + IDKSS +V FN    +    S    +  E ++
Sbjct: 299  AFLDNTGVLQSILTLNSYSDKVLPKVRVIDKSSHEVFFNTGSKFALIPSNENERSVENIL 358

Query: 330  IMDHRADLYSVISQSEGRLLLDFTLVKLPIASDIFKAHYLPTCILPLSGGIQMKMCQFFI 389
            + D    +++V  +SEGRLL  F + KLP+  D+      P+ +  +    ++     FI
Sbjct: 359  LFDENGCIFNVDLKSEGRLLTQFNITKLPLGEDVLSQKSNPSSVSIIWADGRLDTYTIFI 418

Query: 390  GFSSGNALMVKFNNLRSAFES----------NEIQAIELPHXXXXXXXXXXXXXXXXXRP 439
            GF SG+A M+K N+L SA E           N+  +    +                   
Sbjct: 419  GFQSGDATMLKLNHLHSAIEVEEPTFMKDYVNKQASAAYNNEDDDDDDDDFNLYSDEEND 478

Query: 440  AVEN-----MTTVEASIPFSIDLMDFLINVGPITSLAVGKVSSANPNIEGLPNPNRNEIA 494
             V N       T E++ PF+   +  L N+GPI S+ VGKVSS   N++GLPNPN+ EI+
Sbjct: 479  QVNNKNDRTFGTNESNEPFTAQELMELRNIGPINSMCVGKVSSIEDNVKGLPNPNKQEIS 538

Query: 495  LVSSSGHGIGAYINVMEPSVPPLVQQALKFTSVTKIWALKIRKKDKYLITTDSGAEKSDV 554
            +V +SG+G G+++N +  SV P V++ALKF S+TKIW L I+ KDK+LITTDS   +S++
Sbjct: 539  IVCTSGYGDGSHLNAILASVQPRVEKALKFISITKIWNLHIKGKDKFLITTDSTQSQSNI 598

Query: 555  FEIGQKITSIKPKHFKKNVSTVEIAKVGGGKRIVQVTTKAVYLFNLGFKKLMTISFDFEV 614
            +EI    +  K    +++ +T+ IA +G  KRIVQVTT  +YL++L F++  TI FD+EV
Sbjct: 599  YEIDNNFSQHKQGRLRRDATTIHIATIGDNKRIVQVTTNHLYLYDLTFRRFSTIKFDYEV 658

Query: 615  VHVSIFDPFILLTNSKGEIKIYELEPKHRNKLNKVPLPEVLEEMIITSGVILKSSICNQY 674
            VHVS+ DP++L+T S+G+IK++ELE +++ K  KVPLPE+L EM+ITSG+ILKS++CN++
Sbjct: 659  VHVSVMDPYVLITLSRGDIKVFELENRNKKKFVKVPLPEILTEMVITSGLILKSNMCNEF 718

Query: 675  MSGLEDPDKDQLLFTFVAADNQIILFPKEHHDRVFQLNGVDILNDMLFVSTYQLPEQIIP 734
            +SG+     +QLLFTFV ADNQII F K+H+DR+FQLNG+D L D L++STYQLP++IIP
Sbjct: 719  LSGIGKSTIEQLLFTFVTADNQIIFFTKDHNDRIFQLNGIDQLQDSLYISTYQLPDEIIP 778

Query: 735  DPSIKQVMINNLGKNNKEEYLTVLTFGGEIYMYKKI---GNKFFKSMRCNEFQITGAPGN 791
            DPSIKQ+MIN LG N+K+EYLT+LTFGGEIY YKK     ++F++++  N+  ITGAP N
Sbjct: 779  DPSIKQIMINKLGNNSKDEYLTILTFGGEIYQYKKSRSRHSRFYRNVGRNDHPITGAPDN 838

Query: 792  AYAKGVSSIERIAHYVKYFNGYSIILVTGSVPYMIIKEDFSTPKIFKFGNIPLVSLTPWG 851
            AY KGVS IERI HY+  F+GYS+I VTG+ PY+I+KED S P+IF FGNIP+VS++ WG
Sbjct: 839  AYPKGVSGIERIMHYIPNFDGYSVIFVTGNTPYIIMKEDDSLPRIFPFGNIPIVSMSRWG 898

Query: 852  ADSVLCVDDIKNARIVTLNNE-FSYGNRLPVRRIKIGDATNEFQSITGVAFHERTGMYIA 910
              SV+C+DDIKNARI +LN +   YGN+LP+R+IKIG     ++++  + +HERT +Y+ 
Sbjct: 899  EGSVICIDDIKNARIYSLNQDNIYYGNKLPIRKIKIGSMLQNYKTLNSIVYHERTQLYLV 958

Query: 911  SYTKXXXXXXXXXXXXKLIGCDDSVPHAKGYQSGIILLNPKTWNIIDLADYGKNSLINDM 970
            SYTK             LIG    +P+AK ++SG++L+NPK+W +ID  D   NSL+NDM
Sbjct: 959  SYTKEISYEAKAEDGSLLIGYKPELPNAKAFKSGVLLINPKSWEVIDELDLPDNSLVNDM 1018

Query: 971  KTMLIQTNSRMKRKREYLVVGNTFVRDEDIGTMGSFYLYDITEVVPEPGKPDTNYKLKQI 1030
            K+  IQ ++R KRKREY++VG  +   ED+   G F++YDITEVVPEPGKP+TN+KLK+I
Sbjct: 1019 KSSFIQIDTRTKRKREYIIVGIGYATMEDVPPTGEFHIYDITEVVPEPGKPNTNFKLKEI 1078

Query: 1031 FHEEFRGAVSSVCEVSGRFLISQSQKVLVRDVQEDNSVVPVAFLDIPVFVTDSKSCGNLL 1090
            F E+ RG VS V  +SGRFLISQSQK++VRDVQ+DNSV+PVAFLD+PVFVT  K+ GNL+
Sbjct: 1079 FKEDIRGIVSVVNGISGRFLISQSQKIMVRDVQQDNSVIPVAFLDVPVFVTSLKTFGNLI 1138

Query: 1091 IIGDAMQGFQFVGFDAEPYRMIPLGRSVSKFEVMSLEFLMNNGNIYFLVSDRSNILHVLK 1150
            +IGDAMQG QFVGFDAEPYRMI LG S++KFEV+S+EFL+NNG+IYFLV+DR +I+HVLK
Sbjct: 1139 VIGDAMQGIQFVGFDAEPYRMITLGSSITKFEVISVEFLVNNGDIYFLVTDRDSIMHVLK 1198

Query: 1151 YAPDEPNSLSGQKLVHCTSFNLHSTNTCMKLLLKNSEFKAANDLP-AFQAIGAQTDGSIF 1209
            YAPD+PN+LSGQ+LVHC+SFNLHS N C  LL KN EF        +FQ I AQ DGSI 
Sbjct: 1199 YAPDQPNTLSGQRLVHCSSFNLHSLNNCTMLLPKNDEFPRDQRYSRSFQTITAQVDGSIS 1258

Query: 1210 KVVPLSENTYRRLYMVEQQLIEKDIQLCGLNPKMERLQNDFYQLGHSLRPMLDFTVIKNY 1269
            K+VP+ E TYRRLY ++QQ+I+K+ QL GLNP+MER  N +Y LGHSLRPMLDF +IK +
Sbjct: 1259 KIVPVKEETYRRLYFIQQQIIDKEPQLAGLNPRMERQDNKYYHLGHSLRPMLDFNIIKRF 1318

Query: 1270 GALASNKRKQVAAKAGRQA 1288
              ++ N+R  +  K G+ +
Sbjct: 1319 KDMSMNRRSHIVQKLGKNS 1337

>KLLA0C10274g complement(879403..883305) similar to sgd|S0002709
            Saccharomyces cerevisiae YDR301w CFT1 pre-mRNA 3 -end
            processing factor CF II, start by similarity
          Length = 1300

 Score = 1295 bits (3351), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 641/1298 (49%), Positives = 908/1298 (69%), Gaps = 30/1298 (2%)

Query: 1    MNVYDEIFDATTVSHALLGHFTSEKYDQLIAARTNVLSVYKTDH-EKLVLLHEYKLHGRI 59
            MNV+DEI   T V+  L G+FTS + ++ + ARTNVLSV++    +KLVL +E+KL G+I
Sbjct: 1    MNVFDEILQPTVVNKCLHGNFTSAEREEYVVARTNVLSVFRVSRAQKLVLAYEWKLAGKI 60

Query: 60   TGMVLVPQLRSPLDCLMISTGKAKLSLVRFDPNMPIWLETISLHYYEAQFSEKSILELAE 119
              M L+PQ+ SPL  L I + K+K+SLVRFDP +   LET+SLHYY  +F   S   L  
Sbjct: 61   IDMQLLPQIGSPLKMLAILSSKSKVSLVRFDP-VAESLETLSLHYYHDKFVNLSTSSLKT 119

Query: 120  SSKLRIDPEKRCVFLFNTDMLAILPLT----GHEDEDDDNQDHSHQAKKQKVGNDASRSL 175
             S + +DP  RC+ +FN D+LAILPL       E ++D+N      AK+ K     ++ +
Sbjct: 120  ESIMAVDPLFRCLLVFNEDVLAILPLKLNTEDMEIDEDENGIKEPMAKRLK----RNQGI 175

Query: 176  TGQSLVMRVSELHEDIKNVVDIQFLNSFNNPTLAILYQPRLAWTGNEKVVSKTPMKFMAL 235
            T  S++M +S LH+ +K+V DI++LN+F+ PT+ ILYQP LAW GNEKV+  T M++M L
Sbjct: 176  TSDSIIMPISSLHKSLKHVYDIKWLNNFSKPTVGILYQPVLAWCGNEKVLGNT-MRYMVL 234

Query: 236  TL--QDNKSTTIYHMKGIPHDVHSIIPLTNSCVLVGVNEIMSVDNTGALQSTIQLNSFAS 293
            +L  +D K+T I  +  +P+D+H+++PL    VL+GVNE++ +  +GALQS I+LN+FA+
Sbjct: 235  SLDVEDEKTTVIAELADLPNDLHTLVPLKRGYVLIGVNELLYISASGALQSCIRLNTFAT 294

Query: 294  KLPGSKQIDKSSLQVMFNEPVVWTSAMVSKDKEILIIMDHRADLYSVISQSEGRLLLDFT 353
                ++  D S + +  ++  ++    + K  ++LI++D    +Y++I++SEG LL  F 
Sbjct: 295  SSINTRITDNSDMNIFLSKSSIYFYKAL-KRHDLLILIDENCRMYNIITESEGNLLTKFD 353

Query: 354  LVKLPIASDIFKAHYLPTCILPLSGGIQMKMCQFFIGFSSGNALMVKFNNLRSAFESNEI 413
             V++PI ++IFK   LP   L + G + ++  +  IGF SG+A+ ++  NL+ AF +   
Sbjct: 354  CVQVPIVNEIFKNSRLP---LSVCGDLNLETGRVLIGFLSGDAMFLQLKNLKVAFAAKR- 409

Query: 414  QAIELPHXXXXXXXXXXXXXXXXXRPAVENMTTVEASIPFSIDLMDFLINVGPITSLAVG 473
            Q +E                       +     VE   PF I L+D + N+GP+TSL +G
Sbjct: 410  QLVETVDDDDDEYSALYGESQNNTHTRI-----VETQEPFDISLLDSIFNIGPLTSLTIG 464

Query: 474  KVSSANPNIEGLPNPNRNEIALVSSSGHGIGAYINVMEPSVPPLVQQALKFTSVTKIWAL 533
            KV+S  P I+ LPNPN++E ++V++SG G G+++  +  +V P ++QALKFTS T+IW L
Sbjct: 465  KVASVEPTIQRLPNPNKDEFSIVATSGVGRGSHLTALHSTVQPHIEQALKFTSATRIWNL 524

Query: 534  KIRKKDKYLITTDSGAEKSDVFEIGQKITSIKPKHFKKNVSTVEIAKVGGGKRIVQVTTK 593
            KI+ KDKYL+TTD+  EKSDV++I +     + + F+K+  T+ +  +   KRI+QVT+ 
Sbjct: 525  KIKGKDKYLVTTDADKEKSDVYQIDRNFEPFRAQDFRKDSRTIGMETMDDDKRILQVTSG 584

Query: 594  AVYLFNLGFKKLMTISFDFEVVHVSIFDPFILLTNSKGEIKIYELEPKHRNKLNKVPLPE 653
             +YLF++ FK+L  ++ D E+VH  I DP+IL T+++G IKIY+L+ K++ K  K  LPE
Sbjct: 585  GLYLFDVDFKRLARLTIDIEIVHACIIDPYILFTDARGNIKIYQLDSKNKKKFIKFKLPE 644

Query: 654  VLEEMIITSGVILKSSICNQYMSGLEDPDKDQLLFTFVAADNQIILFPKEHHDRVFQLNG 713
             L E+IITSG I KS+ICN+++ GLE+  ++QLLFTFV  DNQ+I F ++H+DR+FQLNG
Sbjct: 645  ALNEIIITSGSIFKSNICNKFLHGLENSSQEQLLFTFVTGDNQVIFFTEKHNDRIFQLNG 704

Query: 714  VDILNDMLFVSTYQLPEQIIPDPSIKQVMINNLGKNNKEEYLTVLTFGGEIYMYKKIGNK 773
            VD L DMLF+STYQ+PE++ PDPSIKQ+M+N LG + KEE+LT+LTFGGEIY YKK    
Sbjct: 705  VDQLEDMLFISTYQIPEEMNPDPSIKQIMLNRLGHHKKEEFLTILTFGGEIYQYKKSTKH 764

Query: 774  FFKSMRCNEFQ-ITGAPGNAYAKGVSSIERIAHYVKYFNGYSIILVTGSVPYMIIKEDFS 832
              K ++C     ITGAP NAY +GV+ IER+AHY   +NGYS++ +TG VPY+IIKED S
Sbjct: 765  SGKLLKCKSHPLITGAPNNAYPQGVNKIERVAHYFPNYNGYSVVFITGQVPYIIIKEDNS 824

Query: 833  TPKIFKFGNIPLVSLTPWGADSVLCVDDIKNARIVTLNNEFSYGNRLPVRRIKIGDATNE 892
              +IF+  NIP+V++  WG +SV+CVD+IKNAR++ L+ E  YGN   +R+I I D   E
Sbjct: 825  VCRIFRMTNIPIVTMARWGKNSVMCVDNIKNARVMKLDPECYYGNTQILRKIIIEDVVEE 884

Query: 893  FQSITGVAFHERTGMYIASYTKXXXXXXXXXXXXKLIGCDDSVPHAKGYQSGIILLNPKT 952
            F+++  +A+HERTGMYI SYTK             L+G D S P++ GY+SG++L+NP T
Sbjct: 885  FETLGNIAYHERTGMYIISYTKFIEYQALSEDGEPLVGYDPSKPNSTGYKSGLLLINPLT 944

Query: 953  WNIIDLADYGKNSLINDMKTMLIQTNSRMKRKREYLVVGNTFVRDEDIGTMGSFYLYDIT 1012
            WNIID  D  +NS++ND+KTMLIQ NS+ +RKRE +++G++FV++ED  + G   + DIT
Sbjct: 945  WNIIDRLDLSENSMVNDIKTMLIQLNSKTRRKRELVIIGSSFVKEEDQPSTGCLLVLDIT 1004

Query: 1013 EVVPEPGKPDTNYKLKQIFHEEFRGAVSSVCEVSGRFLISQSQKVLVRDVQEDNSVVPVA 1072
            EVV EPGKPD+N+K KQ+F EE RG+V++VCE+SGRF+I QS K LVRD+QEDNS VPVA
Sbjct: 1005 EVVAEPGKPDSNFKFKQLFEEEIRGSVNAVCEISGRFMIGQSSKALVRDMQEDNSAVPVA 1064

Query: 1073 FLDIPVFVTDSKSCGNLLIIGDAMQGFQFVGFDAEPYRMIPLGRSVSKFEVMSLEFLMNN 1132
            FLD+PVF+TD+KS  NL+IIGD+MQGF FVGFDAEPYRMI LG+S SKF+VM+LEFL+NN
Sbjct: 1065 FLDMPVFITDAKSFSNLMIIGDSMQGFTFVGFDAEPYRMIVLGKSTSKFQVMNLEFLVNN 1124

Query: 1133 GNIYFLVSDRSNILHVLKYAPDEPNSLSGQKLVHCTSFNLHSTNTCMKLLLKNSEF--KA 1190
            GNI F+V+DR N LHVL+YAPDE NSLSGQ+LVHC SFN+ +TN  MKL+ K+ EF  K 
Sbjct: 1125 GNINFIVTDRQNHLHVLRYAPDEANSLSGQRLVHCNSFNMFTTNNYMKLVRKHVEFGSKT 1184

Query: 1191 ANDLPAFQAIGAQTDGSIFKVVPLSENTYRRLYMVEQQLIEKDIQLCGLNPKMERLQNDF 1250
            +N    + A+G QTDGSIF+++PL+E +YRR Y+V+QQL++ +I L G N KMERL N++
Sbjct: 1185 SN----YIALGCQTDGSIFRMIPLNEASYRRFYLVQQQLLDHEIPLAGFNTKMERLDNEY 1240

Query: 1251 YQLGHSLRPMLDFTVIKNYGALASNKRKQVAAKAGRQA 1288
            Y  GHSLRP LD  V+K Y  L   KR  +  + GR A
Sbjct: 1241 YHKGHSLRPTLDSQVLKKYIHLPITKRTTIENRVGRHA 1278

>Kwal_27.10039
          Length = 1284

 Score = 36.6 bits (83), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 57/142 (40%), Gaps = 22/142 (15%)

Query: 11  TTVSHALLGHFTSEKYDQLIAARTNVLSVYKTDHEKLVLLHEYKL------HGRITGMVL 64
           T   H+ +GHF   K  QL+  + N          +L L  E  +      +G    +V 
Sbjct: 19  TNYVHSCIGHFVDYKPHQLVTNQNNTKKRKSRRDYQLCLATETHVELYDVENGDFKRLVT 78

Query: 65  VPQLRS-------PLDC----LMISTGKAKLSLVRFDPNMPIWLETISLH-YYEAQFSEK 112
           VP   +       P+D     L++ T    LS+++F  +      +I LH      F+  
Sbjct: 79  VPIFATITAMQSLPVDSNYSYLVLLTDSGNLSILKFVYDSG----SIKLHSLLNEPFARS 134

Query: 113 SILELAESSKLRIDPEKRCVFL 134
            I  L+    L +DP  RC+FL
Sbjct: 135 GIRRLSPQKHLSVDPHGRCIFL 156

>AFR382W [3574] [Homologous to ScYML049C (RSE1) - SH]
           complement(1125158..1129024) [3867 bp, 1288 aa]
          Length = 1288

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 27/109 (24%), Positives = 49/109 (44%), Gaps = 9/109 (8%)

Query: 28  QLIAARTNVLSVYKTDHEKLVLLHEYKLHGRITGMV-LVPQLRSPLDCLMISTGKAKLSL 86
           Q+  A    + +Y  +  +L  L    + G ITG+  +V   RS    L++     K+S+
Sbjct: 57  QICMATQTQVELYDVEEGRLRRLFTRTVFGTITGLSSVVADGRS---VLIVVGDSGKMSV 113

Query: 87  VRFD-PNMPIWLETISLHYYEAQFSEKSILELAESSKLRIDPEKRCVFL 134
           +RF      + LE +    +    S   +  L+  + + +DP+ RCV L
Sbjct: 114 LRFKYEGGRVRLEAL----FNEPLSRSGVRRLSPQAHVSVDPQGRCVLL 158

>KLLA0F22583g 2107305..2108909 highly similar to sp|P39077
           Saccharomyces cerevisiae YJL014w CCT3 chaperonin of the
           TCP1 ring complex, cytosolic, start by similarity
          Length = 534

 Score = 30.8 bits (68), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 61/131 (46%), Gaps = 20/131 (15%)

Query: 552 SDVFEIGQKITSIKPKHFKKNVSTVEIAKVGGGKRIVQVTTKAVYLFNLGFKKLMTISFD 611
           SD  EI Q+++  KP   + +V+  ++ +   G + V   ++   +  L    + T+  D
Sbjct: 130 SDALEIIQQVS--KPVDVENDVAMKKLIQAAIGTKYVNHWSEK--MCELALNAVKTVRID 185

Query: 612 FEVVHVSIFDPFILLTNSKGEIKIYELEPKHRNKLNKVPLPEVLEEMIITSGVILKSSIC 671
                        L T S GE   YE++ K   ++ K+P  +VL+  ++  GV+L   + 
Sbjct: 186 -------------LGTTSAGETN-YEIDIKRYVRIEKIPGGDVLDSKVL-KGVMLNKDVV 230

Query: 672 NQYMSGL-EDP 681
           +  MS L E+P
Sbjct: 231 HPKMSRLIENP 241

>Kwal_56.23316
          Length = 278

 Score = 30.4 bits (67), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 28/58 (48%)

Query: 1120 KFEVMSLEFLMNNGNIYFLVSDRSNILHVLKYAPDEPNSLSGQKLVHCTSFNLHSTNT 1177
            K + +S   L ++G  +   +D SNI  V   A  EP  + GQ L    S NL  T+T
Sbjct: 51   KCDSVSFTVLQSSGRFFSAGADVSNIERVQAAARREPGGMLGQWLSEFVSRNLFVTHT 108

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.136    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 41,440,081
Number of extensions: 1844631
Number of successful extensions: 5425
Number of sequences better than 10.0: 21
Number of HSP's gapped: 5506
Number of HSP's successfully gapped: 24
Length of query: 1288
Length of database: 16,596,109
Length adjustment: 113
Effective length of query: 1175
Effective length of database: 12,684,275
Effective search space: 14904023125
Effective search space used: 14904023125
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)