Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_47.1817857156325720.0
KLLA0C10340g54152012221e-163
AAL063C53547710851e-142
Scas_688.116334566674e-79
AEL099W6674516564e-77
KLLA0F21802g6105456506e-77
CAGL0J00495g6654566266e-73
CAGL0M01078g6954546224e-72
Kwal_23.55866074586166e-72
AER234W6144626167e-72
Kwal_56.230524854656024e-71
KLLA0A06952g7164646164e-71
YDR338C6954575999e-69
Scas_373.16944435874e-67
YHR032W5813715701e-65
KLLA0F04279g4834395343e-61
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_47.18178
         (563 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_47.18178                                                         995   0.0  
KLLA0C10340g 886390..888015 weakly similar to sp|Q05497 Saccharo...   475   e-163
AAL063C [124] [Homologous to ScYHR032W - SH] (236488..238095) [1...   422   e-142
Scas_688.11                                                           261   4e-79
AEL099W [2407] [Homologous to ScYDR338C - SH] complement(439214....   257   4e-77
KLLA0F21802g 2029687..2031519 similar to sp|P38767 Saccharomyces...   254   6e-77
CAGL0J00495g complement(40807..42804) similar to sp|P38767 Sacch...   245   6e-73
CAGL0M01078g 118018..120105 highly similar to sp|Q05497 Saccharo...   244   4e-72
Kwal_23.5586                                                          241   6e-72
AER234W [2736] [Homologous to ScYHR032W - SH] complement(1071224...   241   7e-72
Kwal_56.23052                                                         236   4e-71
KLLA0A06952g complement(628173..630323) similar to sp|Q05497 Sac...   241   4e-71
YDR338C (YDR338C) [1167] chr4 complement(1147369..1149456) Membe...   235   9e-69
Scas_373.1                                                            230   4e-67
YHR032W (YHR032W) [2319] chr8 (173336..175081) Member of the mul...   224   1e-65
KLLA0F04279g 407511..408962 similar to ca|CA6037|CaERC4 Candida ...   210   3e-61

>Kwal_47.18178
          Length = 571

 Score =  995 bits (2572), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 504/563 (89%), Positives = 504/563 (89%)

Query: 1   MVTSDDRNNQESAPLLAASTLVSSTNXXXXXXXSGYVSDGRSVASDDVRSNRFRLLSPDF 60
           MVTSDDRNNQESAPLLAASTLVSSTN       SGYVSDGRSVASDDVRSNRFRLLSPDF
Sbjct: 1   MVTSDDRNNQESAPLLAASTLVSSTNPAAAPAASGYVSDGRSVASDDVRSNRFRLLSPDF 60

Query: 61  SHDCNHCLEYLVSPDDDTDDLEQCARCGARCDPPAPPGATAREARAILSAALPLTTTFFL 120
           SHDCNHCLEYLVSPDDDTDDLEQCARCGARCDPPAPPGATAREARAILSAALPLTTTFFL
Sbjct: 61  SHDCNHCLEYLVSPDDDTDDLEQCARCGARCDPPAPPGATAREARAILSAALPLTTTFFL 120

Query: 121 EYALLVSSLFIIGHFGSADHXXXXXXXXMTYNITGLAVIEGMATSLDTFCAQAYGARRYA 180
           EYALLVSSLFIIGHFGSADH        MTYNITGLAVIEGMATSLDTFCAQAYGARRYA
Sbjct: 121 EYALLVSSLFIIGHFGSADHLASASLAAMTYNITGLAVIEGMATSLDTFCAQAYGARRYA 180

Query: 181 KVGLYFWRCTLMIAVAVVPITVLWWTAASWLAVLVPQPALLQDVQLFLRVASAGLPGLVL 240
           KVGLYFWRCTLMIAVAVVPITVLWWTAASWLAVLVPQPALLQDVQLFLRVASAGLPGLVL
Sbjct: 181 KVGLYFWRCTLMIAVAVVPITVLWWTAASWLAVLVPQPALLQDVQLFLRVASAGLPGLVL 240

Query: 241 FETGKRYVQAQGCYEAGTWVLALAVPVNVGLCVALVRQIGFIGAPLALAATHWALAVLLG 300
           FETGKRYVQAQGCYEAGTWVLALAVPVNVGLCVALVRQIGFIGAPLALAATHWALAVLLG
Sbjct: 241 FETGKRYVQAQGCYEAGTWVLALAVPVNVGLCVALVRQIGFIGAPLALAATHWALAVLLG 300

Query: 301 AYCIYWEPRTLQCSYPVWASRRHLKRALTHWGGMWSLAFPGLVMIESEYLSFEVLTLMST 360
           AYCIYWEPRTLQCSYPVWASRRHLKRALTHWGGMWSLAFPGLVMIESEYLSFEVLTLMST
Sbjct: 301 AYCIYWEPRTLQCSYPVWASRRHLKRALTHWGGMWSLAFPGLVMIESEYLSFEVLTLMST 360

Query: 361 RFGVEAIAAQSVVANAGSLIYQVPFAMGCVVSTXXXXXXXXXXXXXXXXTVRAGYWVAAX 420
           RFGVEAIAAQSVVANAGSLIYQVPFAMGCVVST                TVRAGYWVAA 
Sbjct: 361 RFGVEAIAAQSVVANAGSLIYQVPFAMGCVVSTRVGGRVGRGELAGARRTVRAGYWVAAV 420

Query: 421 XXXXXXXXXXXXRGAVARLFTQDAGVIALAERLVPILAVNQVADAVATFGAXXXXXXXXX 480
                       RGAVARLFTQDAGVIALAERLVPILAVNQVADAVATFGA         
Sbjct: 421 VGTVNCVLLVVGRGAVARLFTQDAGVIALAERLVPILAVNQVADAVATFGAAVLRGQGRQ 480

Query: 481 XXXXXXNVVAYYAVGLPVSGWLAFGPLQMGLAGLWVGCGAGIVVLAVAASVWVRKSDWRE 540
                 NVVAYYAVGLPVSGWLAFGPLQMGLAGLWVGCGAGIVVLAVAASVWVRKSDWRE
Sbjct: 481 RVGGALNVVAYYAVGLPVSGWLAFGPLQMGLAGLWVGCGAGIVVLAVAASVWVRKSDWRE 540

Query: 541 IRRAFLARESMEGEDLLTPSESE 563
           IRRAFLARESMEGEDLLTPSESE
Sbjct: 541 IRRAFLARESMEGEDLLTPSESE 563

>KLLA0C10340g 886390..888015 weakly similar to sp|Q05497
           Saccharomyces cerevisiae YDR338c, start by similarity
          Length = 541

 Score =  475 bits (1222), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 242/520 (46%), Positives = 317/520 (60%), Gaps = 21/520 (4%)

Query: 36  YVSDGRSVASDDVRSNRFRLLSPDFSHDCNHCLEYLVSPDDDTDDLEQCARCGARCDPPA 95
           Y SDG S +S D   NR+RL+SPD   D     +++   +D  +DL              
Sbjct: 26  YESDGESASSGDAIDNRYRLMSPDADRD-----DFI--DEDFIEDL-------------T 65

Query: 96  PPGATAREARAILSAALPLTTTFFLEYALLVSSLFIIGHF-GSADHXXXXXXXXMTYNIT 154
            P ++  E   ILS +  +T TF +EY+L + SLF+IGH   S+D         MTYNIT
Sbjct: 66  APTSSRNEVSYILSNSALITLTFLMEYSLAIISLFVIGHVCKSSDALASASLAVMTYNIT 125

Query: 155 GLAVIEGMATSLDTFCAQAYGARRYAKVGLYFWRCTLMIAVAVVPITVLWWTAASWLAVL 214
           GLA +EGMATSLDTFC+QAYGA++YAKVGLY +RC  MI   + P+ + WW +ASWL  +
Sbjct: 126 GLAFVEGMATSLDTFCSQAYGAKKYAKVGLYSFRCAAMIMTGIFPVIISWWFSASWLGYV 185

Query: 215 VPQPALLQDVQLFLRVASAGLPGLVLFETGKRYVQAQGCYEAGTWVLALAVPVNVGLCVA 274
           + +  +L ++QLFLR+ S GLPGL+ FETGKR++Q+QG ++AGT+ L + VPVN+ L  +
Sbjct: 186 IAEQDILPEIQLFLRIISFGLPGLIFFETGKRFLQSQGHFQAGTYSLLITVPVNIILVYS 245

Query: 275 LVRQIGFIGAPLALAATHWALAVLLGAYCIYWEPRTLQCSYPVWASRRHLKRALTHWGGM 334
             R IG+ GAPL +A +HW +A++L  YC +W   TL C YP+++S  H KR    W  M
Sbjct: 246 FTRYIGYAGAPLGIAISHWFMALMLLVYCKFWRKETLICWYPMFSSMFHFKRLFCSWKPM 305

Query: 335 WSLAFPGLVMIESEYLSFEVLTLMSTRFGVEAIAAQSVVANAGSLIYQVPFAMGCVVSTX 394
           W+LAFPGL+MIE+EYLSFEVLT+MST  GV+AIAAQSVV+N GSLIYQ+PFAMGCVVST 
Sbjct: 306 WNLAFPGLLMIEAEYLSFEVLTIMSTYLGVKAIAAQSVVSNIGSLIYQIPFAMGCVVSTR 365

Query: 395 XXXXXXXXXXXXXXXTVRAGYWVAAXXXXXXXXXXXXXRGAVARLFTQDAGVIALAERLV 454
                           +   Y +AA                +A LFT+D  V+ L   + 
Sbjct: 366 VANYVGTESVNNAKICINTSYVIAAFVGIANCCLILTGDKNLAYLFTKDKEVVELYRHVA 425

Query: 455 PILAVNQVADAVATFGAXXXXXXXXXXXXXXXNVVAYYAVGLPVSGWLAFGPLQMGLAGL 514
           PILAVNQ+ DA  TF A               N++AYY + LP+SGWL FG  Q+GL GL
Sbjct: 426 PILAVNQLYDAFTTFSAAILRAQGRQQVGSLLNIIAYYFIALPLSGWLTFGKFQLGLKGL 485

Query: 515 WVGCGAGIVVLAVAASVWVRKSDWREIRRAFLARESMEGE 554
           W GCG GI++LA A S  V  S+W  I      RE  E E
Sbjct: 486 WYGCGTGILLLAFALSYCVFNSNWENIVEECHRREKEENE 525

>AAL063C [124] [Homologous to ScYHR032W - SH] (236488..238095) [1608
           bp, 535 aa]
          Length = 535

 Score =  422 bits (1085), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 210/477 (44%), Positives = 296/477 (62%), Gaps = 1/477 (0%)

Query: 87  CGARCDPPAPPGATAR-EARAILSAALPLTTTFFLEYALLVSSLFIIGHFGSADHXXXXX 145
           CG+  + P     T R E  +IL ++LP++  F +E+++ + SLFIIGH  +A       
Sbjct: 51  CGSDFEEPLDGAQTLRAECISILRSSLPISMAFLMEFSMTICSLFIIGHLCTAMELASAS 110

Query: 146 XXXMTYNITGLAVIEGMATSLDTFCAQAYGARRYAKVGLYFWRCTLMIAVAVVPITVLWW 205
              MTYNITGL+++EG+AT+LDT C QAYG++RY+KVGLYF R + MI V +    ++W+
Sbjct: 111 LAVMTYNITGLSLVEGLATALDTVCPQAYGSQRYSKVGLYFLRGSAMIMVGMSLTAIIWF 170

Query: 206 TAASWLAVLVPQPALLQDVQLFLRVASAGLPGLVLFETGKRYVQAQGCYEAGTWVLALAV 265
            +ASWL +L+P+  L+  +QL+LR+   G+P LVLF TGKRY+QAQ  YEA T+VLA+  
Sbjct: 171 FSASWLQLLIPEADLIPKIQLYLRIMILGIPALVLFSTGKRYLQAQAVYEASTYVLAIVF 230

Query: 266 PVNVGLCVALVRQIGFIGAPLALAATHWALAVLLGAYCIYWEPRTLQCSYPVWASRRHLK 325
           P+ +   +   R  GF+GAP+ +  + W + ++L  +     P TL+C YP   S  H K
Sbjct: 231 PLTIVFVLGFTRHFGFVGAPIGIVTSQWLMVIILFVFARSIRPDTLRCWYPFMQSSHHFK 290

Query: 326 RALTHWGGMWSLAFPGLVMIESEYLSFEVLTLMSTRFGVEAIAAQSVVANAGSLIYQVPF 385
           R  THW  +W LAFPGLVM+E+E+LS E LTL+ST FGV AIA+Q+V+AN  SLIYQ+PF
Sbjct: 291 RVFTHWRPLWDLAFPGLVMLEAEFLSIEALTLISTYFGVNAIASQTVIANLSSLIYQIPF 350

Query: 386 AMGCVVSTXXXXXXXXXXXXXXXXTVRAGYWVAAXXXXXXXXXXXXXRGAVARLFTQDAG 445
           A+GCV+S                 T++A Y +A+                +ARLFT +  
Sbjct: 351 AIGCVISNRVAHYVGSGLIKNAQMTIKASYCLASIVGVSMCLFVAFLNKPLARLFTNNEE 410

Query: 446 VIALAERLVPILAVNQVADAVATFGAXXXXXXXXXXXXXXXNVVAYYAVGLPVSGWLAFG 505
           V+ LA  +  ILAVNQ+ DA  TFGA               N++AYY V LP+  WLAFG
Sbjct: 411 VVELAHSVSYILAVNQIYDAFNTFGAAILRGQGRQRLGGIWNMIAYYIVSLPLGWWLAFG 470

Query: 506 PLQMGLAGLWVGCGAGIVVLAVAASVWVRKSDWREIRRAFLARESMEGEDLLTPSES 562
           PL++ LAGLW GCG GI++LA+A S ++  SDW+ I +    RE+ E E+ +  S+S
Sbjct: 471 PLKLKLAGLWYGCGIGILILALAFSWYIYNSDWQLIIQECNKRENTEVENDMLHSDS 527

>Scas_688.11
          Length = 633

 Score =  261 bits (667), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 146/456 (32%), Positives = 242/456 (53%), Gaps = 13/456 (2%)

Query: 102 REARAILSAALPLTTTFFLEYALLVSSLFIIGHFGSADHXXXXXXXXMTYNITGLAVIEG 161
           RE + I   ALPL  TF L+ +L ++S+F + H G+ +         MT NITGLA I+G
Sbjct: 179 RECKVIAVNALPLIFTFILQNSLSLASIFSVSHLGTKE-LGGVTLGSMTANITGLAAIQG 237

Query: 162 MATSLDTFCAQAYGARRYAKVGLYFWRCTLMIAVAVVPITVLWWT-AASWLAVLVPQPAL 220
           + T LDT C+QAYGA+ Y  VG+   RC ++  +A +P+  +WW+ + + L+ ++P+  L
Sbjct: 238 LCTCLDTLCSQAYGAKNYRLVGVLIQRCAVITILAFLPVMYIWWSWSETILSWMIPEKEL 297

Query: 221 LQDVQLFLRVASAGLPGLVLFETGKRYVQAQGCYEAGTWVLALAVPVNVGLCVALVRQ-- 278
            +    +LR+ + G+PG ++FE GKR++Q QG + A T VL +  P+N  +   LV    
Sbjct: 298 CKLAANYLRITAFGVPGFIIFECGKRFLQCQGIFHASTIVLFICAPLNALMNYILVWDKT 357

Query: 279 --IGFIGAPLALAATHWALAVLLGAYCI--YWEPRTLQCSYPVWASRRHLKRALTHWGGM 334
             IG++GAPL++A  +W +A+ L  Y +    E R ++C    W       +   +W  M
Sbjct: 358 IGIGYLGAPLSVAINYWLMALGLMVYAVTTQHEARPMKC----WNGIIKKTQVFKNWRKM 413

Query: 335 WSLAFPGLVMIESEYLSFEVLTLMSTRFGVEAIAAQSVVANAGSLIYQVPFAMGCVVSTX 394
           ++LA PG++M+E+E+L FE+LT+ ++  G   +AAQS+VA   SL YQVPF++    ST 
Sbjct: 414 FNLALPGIIMVEAEFLGFEILTIFASHLGTAPLAAQSIVATVASLAYQVPFSISVSTSTR 473

Query: 395 XXXXXXXXXXXXXXXTVRAGYWVAAXXXXXXXXXXXXXRGAVARLFTQDAGVIALAERLV 454
                          T      ++              +  +A++F+ ++ V+ L    +
Sbjct: 474 VANFIGASLYRSCIKTCTMALLLSFVCSSMNMVIIFECKDRIAKMFSNESDVVNLVISTL 533

Query: 455 PILAVNQVADAVATFGAXXXXXXXXXXXXXXXNVVAYYAVGLPVSGWLAFGPLQMGLAGL 514
           PILA  Q+ DA     A               N+ A+Y VG+P++  L F   +MG++GL
Sbjct: 534 PILACMQLFDAFNASTAGCLRGQGRQKIGGYINLFAFYCVGIPMAYMLTFN-FKMGISGL 592

Query: 515 WVGCGAGIVVLAVAASVWVRKSDWREIRRAFLARES 550
           W G    ++++++     V   DW++I  A   R +
Sbjct: 593 WYGITCALIMMSICQGYAVFHCDWKQIINAAKNRNA 628

>AEL099W [2407] [Homologous to ScYDR338C - SH]
           complement(439214..441217) [2004 bp, 667 aa]
          Length = 667

 Score =  257 bits (656), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 154/451 (34%), Positives = 228/451 (50%), Gaps = 15/451 (3%)

Query: 92  DPPAPPGATAREARAILSAALPLTTTFFLEYALLVSSLFIIGHFGSADHXXXXXXXXMTY 151
           D    P     E+  +L  ++PL  TF LE    V    ++GH G  +         MT 
Sbjct: 199 DLDDEPATVKSESLVLLCYSVPLIFTFLLEQMFPVVCALVVGHLGK-NELAAVSLASMTT 257

Query: 152 NITGLAVIEGMATSLDTFCAQAYGARRYAKVGLYFWRCTLMIAVAVVPITVLWWTAASWL 211
           NIT  A+ EG++TSLDT C QAYGAR Y  VGL+  RC L      VP   L+W +   L
Sbjct: 258 NIT-FAIFEGISTSLDTLCPQAYGARNYYGVGLHMQRCVLFSLAFFVPFAALFWFSEGIL 316

Query: 212 AVLVPQPALLQDVQLFLRVASAGLPGLVLFETGKRYVQAQGCYEAGTWVLALAVPVNVGL 271
             L+ + +L+     FLRV   G PG +LFE  KRY+QAQG ++AG +VL +  P+N+ +
Sbjct: 317 PYLIKEKSLVPLTSQFLRVMIVGGPGFILFENLKRYLQAQGIFDAGIYVLLICCPLNIVM 376

Query: 272 CVALVRQ----IGFIGAPLALAATHWALAVLLGAYCIYWEPRTLQCSYPVWASRRHLKRA 327
              LV      +GFIGAP+A+A   W + +LL  YCIY+     +C    W      ++A
Sbjct: 377 SYLLVWNPVIGLGFIGAPIAVALNFWCMFLLLLLYCIYFNGS--KC----WGGLS--RKA 428

Query: 328 LTHWGGMWSLAFPGLVMIESEYLSFEVLTLMSTRFGVEAIAAQSVVANAGSLIYQVPFAM 387
             HW  +  LA PG++M+E+E +S E+LTL S+  G E +AAQS V+   +++Y +P+A+
Sbjct: 429 FDHWKDLSKLAVPGIIMLEAEDMSSEILTLFSSYLGTEYLAAQSAVSTTVAMLYMIPYAV 488

Query: 388 GCVVSTXXXXXXXXXXXXXXXXTVRAGYWVAAXXXXXXXXXXXXXRGAVARLFTQDAGVI 447
           G  VST                  R G   +A             R  + R+++ DA VI
Sbjct: 489 GISVSTRIAQYIGARNPDNARLASRVGIASSAVVGIVNCTMLILGRDLIPRIYSSDAEVI 548

Query: 448 ALAERLVPILAVNQVADAVATFGAXXXXXXXXXXXXXXXNVVAYYAVGLPVSGWLAFGPL 507
            L   ++P+L + ++ DA+                    N+V YY   +P+ G L     
Sbjct: 549 RLMREILPLLGLVEIFDALNAIAGSCLRGQGMQYVGSVVNLVVYYLFAIPL-GMLLSWTF 607

Query: 508 QMGLAGLWVGCGAGIVVLAVAASVWVRKSDW 538
            M L+GLWVG G+G++V+ +    +V  +DW
Sbjct: 608 DMKLSGLWVGIGSGMLVIGLIEGYYVLFADW 638

>KLLA0F21802g 2029687..2031519 similar to sp|P38767 Saccharomyces
           cerevisiae YHR032w ERC1 ethionine resistance protein,
           start by similarity
          Length = 610

 Score =  254 bits (650), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 168/545 (30%), Positives = 261/545 (47%), Gaps = 37/545 (6%)

Query: 36  YVSDGRSVASDD-----------VRSNRFRLLSPDFSHDCNHCLEYL-----------VS 73
           Y S GR+ +SD            +R  R  LL  +  ++ NH L               +
Sbjct: 68  YGSTGRTGSSDSSEIHSALPKNLIREER-DLLMDNKLYNSNHALHNHAAYSTNDPNSSFA 126

Query: 74  PDDDTDDLEQCARCGARCDPPAPPGAT-AREARAILSAALPLTTTFFLEYALLVSSLFII 132
           P    +D E         +       T  REA  I S A PL  TF L+ +L ++S+F +
Sbjct: 127 PTSSIEDQEVIETWEDAIESGKDINTTFKREAIVITSNASPLVLTFILQNSLSLASIFSV 186

Query: 133 GHFGSADHXXXXXXXXMTYNITGLAVIEGMATSLDTFCAQAYGARRYAKVGLYFWRCTLM 192
            H GS +         MT +ITG A I+G+ T LDT CAQAYG   Y  VG+ F RC ++
Sbjct: 187 SHLGS-NELGAVTLGSMTASITGFAAIQGLCTCLDTLCAQAYGGNHYHLVGVLFQRCAII 245

Query: 193 IAVAVVPITVLWWT-AASWLAVLVPQPALLQDVQLFLRVASAGLPGLVLFETGKRYVQAQ 251
             +  +P+   WW  +   LA+ +P+  L      +L++ S G+P  +LFE GKR++Q Q
Sbjct: 246 TIILSLPVLFTWWQWSEQILALFIPERELCALAAKYLQIVSLGIPAFILFECGKRFLQCQ 305

Query: 252 GCYEAGTWVLALAVPVNVGLCVALVRQ----IGFIGAPLALAATHWALAVLLGAYCIYW- 306
           G + A + VL +  P+N  +   LV      IG++GAP+++   +W +A+ L AY +Y  
Sbjct: 306 GIFHASSIVLLVCAPLNALMNYVLVWDKNIGIGYLGAPISVVLNYWLMALGLFAYTLYTK 365

Query: 307 -EPRTLQCSYPVWASRRHLKRALTHWGGMWSLAFPGLVMIESEYLSFEVLTLMSTRFGVE 365
            E   ++C    W       + L +   M++LA PG++M+E+E+L FE+LT+ ++  G  
Sbjct: 366 NEKNPMKC----WNGFIKPHQILKNSRKMFNLALPGIIMVEAEFLGFEILTIFASHLGTH 421

Query: 366 AIAAQSVVANAGSLIYQVPFAMGCVVSTXXXXXXXXXXXXXXXXTVRAGYWVAAXXXXXX 425
            +AAQS+++   SL YQVPF++    ST                T +    ++       
Sbjct: 422 ELAAQSIISTIASLAYQVPFSISISTSTRVANFIGASLYRSCVITCKVSLLLSFIISSLN 481

Query: 426 XXXXXXXRGAVARLFTQDAGVIALAERLVPILAVNQVADAVATFGAXXXXXXXXXXXXXX 485
                  R  +ARLF+ +  V+ L    +PILA  Q+ DA     A              
Sbjct: 482 MAMIYKARYLIARLFSSEPDVVRLVSSSLPILAFMQIFDAFNASTAGCLRGQGQQKIGGY 541

Query: 486 XNVVAYYAVGLPVSGWLAFGPLQMGLAGLWVGCGAGIVVLAVAASVWVRKSDWREIRRAF 545
            NV A+Y +G+PVS  L F     G++GLW G  +G+V +++  S  V   +W +I RA 
Sbjct: 542 INVFAFYCIGIPVSYLLTF-HYGFGVSGLWWGITSGLVFMSIFQSYAVFHCNWNDIIRAA 600

Query: 546 LARES 550
            +R S
Sbjct: 601 KSRNS 605

>CAGL0J00495g complement(40807..42804) similar to sp|P38767
           Saccharomyces cerevisiae YHR032w ERC1 ethionine
           resistance protein, start by similarity
          Length = 665

 Score =  245 bits (626), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 145/456 (31%), Positives = 234/456 (51%), Gaps = 13/456 (2%)

Query: 102 REARAILSAALPLTTTFFLEYALLVSSLFIIGHFGSADHXXXXXXXXMTYNITGLAVIEG 161
           RE + I   A PL  TF L+ +L ++S+F + H G+ +         MT NIT LA I+G
Sbjct: 211 REIQVISVNAFPLVFTFILQNSLSLASIFSVSHLGTKE-LGGVTLGSMTANITCLAAIQG 269

Query: 162 MATSLDTFCAQAYGARRYAKVGLYFWRCTLMIAVAVVPITVLWWT-AASWLAVLVPQPAL 220
           + T LDT C+QAYGAR    VG+   RC ++  +A +P+  +W+  +   LA ++P+  L
Sbjct: 270 LCTCLDTLCSQAYGARNNHLVGVLVQRCAIITCLAFLPVMYIWFFWSDRILASMIPEKEL 329

Query: 221 LQDVQLFLRVASAGLPGLVLFETGKRYVQAQGCYEAGTWVLALAVPVNVGLCVALVRQ-- 278
                 +L++ + G+PG + FE GKR++Q QG + A T VL +  P+N  L   LV    
Sbjct: 330 CSLAASYLKITAIGVPGFIFFECGKRFLQCQGIFHASTIVLVICAPLNAILNYILVWDKN 389

Query: 279 --IGFIGAPLALAATHWALAVLLGAYCIYWE--PRTLQCSYPVWASRRHLKRALTHWGGM 334
             IG++GAP ++A ++WA+A+ L AY +  +     ++C    W       +   +W  M
Sbjct: 390 IGIGYLGAPTSVAISYWAMALGLLAYTVLTKHPANPMKC----WNGVIKPNQLFRNWKKM 445

Query: 335 WSLAFPGLVMIESEYLSFEVLTLMSTRFGVEAIAAQSVVANAGSLIYQVPFAMGCVVSTX 394
           ++LA PG++M+E+E+L FE+LT+ ++R G   + AQS+VA   SL YQVPF++    ST 
Sbjct: 446 FNLALPGIIMVEAEFLGFEILTVFASRIGTAPLGAQSIVATVASLAYQVPFSISVSTSTR 505

Query: 395 XXXXXXXXXXXXXXXTVRAGYWVAAXXXXXXXXXXXXXRGAVARLFTQDAGVIALAERLV 454
                          T +    ++              +  +A LF+ +  V++L    +
Sbjct: 506 VANFIGASLYKSCIITCKVSLLLSFACSSLNMLIIFTFKKQIAGLFSSEEDVVSLVVSTL 565

Query: 455 PILAVNQVADAVATFGAXXXXXXXXXXXXXXXNVVAYYAVGLPVSGWLAFGPLQMGLAGL 514
           PILA  Q+ DA     A               N+ A+Y +G+P++  LAF     G+ GL
Sbjct: 566 PILAFMQLFDAFNASTAGCLRGQGRQKIGGYINLFAFYCIGIPMAYCLAF-VFNTGVGGL 624

Query: 515 WVGCGAGIVVLAVAASVWVRKSDWREIRRAFLARES 550
           W G    +V++++     V   DW++I  A   R S
Sbjct: 625 WYGITCALVMMSICQGYAVFHCDWKQIIEAAKVRNS 660

>CAGL0M01078g 118018..120105 highly similar to sp|Q05497
           Saccharomyces cerevisiae YDR338c, start by similarity
          Length = 695

 Score =  244 bits (622), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 153/454 (33%), Positives = 227/454 (50%), Gaps = 22/454 (4%)

Query: 96  PPGATAREARAILSA-ALPLTTTFFLEYALLVSSLFIIGHFGSADHXXXXXXXXMTYNIT 154
           P   T RE   +LS+ + PL  TF LE    +     +GH G  +         MT NIT
Sbjct: 218 PEKITFREEAKVLSSFSFPLIFTFLLEQIFPMVCSLTVGHLGK-NQLAAVSLASMTSNIT 276

Query: 155 GLAVIEGMATSLDTFCAQAYGARRYAKVGLYFWRCTLMIAVAVVPITVLWWTAASWLAVL 214
            LAV EG+ATSLDT C QAYGA RY  VG++F RC L   +  +P  + W+ +   L ++
Sbjct: 277 -LAVFEGIATSLDTLCPQAYGAGRYYSVGIHFQRCVLFSFIIFLPFALFWFFSEPILFLV 335

Query: 215 VPQPALLQDVQLFLRVASAGLPGLVLFETGKRYVQAQGCYEAGTWVLALAVPVNVGLCVA 274
           VP+  L+     FLRV   G P  +LFE  KR++QAQG ++AG +VL +  P+N+ +   
Sbjct: 336 VPEKELIALTSQFLRVLIFGAPAYILFENLKRFLQAQGIFDAGIYVLTICAPLNIFVSYT 395

Query: 275 LVRQ----IGFIGAPLALAATHWALAVLLGAYCIYWEPRTLQCSYPVWASRRHLKRALTH 330
           LV      IGFIG+ +A+    W + +LL  Y IY + +  +C    W      K+A TH
Sbjct: 396 LVWNKYIGIGFIGSAVAVVINFWLMFILLLLYTIYIDGK--KC----WGGFS--KKAFTH 447

Query: 331 WGGMWSLAFPGLVMIESEYLSFEVLTLMSTRFGVEAIAAQSVVANAGSLIYQVPFAMGCV 390
           W  +  LAF G++M+E+E LS+E+LTL S  FG   +AAQS V+   +L+Y VPFA+G  
Sbjct: 448 WKDLGHLAFSGIIMLEAEELSYEILTLFSAYFGTSYLAAQSAVSTMAALLYMVPFAIGIS 507

Query: 391 VSTXXXXXXXXXXXXXXXXTVRAGYWVAAXXXXXXXXXXXXXRGAVARLFTQDAGVIALA 450
            ST                    G   +              R  +A +F++D  VI L 
Sbjct: 508 ASTRIANFIGAKRVDLAHNASEVGLVFSFGAGLTNCCVLFFGRNIIAHVFSRDDEVIDLM 567

Query: 451 ERLVPILAVNQVADAVATFGAXXXXXXXXXXXXXXXNVVAYYAVGLPVS---GWLAFGPL 507
             L+ ++AV Q+ D++                    N++ YY  G+P++   GW+     
Sbjct: 568 TGLLRLVAVVQIFDSLNAVAGSCLRGQGMQSLGSIVNLLGYYLFGIPLALILGWV----F 623

Query: 508 QMGLAGLWVGCGAGIVVLAVAASVWVRKSDWREI 541
            M L GLW+G G  ++++ +  +  V   +W  I
Sbjct: 624 NMKLYGLWIGIGCAMLLIGLIEAYNVLYPNWDYI 657

>Kwal_23.5586
          Length = 607

 Score =  241 bits (616), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 145/458 (31%), Positives = 238/458 (51%), Gaps = 17/458 (3%)

Query: 102 REARAILSAALPLTTTFFLEYALLVSSLFIIGHFGSADHXXXXXXXXMTYNITGLAVIEG 161
           RE + ++  A PL  TF ++ +L ++S+F     G  +         MT NITG A I+G
Sbjct: 153 RECQVLVKNAFPLVFTFVMQNSLSLASVFTTSRLGIKE-LGGITLGSMTANITGFAAIQG 211

Query: 162 MATSLDTFCAQAYGARRYAKVGLYFWRCTLMIAVAVVPITVLWWT-AASWLAVLVPQPAL 220
           + T LDT C+QAYGA+ Y  VG+   RC ++  +   PI  +WW  + + LA ++P+  L
Sbjct: 212 LCTCLDTLCSQAYGAKNYQLVGILLQRCAIITIIFFTPILFMWWFWSEAILAAVIPEREL 271

Query: 221 LQDVQLFLRVASAGLPGLVLFETGKRYVQAQGCYEAGTWVLALAVPVNVGLCVALVRQ-- 278
            +    +L++ + G+PG V FE GKR++Q QG + A T VL    P N  +   LV    
Sbjct: 272 CKLAANYLKIVALGVPGFVFFECGKRFLQCQGIFHASTIVLLFCAPFNAIMNYMLVLDKR 331

Query: 279 --IGFIGAPLALAATHWALAVLLGAYCIYWE----PRTLQCSYPVWASRRHLKRALTHWG 332
             IG+IGAP+++A  +W +A+ L  Y I+ +    PR  +C    W+      +   +W 
Sbjct: 332 FGIGYIGAPISVALNYWLMALGLLFYTIFTKHKINPR--KC----WSGTIKPNQVFKNWK 385

Query: 333 GMWSLAFPGLVMIESEYLSFEVLTLMSTRFGVEAIAAQSVVANAGSLIYQVPFAMGCVVS 392
            M+SLA PG+VM+E+E+L FE+LT+ ++  G   + AQS+V+   SL YQVPF++    S
Sbjct: 386 KMFSLALPGVVMVEAEFLGFEILTIFASHLGTSELGAQSIVSTIASLAYQVPFSISISTS 445

Query: 393 TXXXXXXXXXXXXXXXXTVRAGYWVAAXXXXXXXXXXXXXRGAVARLFTQDAGVIALAER 452
           T                T +    ++              R  +A  F++++ VI+L   
Sbjct: 446 TRVANFIGASLYRNCIATCKVSLLLSTVVSFFNMSAIYFFRVPLAHAFSKESEVISLVVN 505

Query: 453 LVPILAVNQVADAVATFGAXXXXXXXXXXXXXXXNVVAYYAVGLPVSGWLAFGPLQMGLA 512
           ++P+LA  Q+ DA     A               NV+A+Y +G+P+S +L F    +G+A
Sbjct: 506 VLPLLAFMQLFDAFNACTAGCLRGQGQQKIGGYINVLAFYCIGIPMSYFLTF-KCNLGMA 564

Query: 513 GLWVGCGAGIVVLAVAASVWVRKSDWREIRRAFLARES 550
           GLW G  + ++ +++  S  V   +++E+ +A   R S
Sbjct: 565 GLWYGITSALIFMSIFQSYAVFSCNYKEVIKAAKYRNS 602

>AER234W [2736] [Homologous to ScYHR032W - SH]
           complement(1071224..1073068) [1845 bp, 614 aa]
          Length = 614

 Score =  241 bits (616), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 155/462 (33%), Positives = 231/462 (50%), Gaps = 19/462 (4%)

Query: 102 REARAILSAALPLTTTFFLEYALLVSSLFIIGHFGSADHXXXXXXXXMTYNITGLAVIEG 161
           RE+  +   ALPL  TF L+ +L ++S+F + H G+ +         MT NITG A I+G
Sbjct: 159 RESTVLTKNALPLVATFILQNSLSLASVFSVSHLGTKE-LGGITLGSMTANITGFAAIQG 217

Query: 162 MATSLDTFCAQAYGARRYAKVGLYFWRCTLMIAVAVVPITVLWWTAASW-LAVLVPQPAL 220
           + T LDT C+QAYGAR Y  VGL   RC ++  +   P+  LW   +   L  LV  P L
Sbjct: 218 LCTCLDTLCSQAYGARNYTLVGLLLQRCCIISLLVFAPVVWLWVCYSEQVLGYLVSDPEL 277

Query: 221 LQDVQLFLRVASAGLPGLVLFETGKRYVQAQGCYEAGTWVLALAVPVNVGLCVALVRQ-- 278
                 +LR+ +AGLP  +LFE GKRY+Q Q  Y A T VL    P N  L   LV    
Sbjct: 278 CLFAAKYLRIVAAGLPAFILFECGKRYLQCQDIYHASTIVLLFCAPANAFLNYLLVWNSK 337

Query: 279 --IGFIGAPLALAATHWALAVLLGAYCIY----WEPRTLQCSYPVWASRRHLKRALTHWG 332
             IG++GAP+++   +W + + L  Y I+     +PR  +C    W       +   ++ 
Sbjct: 338 VGIGYLGAPVSVVLNYWLMVLGLLLYTIFTKSEIQPR--KC----WTGWIKPHQIFKNYD 391

Query: 333 GMWSLAFPGLVMIESEYLSFEVLTLMSTRFGVEAIAAQSVVANAGSLIYQVPFAMGCVVS 392
            M  LA PG++M+E+E+L FE+LT+ ++   V A+AAQS++A   SL YQ+PF++    S
Sbjct: 392 KMLGLALPGIIMVEAEFLGFEILTIFASHISVNALAAQSIIATIASLAYQIPFSISISTS 451

Query: 393 TXXXXXXXXXXXXXXXXTVRAGYWVAAXXXXXXXXXXXXXRGAVAR-LFTQDAGVIALAE 451
           T                T +    ++              R  +A  LF  +A VI L E
Sbjct: 452 TRVANFIGASLYRSCIITCKVSLLLSFGVSLTSMLAIFVFRSNLAHILFLNEAEVIMLIE 511

Query: 452 RLVPILAVNQVADAV-ATFGAXXXXXXXXXXXXXXXNVVAYYAVGLPVSGWLAFGPLQMG 510
             +PILAV Q+ D+  A+                  NV A+Y +G+P+S +L+F    +G
Sbjct: 512 TTLPILAVMQIFDSFNASTAGCLRGQGQQKDWWLLSNVFAFYCIGIPMSYFLSF-HCDLG 570

Query: 511 LAGLWVGCGAGIVVLAVAASVWVRKSDWREIRRAFLARESME 552
           + GLW G    ++V++V  S  V    W E+ +A   R S +
Sbjct: 571 VKGLWYGITCALIVMSVCQSYAVFNCSWEELVKAANLRTSED 612

>Kwal_56.23052
          Length = 485

 Score =  236 bits (602), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 151/465 (32%), Positives = 237/465 (50%), Gaps = 15/465 (3%)

Query: 80  DLEQCARCGARCDPPAPPGATAREARAILSAALPLTTTFFLEYALLVSSLFIIGHFGSAD 139
           D++  AR  AR D          E + I   + PL  TF L+ +L   ++  +G   + D
Sbjct: 20  DIDVTARDVARTDAKT-------EFKEISKNSGPLILTFVLQMSLSFVTVIFVGRLSAVD 72

Query: 140 HXXXXXXXXMTYNITGLAVIEGMATSLDTFCAQAYGARRYAKVGLYFWRCTLMIAVAVVP 199
                    +T+  T   + +G+AT LDT C QAYG +R+  VGLYF R   +     +P
Sbjct: 73  -LGGVSLANVTFTATS-GIFQGLATCLDTLCPQAYGGKRFKLVGLYFQRGLAISFAFAIP 130

Query: 200 ITVLWWTAASWLAVLVPQPALLQDVQLFLRVASAGLPGLVLFETGKRYVQAQGCYEAGTW 259
           I VLWW +   L ++V    L+     +LRV  A +PG V+FE GK+Y+QAQ  Y  G +
Sbjct: 131 IAVLWWYSNYVLGLVVDDLRLVDIACRYLRVMIAAIPGYVMFECGKKYLQAQNDYTTGQY 190

Query: 260 VLALAVPVNVGLCVALVRQ--IGFIGAPLALAATHWALAVLLGAYCIYWEPRTLQCSYPV 317
           +L +  P+NV L    V +  +GFIGAP+A +  +  +   L  Y I+ + R L      
Sbjct: 191 ILFVCAPLNVVLNYLFVFKFALGFIGAPIATSLIYTLMGFSLATY-IWHQNRNLS-ETNC 248

Query: 318 WASRRHLKRALTHWGGMWSLAFPGLVMIESEYLSFEVLTLMSTRFGVEAIAAQSVVANAG 377
           W+     +   ++W  M SLA PG+VM+E+E+L+FE LT++S +FG E++AAQSV+A+  
Sbjct: 249 WSPLSEWRPIFSNWMTMISLALPGIVMVEAEFLAFESLTVISAKFGTESLAAQSVIASIQ 308

Query: 378 SLIYQVPFAMGCVVSTXXXXXXXXXXXXXXXXTVRAGYW-VAAXXXXXXXXXXXXXRGAV 436
           +L ++VPF++G   S                   R     +A              R A+
Sbjct: 309 TLTFEVPFSVGVAASNRIAYYIGKGRLRDCQIATRTTLVSLACVVGIANFSTLILGRHAI 368

Query: 437 ARLFTQDAGVIALAERLVPILAVNQVADAVATFGAXXXXXXXXXXXXXXXNVVAYYAVGL 496
             +F+ D  VI +A +++PI+ +NQ+ D  +   A               N++AYY VGL
Sbjct: 369 PAIFSNDPEVIRIASQVLPIIGLNQILDVFSVLSAGVLRAQGRQRIGGILNIIAYYVVGL 428

Query: 497 PVSGWLAFGPLQMGLAGLWVGCGAGIVVLAVAASVWVRKSDWREI 541
           P++    F    +GL GLW+G G GI +L+++    V +S+W +I
Sbjct: 429 PMAVVFGF-RWNLGLRGLWMGLGCGIALLSMSLVYCVSRSNWTKI 472

>KLLA0A06952g complement(628173..630323) similar to sp|Q05497
           Saccharomyces cerevisiae YDR338c, start by similarity
          Length = 716

 Score =  241 bits (616), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 146/464 (31%), Positives = 235/464 (50%), Gaps = 17/464 (3%)

Query: 103 EARAILSAALPLTTTFFLEYALLVSSLFIIGHFGSADHXXXXXXXXMTYNITGLAVIEGM 162
           E + + S ++PL  TF LE    V     +GH G  +         MT NIT  A+ EG+
Sbjct: 239 ELKVLASYSIPLIFTFLLEQMFPVVCSLTVGHLGRTE-LAAVSLASMTTNIT-YAIFEGI 296

Query: 163 ATSLDTFCAQAYGARRYAKVGLYFWRCTLMIAVAVVPITVLWWTAASWLAVLVP-QPALL 221
           ATSLDT C  AYG+  Y  VG++  RC +      +P   +WW + + L +++P +P L+
Sbjct: 297 ATSLDTLCPLAYGSGNYYSVGVHMQRCIMFSFTVFIPFGFIWWWSETLLTLVMPHEPELI 356

Query: 222 QDVQLFLRVASAGLPGLVLFETGKRYVQAQGCYEAGTWVLALAVPVNVGLCVALVRQ--- 278
                FLRV+  G P  ++FE+ KR++QAQG ++AG +VL +  P N+ +   LV     
Sbjct: 357 HMTAKFLRVSILGAPAYIIFESLKRFLQAQGIFDAGIYVLMICAPWNMFVSYTLVWNERI 416

Query: 279 -IGFIGAPLALAATHWALAVLLGAYCIYWEPRTLQCSYPVWASRRHLKRALTHWGGMWSL 337
            +GFIGAP+A+    W +  LL  Y IY +       Y  W       ++L HW  +  L
Sbjct: 417 GMGFIGAPIAVVLNFWTMVTLLSLYAIYVD------GYKCWGGFN--SKSLKHWKALSEL 468

Query: 338 AFPGLVMIESEYLSFEVLTLMSTRFGVEAIAAQSVVANAGSLIYQVPFAMGCVVSTXXXX 397
           A PG+VM+E+E LS+E+LTL S+ FG   +AAQS V+   +L+Y +PF++G   ST    
Sbjct: 469 AVPGIVMLEAEDLSYEILTLFSSYFGTPYLAAQSAVSTTAALLYMIPFSVGISSSTRIGN 528

Query: 398 XXXXXXXXXXXXTVRAGYWVAAXXXXXXXXXXXXXRGAVARLFTQDAGVIALAERLVPIL 457
                       +   G   +              + ++A ++T+D  VI L  +L+P++
Sbjct: 529 FIGCRRPNCAKLSAELGIGSSLFVGLLNCLIINVDKRSIANIYTKDEEVIQLMCQLLPLV 588

Query: 458 AVNQVADAVATFGAXXXXXXXXXXXXXXXNVVAYYAVGLPVSGWLAFGPLQMGLAGLWVG 517
            + ++ D++                    N+V Y+ V +P+  +LA+  + M L GLW+G
Sbjct: 589 GIVEIFDSLNAISGSCLRGLGLQYIGSIVNLVVYHLVAIPLGIFLAW-YMDMKLNGLWIG 647

Query: 518 CGAGIVVLAVAASVWVRKSDWREI-RRAFLARESMEGEDLLTPS 560
            G G++++ +  S +V  +DW ++  RA   R+     D  T S
Sbjct: 648 IGVGMLIIGLVQSYYVIFADWNDVMERAEKRRDHDRDADSDTDS 691

>YDR338C (YDR338C) [1167] chr4 complement(1147369..1149456) Member
           of the multiple antimicrobiotic resistance (MAR) family
           of membrane transporters [2088 bp, 695 aa]
          Length = 695

 Score =  235 bits (599), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 147/457 (32%), Positives = 235/457 (51%), Gaps = 16/457 (3%)

Query: 103 EARAILSAALPLTTTFFLEYALLVSSLFIIGHFGSADHXXXXXXXXMTYNITGLAVIEGM 162
           EAR + S + PL  TF LE    +     +GH G  +         MT NIT LA+ EG+
Sbjct: 228 EARVLASYSFPLIFTFLLEQIFPMVCSLTVGHLGK-NELAAVSLASMTSNIT-LAIFEGI 285

Query: 163 ATSLDTFCAQAYGARRYAKVGLYFWRCTLMIAVAVVPITVLWWTAASWLAVLVPQPALLQ 222
           ATSLDT C QAYG+ R+  VG++  RC     V  +P  V+WW +   L+ ++P+  L+ 
Sbjct: 286 ATSLDTLCPQAYGSGRFYSVGVHLQRCIAFSLVIYIPFAVMWWYSEPLLSYIIPEKELIN 345

Query: 223 DVQLFLRVASAGLPGLVLFETGKRYVQAQGCYEAGTWVLALAVPVNVGLCVALVRQ---- 278
               FLRV   G P  + FE  KR++QAQG ++AG +VL +  P+NV +   LV      
Sbjct: 346 LTSRFLRVLILGAPAYIFFENLKRFLQAQGIFDAGIYVLTICAPLNVLVSYTLVWNKYIG 405

Query: 279 IGFIGAPLALAATHWALAVLLGAYCIYWEPRTLQCSYPVWASRRHLKRALTHWGGMWSLA 338
           +GFIGA +A+    W +  LL  Y +Y + R  +C    W      ++A THW  +  LA
Sbjct: 406 VGFIGAAIAVVLNFWLMFFLLLFYALYIDGR--KC----WGGFS--RKAFTHWNDLGHLA 457

Query: 339 FPGLVMIESEYLSFEVLTLMSTRFGVEAIAAQSVVANAGSLIYQVPFAMGCVVSTXXXXX 398
           F G++M+E+E LS+E+LTL S  +GV  +AAQS V+   +L+Y +PFA+G   ST     
Sbjct: 458 FSGIIMLEAEELSYELLTLFSAYYGVSYLAAQSAVSTMAALLYMIPFAIGISTSTRIANF 517

Query: 399 XXXXXXXXXXXTVRAGYWVAAXXXXXXXXXXXXXRGAVARLFTQDAGVIALAERLVPILA 458
                      + + G   +              R  +A ++++D  VI L  +++P++ 
Sbjct: 518 IGAKRTDFAHISSQVGLSFSFIAGFINCCILVFGRNLIANIYSKDPEVIKLIAQVLPLVG 577

Query: 459 VNQVADAVATFGAXXXXXXXXXXXXXXXNVVAYYAVGLPVSGWLAFGPLQMGLAGLWVGC 518
           + Q  D++                    N++AYY  G+P++  L++    M L GLW+G 
Sbjct: 578 IVQNFDSLNAVAGSCLRGQGMQSLGSIVNLMAYYLFGIPLALILSWF-FDMKLYGLWIGI 636

Query: 519 GAGIVVLAVAASVWVRKSDWREIRR-AFLARESMEGE 554
           G+ ++++ +  + +V   DW +I   A + +E+ + E
Sbjct: 637 GSAMLLIGLVEAYYVLFPDWDKIMTYAEILKETEDDE 673

>Scas_373.1
          Length = 694

 Score =  230 bits (587), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 146/443 (32%), Positives = 221/443 (49%), Gaps = 15/443 (3%)

Query: 103 EARAILSAALPLTTTFFLEYALLVSSLFIIGHFGSADHXXXXXXXXMTYNITGLAVIEGM 162
           EA+ + S + PL  TF LE    +     +GH G  +         MT NIT LAV EG+
Sbjct: 222 EAKVLASYSFPLIFTFLLEQIFPMVCSLTVGHLGK-NQLAAVSLASMTSNIT-LAVFEGI 279

Query: 163 ATSLDTFCAQAYGARRYAKVGLYFWRCTLMIAVAVVPITVLWWTAASWLAVLVPQPALLQ 222
           ATSLDT C QAYG+ RY  VG++  RC     V  +P    W+ +   L ++VP+  L+ 
Sbjct: 280 ATSLDTLCPQAYGSGRYFSVGIHLQRCIAFSLVIFIPFAFFWYYSEPILYLVVPEKELIH 339

Query: 223 DVQLFLRVASAGLPGLVLFETGKRYVQAQGCYEAGTWVLALAVPVNVGLCVALVRQ---- 278
               FL+V   G P  + FE  KRY+QAQG ++AG +VLA+  P N+ +   LV      
Sbjct: 340 LTSQFLKVLILGAPAYIFFENLKRYLQAQGIFDAGIYVLAICAPTNILVSYTLVWNKYIG 399

Query: 279 IGFIGAPLALAATHWALAVLLGAYCIYWEPRTLQCSYPVWASRRHLKRALTHWGGMWSLA 338
           IGFIG+ +A+    W +  LL  Y I +E    +C    W      ++ALTHW  +  LA
Sbjct: 400 IGFIGSAVAVVLNFWLMFFLLLFYTIKFEGG--KC----WGGFS--RKALTHWKDLGHLA 451

Query: 339 FPGLVMIESEYLSFEVLTLMSTRFGVEAIAAQSVVANAGSLIYQVPFAMGCVVSTXXXXX 398
             G++M+E+E LS+E+LTL S  FG   +AAQS V+   +L+Y VPFA+G   ST     
Sbjct: 452 LSGIIMLEAEELSYELLTLFSAYFGASYLAAQSAVSTMAALLYMVPFAIGISTSTRIANF 511

Query: 399 XXXXXXXXXXXTVRAGYWVAAXXXXXXXXXXXXXRGAVARLFTQDAGVIALAERLVPILA 458
                      + + G   +              R  +A +F++D  V  L   L+P++ 
Sbjct: 512 IGARRTDCAHISSKVGLTFSFGAGLINCSLLILGRHFIANIFSKDEEVKTLISNLLPLVG 571

Query: 459 VNQVADAVATFGAXXXXXXXXXXXXXXXNVVAYYAVGLPVSGWLAFGPLQMGLAGLWVGC 518
           + Q  D++                    N+++YY  G+P++  L++    M L GLWVG 
Sbjct: 572 IVQNFDSLNAVAGSCLRGQGMQSLGSIVNLLSYYLFGIPLALILSWH-FDMKLNGLWVGI 630

Query: 519 GAGIVVLAVAASVWVRKSDWREI 541
           G+ ++++ +  S +V   +W  I
Sbjct: 631 GSAMLLIGLIESYYVLFPNWNAI 653

>YHR032W (YHR032W) [2319] chr8 (173336..175081) Member of the
           multiple antimicrobiotic resistance (MAR) family of
           membrane transporters [1746 bp, 581 aa]
          Length = 581

 Score =  224 bits (570), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 130/371 (35%), Positives = 202/371 (54%), Gaps = 12/371 (3%)

Query: 102 REARAILSAALPLTTTFFLEYALLVSSLFIIGHFGSADHXXXXXXXXMTYNITGLAVIEG 161
           RE + I   ALPL  TF L+ +L ++S+F + H G+ +         MT NITGLA I+G
Sbjct: 163 RETQVITMNALPLIFTFILQNSLSLASIFSVSHLGTKE-LGGVTLGSMTANITGLAAIQG 221

Query: 162 MATSLDTFCAQAYGARRYAKVGLYFWRCTLMIAVAVVPITVLWWT-AASWLAVLVPQPAL 220
           + T LDT CAQAYGA+ Y  VG+   RC ++  +A +P+  +W+  +   LA+++P+  L
Sbjct: 222 LCTCLDTLCAQAYGAKNYHLVGVLVQRCAVITILAFLPMMYVWFVWSEKILALMIPEREL 281

Query: 221 LQDVQLFLRVASAGLPGLVLFETGKRYVQAQGCYEAGTWVLALAVPVNVGLCVALVRQ-- 278
                 +LRV + G+PG +LFE GKR++Q QG + A T VL +  P+N  +   LV    
Sbjct: 282 CALAANYLRVTAFGVPGFILFECGKRFLQCQGIFHASTIVLFVCAPLNALMNYLLVWNDK 341

Query: 279 --IGFIGAPLALAATHW--ALAVLLGAYCIYWEPRTLQCSYPVWASRRHLKRALTHWGGM 334
             IG++GAPL++   +W   L +L+ A     + R L+C    W      ++A  +W  M
Sbjct: 342 IGIGYLGAPLSVVINYWLMTLGLLIYAMTTKHKERPLKC----WNGIIPKEQAFKNWRKM 397

Query: 335 WSLAFPGLVMIESEYLSFEVLTLMSTRFGVEAIAAQSVVANAGSLIYQVPFAMGCVVSTX 394
            +LA PG+VM+E+E+L FEVLT+ ++  G +A+ AQS+VA   SL YQVPF++    ST 
Sbjct: 398 INLAIPGVVMVEAEFLGFEVLTIFASHLGTDALGAQSIVATIASLAYQVPFSISVSTSTR 457

Query: 395 XXXXXXXXXXXXXXXTVRAGYWVAAXXXXXXXXXXXXXRGAVARLFTQDAGVIALAERLV 454
                          T R    ++              +  +A LF+ ++ V+ +    +
Sbjct: 458 VANFIGASLYDSCMITCRVSLLLSFVCSSMNMFVICRYKEQIASLFSTESAVVKMVVDTL 517

Query: 455 PILAVNQVADA 465
           P+LA  Q+ DA
Sbjct: 518 PLLAFMQLFDA 528

>KLLA0F04279g 407511..408962 similar to ca|CA6037|CaERC4 Candida
           albicans ethionine resistance protein (by homology),
           hypothetical start
          Length = 483

 Score =  210 bits (534), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 133/439 (30%), Positives = 221/439 (50%), Gaps = 14/439 (3%)

Query: 109 SAALPLTTTFFLEYALLVSSLFIIGHFGSADHXXXXXXXXMTYNITGLAVIEGMATSLDT 168
             ++PL  TF L+ +L  S+L   G  G+ +         +T+ +T  A+  G+AT LDT
Sbjct: 42  KTSIPLIITFLLQCSLSSSALVFAGRVGTLE-VGGISIGNVTFAVTS-AIFIGIATCLDT 99

Query: 169 FCAQAYGARRYAKVGLYFWRCTLMIAVAVVPITVLWWTAASWLAVLVPQPALLQDVQLFL 228
            C QAYGA +Y  VGLYF R   +  +  VP+   W+ +   L+ LV    ++    ++L
Sbjct: 100 VCPQAYGAGKYNMVGLYFQRGVAISFLFAVPVIAFWYNSEYVLSFLVEDADVVHIAAVYL 159

Query: 229 RVASAGLPGLVLFETGKRYVQAQGCYEAGTWVLALAVPVNVGL--CVALVRQIGFIGAPL 286
           R+    LPG ++FE GK+Y+QAQG +  G  +L +  P+N+ L     L  + G+IG+P+
Sbjct: 160 RIMILSLPGYIIFECGKKYLQAQGDFVTGQNILFVCAPLNILLNYLFVLKYKFGYIGSPI 219

Query: 287 ALAATHWALAVLLGAYC---IYWEPRTLQCSYPVWASRRHLKRALTHWGGMWSLAFPGLV 343
           ++  ++  + + + AY    IY+   +  C +P+     +      +WG + +LA PGL+
Sbjct: 220 SMVLSYTLMGLTIVAYICRQIYFGNSS--CWHPITG---NFSAIFKNWGPLIALALPGLI 274

Query: 344 MIESEYLSFEVLTLMSTRFGVEAIAAQSVVANAGSLIYQVPFAMGCVVSTXXXXXXXXXX 403
           MIE+E+ +FE++T++S +FG E +AAQS+VA   +  +Q+PF+     S           
Sbjct: 275 MIEAEFFAFEIITVLSAKFGTEVLAAQSIVATLQTFFFQLPFSCSVAASNRIAYHIGSGI 334

Query: 404 XXXXXXTVRAG-YWVAAXXXXXXXXXXXXXRGAVARLFTQDAGVIALAERLVPILAVNQV 462
                   +A  + V               R  +  LF  D  ++  A  L+ ++A+NQ+
Sbjct: 335 TENCKTATKATMFGVGPAAGIINFTVLYFGRYKLCSLFNADPVLVNKAAGLLCVVALNQI 394

Query: 463 ADAVATFGAXXXXXXXXXXXXXXXNVVAYYAVGLPVSGWLAFGPLQMGLAGLWVGCGAGI 522
            D      A               N++AYY VGL V   LAF   +M + G W+G G G+
Sbjct: 395 YDCFNVMAAGVLRAQGRQRIGGYLNIMAYYLVGLEVGILLAF-KFKMEVLGFWIGIGVGV 453

Query: 523 VVLAVAASVWVRKSDWREI 541
           + LA+  + +V  S+WR I
Sbjct: 454 LFLAIGENYFVYISNWRNI 472

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.324    0.135    0.426 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 14,437,843
Number of extensions: 507274
Number of successful extensions: 1464
Number of sequences better than 10.0: 17
Number of HSP's gapped: 1419
Number of HSP's successfully gapped: 17
Length of query: 563
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 456
Effective length of database: 12,891,983
Effective search space: 5878744248
Effective search space used: 5878744248
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 64 (29.3 bits)