Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_47.1818742141620370.0
Scas_588.1442341915100.0
KLLA0C10296g41841615010.0
YDR300C (PRO1)42842014890.0
CAGL0H01441g42742013810.0
AAL061C42041413790.0
YHR033W42342012621e-173
CAGL0D03894g48547112331e-168
Scas_690.3642442511721e-159
ADR106W79836710.97
Kwal_27.1157395626682.4
Scas_491.160277664.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_47.18187
         (416 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_47.18187                                                         789   0.0  
Scas_588.14                                                           586   0.0  
KLLA0C10296g 883644..884900 highly similar to sp|P32264 Saccharo...   582   0.0  
YDR300C (PRO1) [1128] chr4 complement(1061497..1062783) Glutamat...   578   0.0  
CAGL0H01441g complement(140740..142023) highly similar to sp|P32...   536   0.0  
AAL061C [126] [Homologous to ScYDR300C (PRO1) - SH; ScYHR033W - ...   535   0.0  
YHR033W (YHR033W) [2320] chr8 (175540..176811) Protein with simi...   490   e-173
CAGL0D03894g 389509..390966 similar to sp|P32264 Saccharomyces c...   479   e-168
Scas_690.36                                                           456   e-159
ADR106W [1847] [Homologous to ScYDL132W (CDC53) - SH] complement...    32   0.97 
Kwal_27.11573                                                          31   2.4  
Scas_491.1                                                             30   4.4  

>Kwal_47.18187
          Length = 421

 Score =  789 bits (2037), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/416 (92%), Positives = 385/416 (92%)

Query: 1   MSKTYTIVIKLGSSSLVDEKTKEPKLATMAMVVETVVRLRRMGHRVVLVSSGGIAVGLKT 60
           MSKTYTIVIKLGSSSLVDEKTKEPKLATMAMVVETVVRLRRMGHRVVLVSSGGIAVGLKT
Sbjct: 1   MSKTYTIVIKLGSSSLVDEKTKEPKLATMAMVVETVVRLRRMGHRVVLVSSGGIAVGLKT 60

Query: 61  LNLDKRPKHLXXXXXXXXXXXXRLIGRWDALFSQFSQRIAQILITRNDIVDWTQYKNAQN 120
           LNLDKRPKHL            RLIGRWDALFSQFSQRIAQILITRNDIVDWTQYKNAQN
Sbjct: 61  LNLDKRPKHLAQVQAIAAVGQGRLIGRWDALFSQFSQRIAQILITRNDIVDWTQYKNAQN 120

Query: 121 TIHELLQMGVVPIVNENDTLSVSEIKFGDNDTLSAITAALCGADYLFLLTDVDCLYTDNP 180
           TIHELLQMGVVPIVNENDTLSVSEIKFGDNDTLSAITAALCGADYLFLLTDVDCLYTDNP
Sbjct: 121 TIHELLQMGVVPIVNENDTLSVSEIKFGDNDTLSAITAALCGADYLFLLTDVDCLYTDNP 180

Query: 181 RTNPNAKPILVVPATSQMSEGTLXXXXXXXXXXXXXXXXXXXKLIAAELATNAGVNTIIM 240
           RTNPNAKPILVVPATSQMSEGTL                   KLIAAELATNAGVNTIIM
Sbjct: 181 RTNPNAKPILVVPATSQMSEGTLGVKTSSGSGSDVGTGGMTTKLIAAELATNAGVNTIIM 240

Query: 241 KSAEPSNISKVVSYMQNCESITGAAADNVEHLQEQEMLRLQENCVPLHTRFVADESQMHL 300
           KSAEPSNISKVVSYMQNCESITGAAADNVEHLQEQEMLRLQENCVPLHTRFVADESQMHL
Sbjct: 241 KSAEPSNISKVVSYMQNCESITGAAADNVEHLQEQEMLRLQENCVPLHTRFVADESQMHL 300

Query: 301 SNREFWMLHGLVSKGAIVIDQGAYAALTRKNKAGLLPAGLIEVEGNFHEHECIDLKVGSR 360
           SNREFWMLHGLVSKGAIVIDQGAYAALTRKNKAGLLPAGLIEVEGNFHEHECIDLKVGSR
Sbjct: 301 SNREFWMLHGLVSKGAIVIDQGAYAALTRKNKAGLLPAGLIEVEGNFHEHECIDLKVGSR 360

Query: 361 LATGELDPAMPVTTIGRARCNYTSVELCKIKGLQSDQIENVLGYADSEYVAHRGNL 416
           LATGELDPAMPVTTIGRARCNYTSVELCKIKGLQSDQIENVLGYADSEYVAHRGNL
Sbjct: 361 LATGELDPAMPVTTIGRARCNYTSVELCKIKGLQSDQIENVLGYADSEYVAHRGNL 416

>Scas_588.14
          Length = 423

 Score =  586 bits (1510), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/419 (68%), Positives = 333/419 (79%), Gaps = 6/419 (1%)

Query: 1   MSKTYTIVIKLGSSSLVDEKTKEPKLATMAMVVETVVRLRRMGHRVVLVSSGGIAVGLKT 60
           MSK YT+VIKLGSSSLVDEKTKEPKLA M+++VETVV+LRR+GH+V++VSSGGIAVGL+T
Sbjct: 3   MSKCYTLVIKLGSSSLVDEKTKEPKLAIMSLLVETVVKLRRLGHKVIIVSSGGIAVGLRT 62

Query: 61  LNLDKRPKHLXXXXXXXXXXXXRLIGRWDALFSQFSQRIAQILITRNDIVDWTQYKNAQN 120
           LNLDKRPKHL            RLIGRWD LFSQF QRIAQILITRNDIVDWTQYKNAQN
Sbjct: 63  LNLDKRPKHLAEVQAIAAVGQGRLIGRWDLLFSQFGQRIAQILITRNDIVDWTQYKNAQN 122

Query: 121 TIHELLQMGVVPIVNENDTLSVSEIKFGDNDTLSAITAALCGADYLFLLTDVDCLYTDNP 180
           TI+ELL+MGVVPIVNENDTLS+SEIKFGDNDTLSAIT+AL GADYLFLLTDVDCLYTDNP
Sbjct: 123 TINELLKMGVVPIVNENDTLSISEIKFGDNDTLSAITSALVGADYLFLLTDVDCLYTDNP 182

Query: 181 RTNPNAKPILVVPATSQMSEGTLXXXXXXXXXXXXXXXXXXXKLIAAELATNAGVNTIIM 240
           RTNP AKPILVVP    +++G                     KLIAA+LATNAGV+TIIM
Sbjct: 183 RTNPEAKPILVVP---DLAKGLPGVNTSSGSGSDVGTGGMETKLIAADLATNAGVHTIIM 239

Query: 241 KSAEPSNISKVVSYMQNCESITGAAAD---NVEHLQEQEMLRLQENCVPLHTRFVADESQ 297
           KS  P NI K+V YMQ  +  T        ++  LQ++E+  LQ   VPLHT F+A+++ 
Sbjct: 240 KSDIPGNILKIVEYMQAQDLDTNKKQKYQGDLSSLQDKELATLQSLHVPLHTTFIANDNL 299

Query: 298 MHLSNREFWMLHGLVSKGAIVIDQGAYAALTRKNKAGLLPAGLIEVEGNFHEHECIDLKV 357
            HL NREFW+LHGLV++G+++IDQGAY ALTRKNKAGLLP G+I++EG FHE EC+DLK+
Sbjct: 300 HHLKNREFWILHGLVTRGSVIIDQGAYNALTRKNKAGLLPVGIIDIEGTFHELECVDLKL 359

Query: 358 GSRLATGELDPAMPVTTIGRARCNYTSVELCKIKGLQSDQIENVLGYADSEYVAHRGNL 416
           G RL  GELDP  P+ T+GRARCNYTS+EL +IKGLQS+QIE  LGYADSEY AHR NL
Sbjct: 360 GKRLPNGELDPNTPLQTVGRARCNYTSLELSRIKGLQSEQIEEELGYADSEYAAHRENL 418

>KLLA0C10296g 883644..884900 highly similar to sp|P32264
           Saccharomyces cerevisiae YDR300c PRO1 glutamate
           5-kinase, start by similarity
          Length = 418

 Score =  582 bits (1501), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/416 (68%), Positives = 326/416 (78%), Gaps = 3/416 (0%)

Query: 1   MSKTYTIVIKLGSSSLVDEKTKEPKLATMAMVVETVVRLRRMGHRVVLVSSGGIAVGLKT 60
           M K + IVIKLGSSSLVDE+TKEPKL+ M+++VETVV+LRR GH+V++VSSGGIAVGLKT
Sbjct: 1   MVKQFVIVIKLGSSSLVDEETKEPKLSIMSLIVETVVKLRRRGHKVIIVSSGGIAVGLKT 60

Query: 61  LNLDKRPKHLXXXXXXXXXXXXRLIGRWDALFSQFSQRIAQILITRNDIVDWTQYKNAQN 120
           +N+  RPK L            RLIGRWD+LFS+F QRIAQILITRNDIVDWTQYKNAQN
Sbjct: 61  MNMKGRPKKLSKVQAIAAVGQGRLIGRWDSLFSEFDQRIAQILITRNDIVDWTQYKNAQN 120

Query: 121 TIHELLQMGVVPIVNENDTLSVSEIKFGDNDTLSAITAALCGADYLFLLTDVDCLYTDNP 180
           TI ELL MGVVPIVNENDTLSVSEIKFGDNDTLSAITAAL GADYLFLLTDVDCLYTDNP
Sbjct: 121 TISELLSMGVVPIVNENDTLSVSEIKFGDNDTLSAITAALTGADYLFLLTDVDCLYTDNP 180

Query: 181 RTNPNAKPILVVPATSQMSEGTLXXXXXXXXXXXXXXXXXXXKLIAAELATNAGVNTIIM 240
           R NP+AKPILVVP  SQ   G                     KLIAAELATNAGV+TIIM
Sbjct: 181 RANPDAKPILVVPDISQ---GLPGVNTDGGSGSDVGTGGMKTKLIAAELATNAGVHTIIM 237

Query: 241 KSAEPSNISKVVSYMQNCESITGAAADNVEHLQEQEMLRLQENCVPLHTRFVADESQMHL 300
           KS  P NISK+V YMQ  +        ++  LQ  EM  L  N VPLHTRF+A+ +  HL
Sbjct: 238 KSDTPENISKIVLYMQERDDGVNELTQDLADLQLTEMQSLVNNHVPLHTRFIANSNHHHL 297

Query: 301 SNREFWMLHGLVSKGAIVIDQGAYAALTRKNKAGLLPAGLIEVEGNFHEHECIDLKVGSR 360
            NR+FWMLHGLVS+GA++ID GAY ALTRKNKAGLLPAG+IEV+G+FHEHECID+K+G R
Sbjct: 298 KNRQFWMLHGLVSQGAVIIDIGAYEALTRKNKAGLLPAGVIEVQGSFHEHECIDIKLGVR 357

Query: 361 LATGELDPAMPVTTIGRARCNYTSVELCKIKGLQSDQIENVLGYADSEYVAHRGNL 416
            + G LD ++ + T+GRARCNYTS EL KIKGLQSDQIE++LGYADSEYVAHR NL
Sbjct: 358 DSDGNLDKSVALKTVGRARCNYTSTELSKIKGLQSDQIEDILGYADSEYVAHRENL 413

>YDR300C (PRO1) [1128] chr4 complement(1061497..1062783) Glutamate
           5-kinase, carries out first step in proline biosynthesis
           pathway [1287 bp, 428 aa]
          Length = 428

 Score =  578 bits (1489), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/420 (66%), Positives = 332/420 (79%), Gaps = 8/420 (1%)

Query: 2   SKTYTIVIKLGSSSLVDEKTKEPKLATMAMVVETVVRLRRMGHRVVLVSSGGIAVGLKTL 61
           SK+YTIVIKLGSSSLVDEKTKEPKLA M+++VETVV+LRRMGH+V++VSSGGIAVGL+T+
Sbjct: 7   SKSYTIVIKLGSSSLVDEKTKEPKLAIMSLIVETVVKLRRMGHKVIIVSSGGIAVGLRTM 66

Query: 62  NLDKRPKHLXXXXXXXXXXXXRLIGRWDALFSQFSQRIAQILITRNDIVDWTQYKNAQNT 121
            ++KRPKHL            RLIGRWD LFSQF QRIAQIL+TRNDI+DWTQYKNAQNT
Sbjct: 67  RMNKRPKHLAEVQAIAAIGQGRLIGRWDLLFSQFDQRIAQILLTRNDILDWTQYKNAQNT 126

Query: 122 IHELLQMGVVPIVNENDTLSVSEIKFGDNDTLSAITAALCGADYLFLLTDVDCLYTDNPR 181
           I+ELL MGV+PIVNENDTLSV EIKFGDNDTLSAIT+AL  ADYLFLLTDVDCLYTDNPR
Sbjct: 127 INELLNMGVIPIVNENDTLSVREIKFGDNDTLSAITSALIHADYLFLLTDVDCLYTDNPR 186

Query: 182 TNPNAKPILVVPATSQMSEGTLXXXXXXXXXXXXXXXXXXXKLIAAELATNAGVNTIIMK 241
           TNP+A PILVVP    +S+G                     KL+AA+LATNAGV+T+IMK
Sbjct: 187 TNPDAMPILVVP---DLSKGLPGVNTAGGSGSDVGTGGMETKLVAADLATNAGVHTLIMK 243

Query: 242 SAEPSNISKVVSYMQNCE-----SITGAAADNVEHLQEQEMLRLQENCVPLHTRFVADES 296
           S  P+NI ++V YMQ  E      +  A   ++  LQ++E  +L+   VPLHT+F+A+++
Sbjct: 244 SDTPANIGRIVEYMQTLELDDENKVKQAYNGDLTDLQKREFEKLKALNVPLHTKFIANDN 303

Query: 297 QMHLSNREFWMLHGLVSKGAIVIDQGAYAALTRKNKAGLLPAGLIEVEGNFHEHECIDLK 356
           + HL NREFW+LHGLVSKGA+VIDQGAYAALTRKNKAGLLPAG+I+V+G FHE EC+D+K
Sbjct: 304 KHHLKNREFWILHGLVSKGAVVIDQGAYAALTRKNKAGLLPAGVIDVQGTFHELECVDIK 363

Query: 357 VGSRLATGELDPAMPVTTIGRARCNYTSVELCKIKGLQSDQIENVLGYADSEYVAHRGNL 416
           VG +L  G LDP  P+ T+G+ARCNYTS EL KIKGL SDQIE  LGY DSEYVAHR NL
Sbjct: 364 VGKKLPDGTLDPDFPLQTVGKARCNYTSSELTKIKGLHSDQIEEELGYNDSEYVAHRENL 423

>CAGL0H01441g complement(140740..142023) highly similar to sp|P32264
           Saccharomyces cerevisiae YDR300c PRO1 glutamate
           5-kinase, hypothetical start
          Length = 427

 Score =  536 bits (1381), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/420 (61%), Positives = 317/420 (75%), Gaps = 12/420 (2%)

Query: 3   KTYTIVIKLGSSSLVDEKTKEPKLATMAMVVETVVRLRRMGHRVVLVSSGGIAVGLKTLN 62
           K +TIVIKLG+SSLVDEKTKEP+LA M+++VETVV+LRR+GH VV+VSSG I VGL  L 
Sbjct: 9   KPFTIVIKLGTSSLVDEKTKEPRLAIMSLIVETVVKLRRLGHNVVIVSSGSIGVGLHILG 68

Query: 63  LDKRPKHLXXXXXXXXXXXXRLIGRWDALFSQFSQRIAQILITRNDIVDWTQYKNAQNTI 122
           ++KRPKHL            +LIGRWD+LF+ F Q IAQIL+TRNDI+DW+QY+NAQNT+
Sbjct: 69  MEKRPKHLSEVQAIAAIGQSKLIGRWDSLFAHFGQSIAQILLTRNDILDWSQYRNAQNTV 128

Query: 123 HELLQMGVVPIVNENDTLSVSEIKFGDNDTLSAITAALCGADYLFLLTDVDCLYTDNPRT 182
            ELL+MGVVPI+NENDTLSV EIKFGDNDTLSAITA L  ADYLFLLTDVDCLYT +PR+
Sbjct: 129 EELLKMGVVPIINENDTLSVQEIKFGDNDTLSAITAGLIHADYLFLLTDVDCLYTADPRS 188

Query: 183 NPNAKPILVVPATSQMSEGTLXXXXXXXXXXXXXXXXXXXKLIAAELATNAGVNTIIMKS 242
           +P+AKPIL+VP    +S+G                     KL+AAELATNAGV+TIIMKS
Sbjct: 189 DPDAKPILIVP---DLSKGLPGVDTSSGSGSDVGTGGMQTKLVAAELATNAGVHTIIMKS 245

Query: 243 AEPSNISKVVSYMQNCESITGAAADN------VEHLQEQEMLRLQENCVPLHTRFVADES 296
             PSNI K+V Y+Q   S+     DN      +  LQ +E  +L    VP HT+F+A+  
Sbjct: 246 DAPSNIYKIVKYIQ---SLHDTGEDNKVFEGDLMKLQLEEYEKLDRMGVPFHTKFLANSI 302

Query: 297 QMHLSNREFWMLHGLVSKGAIVIDQGAYAALTRKNKAGLLPAGLIEVEGNFHEHECIDLK 356
             HL N+EFW+LHGLV+ GA++ID+GAY ALTRKNKAGLLP G+IE+EG+FHE EC+DLK
Sbjct: 303 SRHLRNKEFWILHGLVTSGAVIIDEGAYKALTRKNKAGLLPVGVIEIEGSFHEMECVDLK 362

Query: 357 VGSRLATGELDPAMPVTTIGRARCNYTSVELCKIKGLQSDQIENVLGYADSEYVAHRGNL 416
           VG RL  GELDP  P+T +GRARCNY S+E+ KIKG QSD+IEN LGY +SEY+AHR N+
Sbjct: 363 VGKRLPNGELDPDYPLTIVGRARCNYPSLEISKIKGQQSDEIENELGYCNSEYIAHRENM 422

>AAL061C [126] [Homologous to ScYDR300C (PRO1) - SH; ScYHR033W - SH]
           (239518..240780) [1263 bp, 420 aa]
          Length = 420

 Score =  535 bits (1379), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/414 (63%), Positives = 317/414 (76%), Gaps = 4/414 (0%)

Query: 3   KTYTIVIKLGSSSLVDEKTKEPKLATMAMVVETVVRLRRMGHRVVLVSSGGIAVGLKTLN 62
           + +TIV+KLGSSSLVDE T EPKL+ M+ +VETVV+LRRMGH+VV+VSSG IAVGLKT+ 
Sbjct: 6   RKFTIVLKLGSSSLVDESTLEPKLSIMSHIVETVVKLRRMGHKVVIVSSGCIAVGLKTVG 65

Query: 63  LDKRPKHLXXXXXXXXXXXXRLIGRWDALFSQFSQRIAQILITRNDIVDWTQYKNAQNTI 122
            D+RPK L            RLI RWD+LF  F+++IAQIL+TRNDIVDW+QYKNAQNT 
Sbjct: 66  TDRRPKKLSQLQAIAAVGQGRLIARWDSLFRPFNEKIAQILLTRNDIVDWSQYKNAQNTF 125

Query: 123 HELLQMGVVPIVNENDTLSVSEIKFGDNDTLSAITAALCGADYLFLLTDVDCLYTDNPRT 182
           HELL MGV PIVNENDTLS+S +KFGDNDTLSAITA L GADYLFL+TDVDCLYTDNPRT
Sbjct: 126 HELLAMGVTPIVNENDTLSISGVKFGDNDTLSAITAGLIGADYLFLMTDVDCLYTDNPRT 185

Query: 183 NPNAKPILVVPATSQMSEGTLXXXXXXXXXXXXXXXXXXXKLIAAELATNAGVNTIIMKS 242
           NP+AKPILVVP    +S+G                     K++AA+LATNAGV+TIIMKS
Sbjct: 186 NPDAKPILVVP---DLSQGLPGVNTSSGSGSGVGTGGMATKILAADLATNAGVHTIIMKS 242

Query: 243 AEPSNISKVVSYMQNCESITGAAADNVEHLQEQEMLRLQENCVPLHTRFVADESQMHLSN 302
             P ++ ++V +M+  E  T  +AD  E LQ  E+  LQE+ VPLHTRF+A+  Q  L+ 
Sbjct: 243 ERPVDMVRIVEFMEWREQCTAVSAD-AETLQTDELNLLQEHGVPLHTRFIANVWQPSLNK 301

Query: 303 REFWMLHGLVSKGAIVIDQGAYAALTRKNKAGLLPAGLIEVEGNFHEHECIDLKVGSRLA 362
           REFW+LHGLVS G ++ID+GAY ALTRKNKAGLLPAG+I VEG+FHE E +DLK+G R A
Sbjct: 302 REFWILHGLVSCGTVIIDKGAYKALTRKNKAGLLPAGVIAVEGSFHELEAVDLKIGVRKA 361

Query: 363 TGELDPAMPVTTIGRARCNYTSVELCKIKGLQSDQIENVLGYADSEYVAHRGNL 416
            G LD + P+ T+GRARCNY+SVE+ KIKGLQS QIE VLGY DSEY+AHR NL
Sbjct: 362 DGSLDESEPLQTVGRARCNYSSVEVDKIKGLQSGQIETVLGYIDSEYIAHRENL 415

>YHR033W (YHR033W) [2320] chr8 (175540..176811) Protein with
           similarity to Pro1p [1272 bp, 423 aa]
          Length = 423

 Score =  490 bits (1262), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 238/420 (56%), Positives = 305/420 (72%), Gaps = 7/420 (1%)

Query: 1   MSKTYTIVIKLGSSSLVDEKTKEPKLATMAMVVETVVRLRRMGHRVVLVSSGGIAVGLKT 60
           M+K YTIVIKLGSSSLVDE TKEPKL+ M ++VETV  L+RMGH+V++VSSGGIAVGL  
Sbjct: 1   MTKAYTIVIKLGSSSLVDESTKEPKLSIMTLIVETVTNLKRMGHKVIIVSSGGIAVGLDA 60

Query: 61  LNLDKRPKHLXXXXXXXXXXXXRLIGRWDALFSQFSQRIAQILITRNDIVDWTQYKNAQN 120
           LN+  +PK L            RLI RW+ LFSQ+ ++ AQIL+TRNDI+ W QY NA+N
Sbjct: 61  LNIPHKPKQLSEVQAIAAVGQGRLIARWNMLFSQYGEQTAQILLTRNDILRWNQYNNARN 120

Query: 121 TIHELLQMGVVPIVNENDTLSVSEIKFGDNDTLSAITAALCGADYLFLLTDVDCLYTDNP 180
           TI+ELL MGV+PIVNENDTLS+SEI+FGDNDTLSAITAAL GAD+LFLLTDVDCLYTDNP
Sbjct: 121 TINELLAMGVIPIVNENDTLSISEIEFGDNDTLSAITAALVGADFLFLLTDVDCLYTDNP 180

Query: 181 RTNPNAKPILVVPATSQMSEGTLXXXXXXXXXXXXXXXXXXXKLIAAELATNAGVNTIIM 240
           RTNP+A+PI++VP   ++SEG                     KLIAA+LA+NAG+ TI+M
Sbjct: 181 RTNPDARPIVLVP---ELSEGLPGVNTSSGSGSEVGTGGMRTKLIAADLASNAGIETIVM 237

Query: 241 KSAEPSNISKVVSYMQN----CESITGAAADNVEHLQEQEMLRLQENCVPLHTRFVADES 296
           KS  P  + K+V Y+Q+       I          LQ+ E+ +L+   VP+HT+F+A+++
Sbjct: 238 KSDRPEYVPKIVDYIQHHFRPPRHIGNGTQQQFLDLQDTELEQLRRYDVPMHTKFLANDN 297

Query: 297 QMHLSNREFWMLHGLVSKGAIVIDQGAYAALTRKNKAGLLPAGLIEVEGNFHEHECIDLK 356
           +  L NREFW+LHGL++KGAI+ID+ +Y  L  K+ A L P  +IEV  NFHE EC+DLK
Sbjct: 298 KHKLKNREFWILHGLITKGAIIIDENSYDKLLSKDMASLTPNAVIEVRDNFHELECVDLK 357

Query: 357 VGSRLATGELDPAMPVTTIGRARCNYTSVELCKIKGLQSDQIENVLGYADSEYVAHRGNL 416
           +G RL  GELD + P+ ++G  R NYTS+EL KIKGL S++I +VLGY+ SEYVAHR N+
Sbjct: 358 IGQRLPNGELDISKPIQSVGCVRSNYTSLELAKIKGLPSEKIHDVLGYSVSEYVAHRENI 417

>CAGL0D03894g 389509..390966 similar to sp|P32264 Saccharomyces
           cerevisiae YDR300c PRO1 or sp|P38690 Saccharomyces
           cerevisiae YHR033w, hypothetical start
          Length = 485

 Score =  479 bits (1233), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 247/471 (52%), Positives = 310/471 (65%), Gaps = 60/471 (12%)

Query: 4   TYTIVIKLGSSSLVDEKTKEPKLATMAMVVETVVRLRRMGHRVVLVSSGGIAVGLKTLNL 63
           + TIVIKLG+SSLVDEKT+EPKL+ M  VVETV++L+R GH+VV+VSSGGIAVGL  + +
Sbjct: 2   SQTIVIKLGTSSLVDEKTREPKLSIMTQVVETVIQLKRQGHKVVIVSSGGIAVGLNAMEM 61

Query: 64  DKRPKHLXXXXXXXXXXXXRLIGRWDALFSQFSQRIAQILITRNDIVDWTQYKNAQNTIH 123
           DK+P  L            RLIGRW  LF Q+ ++IAQILITRNDI+ WTQYKNAQNTI 
Sbjct: 62  DKKPTDLAEIQAIAAIGQGRLIGRWSMLFQQYGEKIAQILITRNDILGWTQYKNAQNTIL 121

Query: 124 ELLQMGVVPIVNENDTLSVSEIKFGDNDTLSAITAALCGADYLFLLTDVDCLYTDNPRTN 183
           +LL+MGVVPIVNENDTLS+SEIKFGDNDTLSAITAAL  AD+LFLLTDVDCLYT+NPRTN
Sbjct: 122 QLLEMGVVPIVNENDTLSISEIKFGDNDTLSAITAALVSADHLFLLTDVDCLYTENPRTN 181

Query: 184 PNAKPILVVPATSQMSEGTLXXXXXXXXXXXXXXXXXXXKLIAAELATNAGVNTIIMKSA 243
           P+AKPI++VP   Q   G                     KLIAA+LATNAGVNTIIMKS 
Sbjct: 182 PDAKPIVIVPNMDQGVPGV--DTSNADAGSSVGTGGMRTKLIAADLATNAGVNTIIMKSD 239

Query: 244 EPSNISKVVSYM-----------------QNCESIT-----------------GAAADNV 269
            PSN+  +V Y+                 Q+ E ++                   + +++
Sbjct: 240 APSNVKHIVDYLVKYPKKVLYDDNKSSREQSSEPLSLDQLKNHPYGKGGVISPPKSEEDL 299

Query: 270 EHLQEQEMLRLQENCVPLHTRFVADESQMHLSNREFWMLHGLVSKGAIVIDQGAYAALTR 329
             LQ+ E+  ++E  VPLHT F+A +   HL NREFW+LHGLV+KG ++ID+ AY  LT 
Sbjct: 300 LSLQDAELKEIKERNVPLHTVFLAKDIDHHLKNREFWILHGLVTKGVLIIDEDAYNTLTN 359

Query: 330 KN------------------------KAGLLPAGLIEVEGNFHEHECIDLKVGSRLATGE 365
           ++                          GLLP  +IEV+G+FHE EC+D+KVG RL  G+
Sbjct: 360 ESGDEEHVSEAYVSEVEDDEMSEVDQDHGLLPKDVIEVKGSFHELECVDIKVGKRLPNGK 419

Query: 366 LDPAMPVTTIGRARCNYTSVELCKIKGLQSDQIENVLGYADSEYVAHRGNL 416
           LDP  P+  +GRARCN+TSVEL +IKGL  D++++VLGY  SEYVAH+ NL
Sbjct: 420 LDPDAPLEYVGRARCNFTSVELNRIKGLPVDRVQDVLGYDVSEYVAHKDNL 470

>Scas_690.36
          Length = 424

 Score =  456 bits (1172), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 234/425 (55%), Positives = 295/425 (69%), Gaps = 16/425 (3%)

Query: 1   MSKTYTIVIKLGSSSLVDEKTKEPKLATMAMVVETVVRLRRMGHRVVLVSSGGIAVGLKT 60
           M+K+ TIVIKLGSSSLVDE T+EPKL+TM  +VE V  L+R+GH+VV+VSSGGIAVGL  
Sbjct: 1   MTKSNTIVIKLGSSSLVDEVTREPKLSTMTQIVEIVSCLKRLGHKVVIVSSGGIAVGLDA 60

Query: 61  LNLDKRPKHLXXXXXXXXXXXXRLIGRWDALFSQFSQRIAQILITRNDIVDWTQYKNAQN 120
           +NL K+P  L            +LIGRW+ LF Q++++IAQIL+TR DI  WTQ+KNAQN
Sbjct: 61  MNLKKKPSQLSEIQAIAAIGQGKLIGRWEMLFRQYNEQIAQILLTRKDIFGWTQFKNAQN 120

Query: 121 TIHELLQMGVVPIVNENDTLSVSEIKFGDNDTLSAITAALCGADYLFLLTDVDCLYTDNP 180
           TI+ LL+MGVVPIVNENDTLSVSEIKFGDNDTLSAIT+AL  ADYLFLLTDVDCLYTDNP
Sbjct: 121 TINALLKMGVVPIVNENDTLSVSEIKFGDNDTLSAITSALVNADYLFLLTDVDCLYTDNP 180

Query: 181 RTNPNAKPILVVPATSQMSEGTLXXX-----XXXXXXXXXXXXXXXXKLIAAELATNAGV 235
           + N +AKPIL V     M E ++                        K+ AA+LATN G+
Sbjct: 181 KVNKDAKPILTV---FDMHEDSISKVLDTCPSLSDSGSNIGTGGMRTKITAADLATNVGI 237

Query: 236 NTIIMKSAEPSNISKVVSYMQNCE-SITGAAADNVEHLQEQEMLRLQENCVPLHTRFVAD 294
           +TIIM S  P+NI K++ YM+     + G    N     + E+  L  + VPLHT+F+A+
Sbjct: 238 HTIIMSSQTPANILKIIEYMETSNLKVDGGVCSN----NDLELKNLIAHDVPLHTKFIAN 293

Query: 295 E-SQMHLSNREFWMLHGLVSKGAIVIDQGAYAALTRKNK--AGLLPAGLIEVEGNFHEHE 351
           E S+ +L NREFW+LHGLV+KG+I+ID+ +Y  L RK +   GLLP  +I+ E  FHE E
Sbjct: 294 ENSETYLKNREFWILHGLVTKGSIIIDKNSYKDLLRKKEKCKGLLPISIIDTEDQFHELE 353

Query: 352 CIDLKVGSRLATGELDPAMPVTTIGRARCNYTSVELCKIKGLQSDQIENVLGYADSEYVA 411
           C++LKVG RL  G+++    +  +GRARCNYTS E+ KIKGL+SDQI   LGY DS YV 
Sbjct: 354 CVELKVGERLPNGKVNRKAGLKVVGRARCNYTSYEINKIKGLKSDQIFETLGYGDSAYVV 413

Query: 412 HRGNL 416
           H  NL
Sbjct: 414 HNENL 418

>ADR106W [1847] [Homologous to ScYDL132W (CDC53) - SH]
           complement(894781..897177) [2397 bp, 798 aa]
          Length = 798

 Score = 32.0 bits (71), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 22/36 (61%)

Query: 125 LLQMGVVPIVNENDTLSVSEIKFGDNDTLSAITAAL 160
           L QM ++ + NENDTLS  +I+ G N T   I  ++
Sbjct: 622 LFQMAILLMFNENDTLSFEQIQEGTNLTTQHIILSM 657

>Kwal_27.11573
          Length = 956

 Score = 30.8 bits (68), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 18/26 (69%)

Query: 390 IKGLQSDQIENVLGYADSEYVAHRGN 415
           I+G+  D I N+L  ADS+ +AH GN
Sbjct: 846 IEGMDLDDINNLLSRADSDLIAHDGN 871

>Scas_491.1
          Length = 602

 Score = 30.0 bits (66), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 38/77 (49%), Gaps = 4/77 (5%)

Query: 243 AEPSNISKVVSYMQNCES-ITGAAADNVE--HLQEQEMLRLQENCVPLHTRFVADESQMH 299
            E +N+ K +   QN E  +     DN++   L+ QE+    +N V    RF+A+ +++ 
Sbjct: 322 TENTNLKKQIEQFQNQEKFLKKDFVDNIQSKDLKIQELELANKNLVEEKNRFIAENNKLS 381

Query: 300 LSNREFW-MLHGLVSKG 315
           + N E    L GL S+ 
Sbjct: 382 IENNELREKLEGLRSQS 398

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.132    0.378 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 11,634,677
Number of extensions: 435073
Number of successful extensions: 1056
Number of sequences better than 10.0: 12
Number of HSP's gapped: 1050
Number of HSP's successfully gapped: 13
Length of query: 416
Length of database: 16,596,109
Length adjustment: 104
Effective length of query: 312
Effective length of database: 12,995,837
Effective search space: 4054701144
Effective search space used: 4054701144
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 63 (28.9 bits)