Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_47.1818433733317680.0
KLLA0C10318g3333377035e-91
Sklu_1023.23523477002e-90
AAL062W3273226896e-89
CAGL0D03916g3443296245e-79
Scas_690.373323205836e-73
YHR034C3443285263e-64
AFR634W49079800.062
CAGL0J01573g154100671.1
Kwal_47.1779247134653.6
Scas_694.2131373653.6
Sklu_2066.263948654.2
KLLA0E19943g59294636.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_47.18184
         (333 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_47.18184                                                         685   0.0  
KLLA0C10318g complement(885031..886032) similar to sp|P38768 Sac...   275   5e-91
Sklu_1023.2 YHR034C, Contig c1023 1165-2223                           274   2e-90
AAL062W [125] [Homologous to ScYHR034C - SH] complement(238295.....   270   6e-89
CAGL0D03916g complement(391089..392123) similar to sp|P38768 Sac...   244   5e-79
Scas_690.37                                                           229   6e-73
YHR034C (YHR034C) [2321] chr8 complement(176957..177991) Protein...   207   3e-64
AFR634W [3826] [Homologous to ScYNL253W - SH] complement(1593772...    35   0.062
CAGL0J01573g complement(149600..150064) some similarities with s...    30   1.1  
Kwal_47.17792                                                          30   3.6  
Scas_694.21                                                            30   3.6  
Sklu_2066.2 YJL128C, Contig c2066 5081-7000                            30   4.2  
KLLA0E19943g 1766853..1768631 weakly similar to sp|P34217 Saccha...    29   6.5  

>Kwal_47.18184
          Length = 337

 Score =  685 bits (1768), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/333 (100%), Positives = 333/333 (100%)

Query: 1   MAFLLRAIDNGNNDADSVVRVEPQPGFVVKSKLVSSYDGRYSLGAKVFVNVCHEDQVPQP 60
           MAFLLRAIDNGNNDADSVVRVEPQPGFVVKSKLVSSYDGRYSLGAKVFVNVCHEDQVPQP
Sbjct: 1   MAFLLRAIDNGNNDADSVVRVEPQPGFVVKSKLVSSYDGRYSLGAKVFVNVCHEDQVPQP 60

Query: 61  EIPFNPSVVYPLIMTNQWEIPIIASALRQDRDKKGDLCYVCDCCINSACMQWARTELQLR 120
           EIPFNPSVVYPLIMTNQWEIPIIASALRQDRDKKGDLCYVCDCCINSACMQWARTELQLR
Sbjct: 61  EIPFNPSVVYPLIMTNQWEIPIIASALRQDRDKKGDLCYVCDCCINSACMQWARTELQLR 120

Query: 121 EILVEWCLESCELRQRIEISREHLAFPKLRMKGASILPLEVLTTDLHADFRHEMRDLAKR 180
           EILVEWCLESCELRQRIEISREHLAFPKLRMKGASILPLEVLTTDLHADFRHEMRDLAKR
Sbjct: 121 EILVEWCLESCELRQRIEISREHLAFPKLRMKGASILPLEVLTTDLHADFRHEMRDLAKR 180

Query: 181 EAEPASILELKRELIDADLDSTSIDSSALPPLFPSKTPTRLLIQEIDSTSTSSQAPAKTV 240
           EAEPASILELKRELIDADLDSTSIDSSALPPLFPSKTPTRLLIQEIDSTSTSSQAPAKTV
Sbjct: 181 EAEPASILELKRELIDADLDSTSIDSSALPPLFPSKTPTRLLIQEIDSTSTSSQAPAKTV 240

Query: 241 STTPPTTDPAFDISMGKPSAQNSQAKLRIDIVSLLPAESDYLISYNSNENTLTISHTNTT 300
           STTPPTTDPAFDISMGKPSAQNSQAKLRIDIVSLLPAESDYLISYNSNENTLTISHTNTT
Sbjct: 241 STTPPTTDPAFDISMGKPSAQNSQAKLRIDIVSLLPAESDYLISYNSNENTLTISHTNTT 300

Query: 301 HFLPKEITIALPHVVVSSTPQITTAFDDQSRKM 333
           HFLPKEITIALPHVVVSSTPQITTAFDDQSRKM
Sbjct: 301 HFLPKEITIALPHVVVSSTPQITTAFDDQSRKM 333

>KLLA0C10318g complement(885031..886032) similar to sp|P38768
           Saccharomyces cerevisiae YHR034c singleton, start by
           similarity
          Length = 333

 Score =  275 bits (703), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 145/337 (43%), Positives = 219/337 (64%), Gaps = 12/337 (3%)

Query: 1   MAFLLRAI-DNGNNDADSVVRVEPQPGFVVKSKLVSSYDGRYSLGAKVFVNVCHEDQVPQ 59
           M+FLLR + D+ +N++++V+R+ P+P FVVKSK+++      S  AK+F+N+CH DQ+P 
Sbjct: 1   MSFLLRPLNDSSSNNSNNVIRISPEPCFVVKSKVINPGTTSLSSNAKIFINICHNDQIPL 60

Query: 60  PEIPFNPSVVYPLIMTNQWEIPIIASALRQDRDKKGDLCYVCDCCINSACMQWARTELQL 119
           PEI FNP++VYPLI+ NQWEIPI+ S++R+D DKKG++CYV DCCIN+ C+ W + +LQL
Sbjct: 61  PEIDFNPAIVYPLIINNQWEIPIVTSSIREDVDKKGNVCYVSDCCINTKCVSWIQHDLQL 120

Query: 120 REILVEWCLESCELRQRIEISREHLAFPKLRMKGASILPLEVLTTDLHADFRHEMRDLAK 179
           REI+VEWCLESCELR  +EISR++++FPKL+ KG +I  LE+L  DL  ++   + DL  
Sbjct: 121 REIVVEWCLESCELRAELEISRDNISFPKLKKKGDTIPELEILREDLTENYEETINDLVN 180

Query: 180 RE-AEPASILELKRELIDADLDSTSIDSSALPPLFPSKTPTRL--LIQEIDSTSTSSQAP 236
           RE  EP SI+E +R+ +  D  ST      LPPL P    +R   LI+EI+  S      
Sbjct: 181 REQKEPVSIIEKRRDFLAEDEPST----GELPPLIPIDQSSRRKPLIEEIEDLSLHETKK 236

Query: 237 AKTVSTTPPTTDPAFDISMGKPSAQNSQAKLRIDIVSLLPAESDYLISYNSNENTLTISH 296
            K       +   ++++SMGKP    S+  L+I++ S L +  DY I Y++  N L I +
Sbjct: 237 PKVEEIQKKSI--SYELSMGKP-KDTSEFLLKIEVTSELNSSLDYNIKYDAKSNKLIIKN 293

Query: 297 TNTTHFLPKEITIALPHVVVSSTPQITTAFDDQSRKM 333
           TN   +  K++ + LP  + ++ P++   F    R++
Sbjct: 294 TNLGIYPEKKLKVPLPD-IFNNPPKLECFFVKPERRL 329

>Sklu_1023.2 YHR034C, Contig c1023 1165-2223
          Length = 352

 Score =  274 bits (700), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 152/347 (43%), Positives = 214/347 (61%), Gaps = 19/347 (5%)

Query: 3   FLLRAIDNGNNDADSVVRVEPQPGFVVKSKLVS-SYDGRYSLGAKVFVNVCHEDQVPQPE 61
           FLLR I++  + A SV+ +EPQPGFV+KSKL S S     ++G K+F+NVC ++QVP+P 
Sbjct: 5   FLLRPINSTESTA-SVLLLEPQPGFVIKSKLDSCSPPTELAIGTKIFINVCFDNQVPKPN 63

Query: 62  IPFNPSVVYPLIMTNQWEIPIIASALRQDRDKKGDLCYVCDCCINSACMQWARTELQLRE 121
             FNPS+VYPLIM NQWEIPII S +R+D+DKKG +CYV DCCIN+ CM W   + QLRE
Sbjct: 64  TEFNPSIVYPLIMNNQWEIPIITSNVREDKDKKGAICYVWDCCINTECMSWVNKDYQLRE 123

Query: 122 ILVEWCLESCELRQRIEISREHLAFPKLRMKGASILPLEVLTTDLHADFRHEMRDLAKRE 181
           ILVEWCLESCELRQ +EISR+ +AFPKL+ KG  I  LE+L +DL+ DFR E+  + +++
Sbjct: 124 ILVEWCLESCELRQSVEISRDRIAFPKLKRKGDKIPTLEILNSDLNQDFRKEIDSIVEKD 183

Query: 182 -AEPASILELKRELIDADL-----DSTSIDSSALPPLFPSKTPT--------RLLIQEID 227
             +P SILE++R+L+  +      ++   D+  LPPLFP+   T        + LI+EI 
Sbjct: 184 RTDPTSILEMQRDLVFGETLGGRKNNGDEDTGTLPPLFPTTATTTTNNTTQKKPLIEEIQ 243

Query: 228 STST-SSQAPAKTVSTTPPTTDPAFDISMGKPSAQNSQAKLRIDIVSLLPAESDYLISYN 286
             S    QA  +            +  +M K +  + + KL+I+I+S L +  DY I Y+
Sbjct: 244 DLSIREKQAETRKPRAIVEPKTLEYQATMVK-TKDDKKFKLKIEIISELDSSLDYSIKYD 302

Query: 287 SNENTLTISHTNTTHFLPKEITIALPHVVVSSTPQITTAFDDQSRKM 333
              + L I + N   +  K++ I LP  +    P I   F    RK+
Sbjct: 303 VKNSVLAIKNINLHLYNEKKLEIPLPK-IFEEQPDIKCFFIKSERKL 348

>AAL062W [125] [Homologous to ScYHR034C - SH]
           complement(238295..239278) [984 bp, 327 aa]
          Length = 327

 Score =  270 bits (689), Expect = 6e-89,   Method: Compositional matrix adjust.
 Identities = 147/322 (45%), Positives = 201/322 (62%), Gaps = 17/322 (5%)

Query: 1   MAFLLRAIDNGNNDADSVVRVEPQPGFVVKSKLVSSYDGRYSLGAKVFVNVCHEDQVPQP 60
           M FLLR ID+      SV+   P PGFV+KSKL    D    +G K FVNVCH  QVP P
Sbjct: 1   MDFLLRPIDSKEC---SVITFVPTPGFVIKSKLEHGKDATLVVGTKTFVNVCHHTQVPLP 57

Query: 61  EIPFNPSVVYPLIMTNQWEIPIIASALRQDRDKKGDLCYVCDCCINSACMQWARTELQLR 120
           ++PF+ S+VYPLIM N+WEIPI+ SA+R+D DKKG  CYV DCCINS CMQW   + QLR
Sbjct: 58  DVPFDASIVYPLIMENKWEIPIVTSAVRRDADKKGQECYVWDCCINSECMQWIEKDYQLR 117

Query: 121 EILVEWCLESCELRQRIEISREHLAFPKLRMKGASILP-LEVLTTDLHADFRHEMRDLAK 179
           EILVEWCLESCELRQ + ISRE + FP+++ KGA  LP +EVL  DL  D++HE+ + + 
Sbjct: 118 EILVEWCLESCELRQSVGISREAVVFPRMKSKGA--LPAVEVLQQDLTHDYKHEIAENSS 175

Query: 180 REA-EPASILELKRELIDADLDSTSIDSSALPPLFPSKTPTRLLIQEIDST--STSSQAP 236
               +P  IL ++  L     +  S D   LP LFP +  TR LI+E+++   S S +AP
Sbjct: 176 LGMDDPRQILHMRGALD----EEASGDDGTLPSLFPERPATRPLIEEVNTGRHSASVEAP 231

Query: 237 AKTVSTTPPTTDPAFDISMGKPSAQNSQAKLRIDIVSLLPAESDYLISYNSNENTLTISH 296
               +   P  +  F ++MG+P   ++  K+++ + S L +   Y + Y+  EN+L ++ 
Sbjct: 232 KTLPACGLPRLE--FAVTMGRPR-NDANYKIKVQVASALNSGHAYSVHYDGKENSLLVTS 288

Query: 297 TNTTHFLPKEITIALPHVVVSS 318
           T+   + PKEI I LP VV  +
Sbjct: 289 TSQA-YEPKEICIPLPGVVAGT 309

>CAGL0D03916g complement(391089..392123) similar to sp|P38768
           Saccharomyces cerevisiae YHR034c, hypothetical start
          Length = 344

 Score =  244 bits (624), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 134/329 (40%), Positives = 206/329 (62%), Gaps = 25/329 (7%)

Query: 1   MAFLLRAIDNGNNDADSVVRVEPQPGFVVKSKLVSSYDGR------YSLGAKVFVNVCHE 54
           M FLLR I +G  D + V  + P+P FV+KSK+V+  D R         G+K+FVN+CH+
Sbjct: 1   MDFLLRPIASG--DDNQVTVLHPEPLFVIKSKIVN-IDNRPKKLLKLEAGSKIFVNLCHD 57

Query: 55  DQVPQPEIPFNPSVVYPLIMTNQWEIPIIASALRQDRDKKGDLCYVCDCCINSACMQWAR 114
            Q P+PEIPF+P++VYPLI+ N+WEIPI+AS++R D DKKG +CYV DCC+ S C++W  
Sbjct: 58  PQAPKPEIPFDPNIVYPLIINNKWEIPIVASSIRTDTDKKGQVCYVIDCCVASDCVKWFV 117

Query: 115 TELQLREILVEWCLESCELRQRIEISREHLAFPKLRMKGASILPLEVLTTDLHA-DFRHE 173
            + QL+EI+VEWCLE+ ELR+ IEISR+ ++FPK+R KG SI  LE+ + +L   D +  
Sbjct: 118 EDYQLKEIVVEWCLEAAELREVIEISRDKISFPKMRKKGDSIPDLEIFSNELDGSDIKEA 177

Query: 174 MRDLAKREAEPASILELKRELIDADLD-----STSIDSSALPPLFP--SKTPTRLLIQEI 226
            ++   +  +P+S+L+++R+L+  + D      + I +  LPPLFP  ++T  R LIQEI
Sbjct: 178 TQN--DKGNDPSSLLQIRRDLLSQEEDLSLSNDSDITAHGLPPLFPKANETKGRSLIQEI 235

Query: 227 DSTSTSSQAPAKTVSTTPPTTDPAFDISMGKPSAQNSQAKLRIDI-VSLLPAESDYLISY 285
           D   T  + P           +  +++ M K   +N + KLR+DI +  +  +SD  I Y
Sbjct: 236 DDL-TLKEKPKNAAKKVQKNIE--YNVVMKK--IENHKYKLRLDIQIDSITGKSDLNIFY 290

Query: 286 NSNENTLTISHTNTTHFLPKEITIALPHV 314
           +   N + + + NT  +  K+  I LP++
Sbjct: 291 DPTNNDIVLRNLNTDLYDQKDFKIPLPNI 319

>Scas_690.37
          Length = 332

 Score =  229 bits (583), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 133/320 (41%), Positives = 185/320 (57%), Gaps = 27/320 (8%)

Query: 3   FLLRAIDNGNNDADSVVRVEPQPGFVVKSKLVSSYDGRYSLGAKVFVNVCHEDQVPQPEI 62
           FL+R I       D ++ + P P FV+KSKL  +        +K+F+NVC +  VP P I
Sbjct: 8   FLIRPISTAQ---DPIITIHPTPKFVIKSKLTPT-------NSKLFINVCQDANVPSPSI 57

Query: 63  PFNPSVVYPLIMTNQWEIPIIASALRQDRDKKGDLCYVCDCCINSACMQWARTELQLREI 122
           PF P+VVYPLIM ++WEIPI+ S +RQD DKKG  C+VCDC IN  CMQW   +LQLREI
Sbjct: 58  PFQPNVVYPLIMRDEWEIPILTSPMRQDTDKKGSPCHVCDCIINDQCMQWIAKDLQLREI 117

Query: 123 LVEWCLESCELRQRIEISREHLAFPKLRMKGASILP-LEVLTTDLHADFRHEMRDLAKRE 181
           L+EWCLE+ ELR+ + + R+ +  PKL  KG+  LP LE+   +L  DF+ ++  + +  
Sbjct: 118 LIEWCLEAVELREAVTVDRDAVKLPKLTCKGSLPLPVLEIPKRELERDFKRDIASIIEEN 177

Query: 182 A--EPASILELKRELIDADLDSTSIDSSALPPLFP-SKTPTRLLIQEI----DSTSTSSQ 234
              EP  +L+LKR   D D D T      LPPLFP S      LI+EI    D    + Q
Sbjct: 178 TVDEPVKVLQLKRTQND-DPDDT------LPPLFPQSGNVQGPLIEEIDVDMDDLKITKQ 230

Query: 235 APAKTVSTTPPTTDPAFDISMGKPSAQNSQAKLRIDIVSLLPAESDYLISYNSNENTLTI 294
            P  +  T+P   D  F+  M K +    + KLRIDI S + +  D  ++Y+   N L +
Sbjct: 231 EPTSS-RTSPLLKDLHFETVMRK-TNNTQRYKLRIDITSEIDSSLDLHLAYDRTNNELIL 288

Query: 295 SHTNTTHFLPKEITIALPHV 314
            + NT  F+ K+I I LP++
Sbjct: 289 QNLNTVEFIEKKIKIPLPNI 308

>YHR034C (YHR034C) [2321] chr8 complement(176957..177991) Protein of
           unknown function, has low similarity to uncharacterized
           C. albicans Orf6.8994p [1035 bp, 344 aa]
          Length = 344

 Score =  207 bits (526), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 130/328 (39%), Positives = 188/328 (57%), Gaps = 28/328 (8%)

Query: 3   FLLRAIDNGNNDAD----------SVVRVEPQPGFVVKSKLVSSYDGRYSL--GAKVFVN 50
           FLLR I   + + D          SV ++EP   FV+K+KL+S+ +G   L  G KVF+N
Sbjct: 4   FLLRPIKQRHRNEDKYVSVDAADGSVSKIEPIADFVIKTKLLSA-NGPEKLQDGRKVFIN 62

Query: 51  VCHEDQVPQPEIPFNPSVVYPLIMTNQWEIPIIASALRQDRDKKGDLCYVCDCCINSACM 110
           VCH   VP+PE+ FN  +V+PLI+ N+WEIPII S  R D DKKG  CYV DCCINS C 
Sbjct: 63  VCHSPLVPKPEVDFNARIVFPLIIQNEWEIPIITSCYRMDHDKKGQECYVWDCCINSDCS 122

Query: 111 QWARTELQLREILVEWCLESCELRQRIEISREHLAFPKLRMKGASILPLEVLTTDLHADF 170
           +W   ++QLREILVEWCLESCE+R  + + R+ +AFPK++ KGA +  LEVL  +LH D+
Sbjct: 123 RWICDDIQLREILVEWCLESCEIRDSVVLCRDRIAFPKMKKKGAELPALEVLNDELHQDY 182

Query: 171 RHEMRDLAKREA-EPASILELKRELIDADLDSTSIDSSALPPLFPSKTP-TRLLIQEIDS 228
           + +M  + + EA +P SIL  + +  D    +   D   LPPLFP +   +   I+EID 
Sbjct: 183 KAKMHKIIEEEAGDPMSILRGRNDDGDD---NNDPDDGTLPPLFPIENKISGAKIEEIDK 239

Query: 229 TSTSSQAPAKTVSTTPPTTD-----PAFDISMGKPSAQNSQAKLRIDIVSLLPAES--DY 281
              + +   +  +  P   +     P +++ M +   + +  KLRI I +  P      +
Sbjct: 240 NEIAHRNLKQAPAPAPAPHEQQEDVPEYEVKMKR--FKGAAYKLRILIENKAPNSKPDRF 297

Query: 282 LISYNSNENTLTISHTNTTHFLPKEITI 309
             SYN  EN L I+   +   LP++I +
Sbjct: 298 SPSYNFAENILYINGKLSIP-LPRDIVV 324

>AFR634W [3826] [Homologous to ScYNL253W - SH]
           complement(1593772..1595244) [1473 bp, 490 aa]
          Length = 490

 Score = 35.4 bits (80), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 38/79 (48%), Gaps = 16/79 (20%)

Query: 238 KTVSTTPPT-------TDPAFDISMGKPSAQNSQAKLRIDIVSLLPAESDYLISYNSNEN 290
           KTV + P         +D  F +++G   +   Q+K      SLL  E+ Y IS+NSN N
Sbjct: 304 KTVHSEPEGVVESVSISDDGFVLAVGSRMSSREQSKF--SFRSLLGQENMYEISFNSNAN 361

Query: 291 TLTISHTNTTHFLPKEITI 309
           +L        HF+P+ + +
Sbjct: 362 SL-------VHFIPETMKV 373

>CAGL0J01573g complement(149600..150064) some similarities with
           sp|P53115 Saccharomyces cerevisiae YGL150c INO80,
           hypothetical start
          Length = 154

 Score = 30.4 bits (67), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 44/100 (44%), Gaps = 7/100 (7%)

Query: 122 ILVEWCLESCELRQRIEISREH----LAFPKLRMKGASILPLEVLTTDLHADFRHEMRDL 177
           I +++CL  C    RI I  E     L    L     +   L++ TTD H    H     
Sbjct: 52  IRLQYCLCRCRC-GRICIVEEQRSLKLKHLVLETHACTSQTLKLTTTDRHKACNHTEPCA 110

Query: 178 AKREAEPASILELKRELIDADLDST-SIDSSALPPLFPSK 216
             R  +P   L+ KR+ ++  L+ST  I + + P LFP +
Sbjct: 111 ENRGCDPEQTLQKKRK-VELQLNSTQQIITQSYPILFPPR 149

>Kwal_47.17792
          Length = 471

 Score = 29.6 bits (65), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 20/34 (58%)

Query: 274 LLPAESDYLISYNSNENTLTISHTNTTHFLPKEI 307
           +LP  S  LI +  N   +T+S +N  H LP+E+
Sbjct: 386 ILPIVSAPLIYFTCNSKIMTVSESNEAHGLPQEV 419

>Scas_694.21
          Length = 313

 Score = 29.6 bits (65), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 18/73 (24%), Positives = 31/73 (42%), Gaps = 13/73 (17%)

Query: 40  RYSLGAKVF--VNVCHEDQVPQPEIPFNPSVVYPLIMTNQWEIPIIASALRQDRDKKGDL 97
           +Y LG + F  +N+C +           P V+ P   T +W + +I   +R     K  +
Sbjct: 63  QYILGTQPFGLLNICCK-----------PKVLIPRWETEEWAMDLIRGIIRAAMQTKKPI 111

Query: 98  CYVCDCCINSACM 110
             + D C  S C+
Sbjct: 112 LTIWDLCTGSGCI 124

>Sklu_2066.2 YJL128C, Contig c2066 5081-7000
          Length = 639

 Score = 29.6 bits (65), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 25/48 (52%)

Query: 198 DLDSTSIDSSALPPLFPSKTPTRLLIQEIDSTSTSSQAPAKTVSTTPP 245
           +  ST  + +  P +   ++    L+  I +TSTSS   A TV TTPP
Sbjct: 229 EFASTPSNKAQTPSIQGKRSNPGSLVNGIQTTSTSSNKQADTVGTTPP 276

>KLLA0E19943g 1766853..1768631 weakly similar to sp|P34217
           Saccharomyces cerevisiae YBL051c singleton, hypothetical
           start
          Length = 592

 Score = 28.9 bits (63), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 41/94 (43%), Gaps = 2/94 (2%)

Query: 189 ELKRELIDADLDSTSIDSSALPPLFPSKTPTRLLIQEIDS-TSTSSQAPAK-TVSTTPPT 246
           E  R + +  L S     S+ PP  PS        Q  +S  +  S AP   ++ T PP+
Sbjct: 137 EQHRSMSNISLQSLGATPSSAPPGGPSMASNNSSSQLFNSFMNADSAAPGSVSMGTVPPS 196

Query: 247 TDPAFDISMGKPSAQNSQAKLRIDIVSLLPAESD 280
             P+      + SAQN+ A + +  +  LP  S+
Sbjct: 197 PQPSIHHHHSQLSAQNTAASMSMLSMQGLPQMSE 230

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.131    0.383 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 11,014,010
Number of extensions: 475056
Number of successful extensions: 2214
Number of sequences better than 10.0: 86
Number of HSP's gapped: 2193
Number of HSP's successfully gapped: 110
Length of query: 333
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 231
Effective length of database: 13,065,073
Effective search space: 3018031863
Effective search space used: 3018031863
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 62 (28.5 bits)