Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_47.1817227327010631e-147
Sklu_2260.42692735395e-68
KLLA0F27555g2792154813e-59
YIL044C (AGE2)2982934746e-58
ADL084W2331184661e-57
CAGL0L00825g2652844672e-57
Scas_704.423111314531e-54
Kwal_33.131018731062056e-18
CAGL0G05445g354781955e-17
Scas_677.6357781956e-17
ABL164C3601121902e-16
Kwal_23.4569370781903e-16
Sklu_2267.4359781868e-16
YDL226C (GCS1)352781841e-15
KLLA0D18942g3571121841e-15
KLLA0E06787g5151181816e-15
YDR524C (AGE1)4821151808e-15
CAGL0H01617g3491361781e-14
Scas_685.258771091782e-14
AGL279C451771753e-14
Kwal_27.106764661171754e-14
AFR725C8731121755e-14
Sklu_2181.34141311711e-13
ACL055W4711201692e-13
YNL204C (SPS18)300981653e-13
Scas_672.9485781674e-13
Scas_707.333961281622e-12
CAGL0G03707g486781612e-12
YER122C (GLO3)493791612e-12
Kwal_47.172483111241584e-12
Scas_602.10447991577e-12
CAGL0L06028g5051221515e-11
YGL181W (GTS1)3961211453e-10
KLLA0C17138g383991337e-09
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_47.18172
         (270 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_47.18172                                                         414   e-147
Sklu_2260.4 YIL044C, Contig c2260 5970-6779                           212   5e-68
KLLA0F27555g complement(2554571..2555410) some similarities with...   189   3e-59
YIL044C (AGE2) [2623] chr9 complement(272949..273845) GTPase-act...   187   6e-58
ADL084W [1657] [Homologous to ScYIL044C (AGE2) - SH] complement(...   184   1e-57
CAGL0L00825g complement(102709..103506) similar to sp|P40529 Sac...   184   2e-57
Scas_704.42                                                           179   1e-54
Kwal_33.13101                                                          84   6e-18
CAGL0G05445g complement(514769..515833) similar to sp|P35197 Sac...    80   5e-17
Scas_677.6                                                             80   6e-17
ABL164C [428] [Homologous to ScYDL226C (GCS1) - SH; ScYNL204C (S...    78   2e-16
Kwal_23.4569                                                           78   3e-16
Sklu_2267.4 YDL226C, Contig c2267 4691-5770 reverse complement         76   8e-16
YDL226C (GCS1) [649] chr4 complement(51116..52174) GTPase-activa...    75   1e-15
KLLA0D18942g 1594560..1595633 similar to sp|P35197 Saccharomyces...    75   1e-15
KLLA0E06787g 618131..619678 similar to sp|P38682 Saccharomyces c...    74   6e-15
YDR524C (AGE1) [1336] chr4 complement(1487530..1488978) ADP-ribo...    74   8e-15
CAGL0H01617g 157279..158328 similar to tr|Q04412 Saccharomyces c...    73   1e-14
Scas_685.25                                                            73   2e-14
AGL279C [4033] [Homologous to ScYER122C (GLO3) - SH] (182187..18...    72   3e-14
Kwal_27.10676                                                          72   4e-14
AFR725C [3918] [Homologous to ScYDR524C (AGE1) - SH] (1771660..1...    72   5e-14
Sklu_2181.3 YGL181W, Contig c2181 6465-7709                            70   1e-13
ACL055W [994] [Homologous to ScYGL181W (GTS1) - SH] complement(2...    70   2e-13
YNL204C (SPS18) [4399] chr14 complement(258374..259276) Sporulat...    68   3e-13
Scas_672.9                                                             69   4e-13
Scas_707.33                                                            67   2e-12
CAGL0G03707g complement(355469..356929) similar to sp|P38682 Sac...    67   2e-12
YER122C (GLO3) [1552] chr5 complement(402867..404348) GTPase-act...    67   2e-12
Kwal_47.17248                                                          65   4e-12
Scas_602.10                                                            65   7e-12
CAGL0L06028g complement(675584..677101) weakly similar to sp|P40...    63   5e-11
YGL181W (GTS1) [1810] chr7 (157910..159100) Putative zinc-finger...    60   3e-10
KLLA0C17138g 1497245..1498396 some similarities with sp|P40956 S...    56   7e-09

>Kwal_47.18172
          Length = 273

 Score =  414 bits (1063), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 210/270 (77%), Positives = 210/270 (77%)

Query: 1   MSSPAVKKVLSALLRDPANGTCADCKTAGHPRWASWSLGVFICIRCAGIHRSLGTHISKV 60
           MSSPAVKKVLSALLRDPANGTCADCKTAGHPRWASWSLGVFICIRCAGIHRSLGTHISKV
Sbjct: 1   MSSPAVKKVLSALLRDPANGTCADCKTAGHPRWASWSLGVFICIRCAGIHRSLGTHISKV 60

Query: 61  KSVDLDTWQEEHLRKVVEFGNNAAANAVYECKLSGNHTPDASKLSDFIRSKYELKKWLGS 120
           KSVDLDTWQEEHLRKVVEFGNNAAANAVYECKLSGNHTPDASKLSDFIRSKYELKKWLGS
Sbjct: 61  KSVDLDTWQEEHLRKVVEFGNNAAANAVYECKLSGNHTPDASKLSDFIRSKYELKKWLGS 120

Query: 121 SANATTPASGSNSVVTNSKPERTQEKTQVXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLN 180
           SANATTPASGSNSVVTNSKPERTQEKTQV                            DLN
Sbjct: 121 SANATTPASGSNSVVTNSKPERTQEKTQVSQQTHNSQTSLLSQTTSVSIGSGSSSQVDLN 180

Query: 181 LXXXXXXXXXXXXXXXXELNGRPDLKKSILSLYSRPRASATSVASGAXXXXXXXXXXXXX 240
           L                ELNGRPDLKKSILSLYSRPRASATSVASGA             
Sbjct: 181 LAPPRAPTRTTTSQAARELNGRPDLKKSILSLYSRPRASATSVASGASNISLGSSTGNSS 240

Query: 241 XXXPGANFSVPAGSNTTASASLEDNELFKN 270
              PGANFSVPAGSNTTASASLEDNELFKN
Sbjct: 241 NSTPGANFSVPAGSNTTASASLEDNELFKN 270

>Sklu_2260.4 YIL044C, Contig c2260 5970-6779
          Length = 269

 Score =  212 bits (539), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 121/273 (44%), Positives = 148/273 (54%), Gaps = 10/273 (3%)

Query: 1   MSSPAVKKVLSALLRDPANGTCADCKTAGHPRWASWSLGVFICIRCAGIHRSLGTHISKV 60
           MSSP VKKVL+ LLRDP N  CADCK + HPRW SWSLGVF+CI+CAGIHRSLGTHISKV
Sbjct: 1   MSSPQVKKVLATLLRDPDNARCADCKVSSHPRWCSWSLGVFVCIKCAGIHRSLGTHISKV 60

Query: 61  KSVDLDTWQEEHLRKVVEFGNNAAANAVYECKLSGNHTPDASKLSDFIRSKYELKKWLGS 120
           KSVDLDTWQE+HL++V+ +GNN  AN  YE KL G+HTPD SKL  FIR+KYELKKW G 
Sbjct: 61  KSVDLDTWQEQHLQQVIRWGNNKRANLYYEAKLQGSHTPDPSKLQSFIRTKYELKKWCGE 120

Query: 121 S---ANATTPASGSNSVVTNSKPERTQEKTQVXXXXXXXXXXXXXXXXXXXXXXXXXXXX 177
           +    +AT   +  N V   + P   +E                                
Sbjct: 121 ADEVLSATETTTAPNPVAETAPPALVRE------FSTGIPATTAPPVTTSSTSSSCSSSL 174

Query: 178 DLNLXXXXXXXXXXXXXXXXELNGRPDLKKSILSLYSRPRASATSVASGAXXXXXXXXXX 237
                                 + RP+LKKSILSLY++P+ +  S  S            
Sbjct: 175 LDLNLTPVASSTQQRVTHTHSYSTRPELKKSILSLYAKPKVTQ-SAPSLRDTSTAAAATS 233

Query: 238 XXXXXXPGANFSVPAGSNTTASASLEDNELFKN 270
                   +N +    SN ++  +LEDNELFKN
Sbjct: 234 AAPLNGNYSNSNAWNSSNNSSDLALEDNELFKN 266

>KLLA0F27555g complement(2554571..2555410) some similarities with
           sp|P40529 Saccharomyces cerevisiae YIL044c AGE2,
           hypothetical start
          Length = 279

 Score =  189 bits (481), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 102/215 (47%), Positives = 117/215 (54%), Gaps = 7/215 (3%)

Query: 1   MSSPAVKKVLSALLRDPANGTCADCKTAGHPRWASWSLGVFICIRCAGIHRSLGTHISKV 60
           M+S  VKKVL+ LLRDP N  C DCK A HPRWASWSLGVF+CI+CAG HRS+GTHISKV
Sbjct: 1   MTSVEVKKVLTTLLRDPENNRCGDCKVATHPRWASWSLGVFVCIKCAGFHRSMGTHISKV 60

Query: 61  KSVDLDTWQEEHLRKVVEFGNNAAANAVYECKL-SGNHTPDASKLSDFIRSKYELKKWLG 119
           KSVDLDTW EEHL  V+EFGNN   N  YE KL  G + PD SK+  FIR+KYELKKW+G
Sbjct: 61  KSVDLDTWTEEHLEAVLEFGNNKKFNEYYENKLGGGTYVPDQSKIGQFIRTKYELKKWVG 120

Query: 120 SSANATTPASGSNSVVTNSKPERTQEKTQVXXXXXXXXXXXXXXXXXXXXXXXXXXXXDL 179
                   +S      T    +R  +K                               D 
Sbjct: 121 DDPIVDVKSSKH----TAEAKDRVAQK--AAAVRNSPSSDSPRSLDLDLGLNLNSVVTDK 174

Query: 180 NLXXXXXXXXXXXXXXXXELNGRPDLKKSILSLYS 214
           N+                    RPDLKKSILSLY+
Sbjct: 175 NVPQISSEKPSATNTNVYRPPDRPDLKKSILSLYA 209

>YIL044C (AGE2) [2623] chr9 complement(272949..273845)
           GTPase-activating protein for Arf1p, has overlapping
           function with Gcs1p in transport from the trans-Golgi
           network (TGN), involved in endocytosis [897 bp, 298 aa]
          Length = 298

 Score =  187 bits (474), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 119/293 (40%), Positives = 147/293 (50%), Gaps = 24/293 (8%)

Query: 2   SSPAVKKVLSALLRDPANGTCADCKTAGHPRWASWSLGVFICIRCAGIHRSLGTHISKVK 61
           +S  VKK LSALLRDP N  CADCK   HPRWASWSLGVFICI+CAGIHRSLGTHISKVK
Sbjct: 3   TSVPVKKALSALLRDPGNSHCADCKAQLHPRWASWSLGVFICIKCAGIHRSLGTHISKVK 62

Query: 62  SVDLDTWQEEHLRKVVEFGNNAAANAVYEC----KLSGNHTPDASKLSDFIRSKYELKKW 117
           SVDLDTW+EEHL K+++F NN  AN+ YE     +L      D S L +FI++KYE KKW
Sbjct: 63  SVDLDTWKEEHLVKLIQFKNNLRANSYYEATLADELKQRKITDTSSLQNFIKNKYEYKKW 122

Query: 118 LGS------------------SANATTPASGSNSVVTNSKPERTQEKTQVXXXXXXXXXX 159
           +G                   SAN + PAS +    +++  ++TQ +             
Sbjct: 123 IGDLSSIEGLNDSTEPVLHKPSANHSLPASNARLDQSSNSLQKTQTQPPSHLLSTSRSNT 182

Query: 160 XXXXXXXXXXXXXXXXXXDLNLXXXXXXXXXXXXXXXXELNGRPDLKKSILSLYSRPRAS 219
                               +                 E   R DLKKSILSLYS+P A 
Sbjct: 183 SLLNLQVSSLSKTTSNTSVTSSATSIGAANTKTGNRVGEFGQRNDLKKSILSLYSKPSAQ 242

Query: 220 ATSVASGAXXXXXXXXXXXXXXXXPG--ANFSVPAGSNTTASASLEDNELFKN 270
             S  S                   G  A  +    SN++++ SL+DNELFKN
Sbjct: 243 TQSQNSFFTSTTPQPCNTPSPFVNTGITATNNNSMNSNSSSNISLDDNELFKN 295

>ADL084W [1657] [Homologous to ScYIL044C (AGE2) - SH]
           complement(536243..536944) [702 bp, 233 aa]
          Length = 233

 Score =  184 bits (466), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 79/118 (66%), Positives = 97/118 (82%), Gaps = 1/118 (0%)

Query: 1   MSSPAVKKVLSALLRDPANGTCADCKTAGHPRWASWSLGVFICIRCAGIHRSLGTHISKV 60
           M+S  V++VL  LLRDP N  CADCK + HPRWASWSLGVF+CIRCAG HRSLGTH+SKV
Sbjct: 1   MTSVEVRRVLEQLLRDPCNQQCADCKNSAHPRWASWSLGVFVCIRCAGFHRSLGTHVSKV 60

Query: 61  KSVDLDTWQEEHLRKVVEFGNNAAANAVYECKL-SGNHTPDASKLSDFIRSKYELKKW 117
           KSVDLDTW+EEHL++VV FGNN  AN V+E +L  G++ PD SK+  FI++KYE++KW
Sbjct: 61  KSVDLDTWKEEHLQQVVRFGNNQQANKVFEGRLGGGSYVPDQSKMGQFIKTKYEVRKW 118

 Score = 45.4 bits (106), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 38/71 (53%), Gaps = 16/71 (22%)

Query: 200 NGRPDLKKSILSLYSRPRASATSVASGAXXXXXXXXXXXXXXXXPGANFSVPAGSNTTAS 259
           N RPDLKKSILSLY++PR  +  VAS A                 G ++S         +
Sbjct: 176 NARPDLKKSILSLYAKPRQQSPGVASSASSLNSAAASA-------GVSYS---------A 219

Query: 260 ASLEDNELFKN 270
           ASLEDNELFKN
Sbjct: 220 ASLEDNELFKN 230

>CAGL0L00825g complement(102709..103506) similar to sp|P40529
           Saccharomyces cerevisiae YIL044c AGE2, hypothetical
           start
          Length = 265

 Score =  184 bits (467), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 112/284 (39%), Positives = 143/284 (50%), Gaps = 36/284 (12%)

Query: 1   MSSPAVKKVLSALLRDPANGTCADCKTAGHPRWASWSLGVFICIRCAGIHRSLGTHISKV 60
           M+S  VKK L+ LLRDP N +CADCK+  HPRWASWSLGVFICI+CAG+HRSLGTHISKV
Sbjct: 1   MTSVPVKKALTTLLRDPGNASCADCKSQSHPRWASWSLGVFICIKCAGVHRSLGTHISKV 60

Query: 61  KSVDLDTWQEEHLRKVVEFGNNAAANAVYECKLSGNHTPDASK------------LSDFI 108
           KSVDLDTW+EEHL+++V+  NN  AN VYE KL     PD+SK            L +FI
Sbjct: 61  KSVDLDTWKEEHLKELVQMRNNVNANRVYEAKL-----PDSSKFNGKSLGNDINLLQEFI 115

Query: 109 RSKYELKKWLGSSANATTPASGSNSVVTNSKPERTQEKTQVXXXXXXXXXXXXXXXXXXX 168
           R KYE K+W+ SS +     S    VV+ +    +   + +                   
Sbjct: 116 RQKYERKRWMDSSVD----LSRDQPVVSQANSSSSSLVSTMSSSNESTNNTVAVEEKLKP 171

Query: 169 XXXXXXXXXDLNLXXXXXXXXXXXXXXXXELNGRPDLKKSILSLYSRPRASATSVASGAX 228
                    +L                  +   R DLKKSILSLYS   AS ++  S   
Sbjct: 172 QSTHSSSLLNLQGRKEIVENKRPARPTQQDTPQRNDLKKSILSLYSSANASKSNNNSTMN 231

Query: 229 XXXXXXXXXXXXXXXPGANFSVPAGS--NTTASASLEDNELFKN 270
                           G   + P  +     +S S++D+ELFKN
Sbjct: 232 VSS-------------GMGMTTPFNTTPQNNSSLSIDDDELFKN 262

>Scas_704.42
          Length = 311

 Score =  179 bits (453), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 96/131 (73%), Gaps = 5/131 (3%)

Query: 2   SSPAVKKVLSALLRDPANGTCADCKTAGHPRWASWSLGVFICIRCAGIHRSLGTHISKVK 61
           +SP+VKK L+ALLRDP N  CADCK   HPRWASWSLGVF+CI+CAG+HRSLGTHI+KVK
Sbjct: 3   TSPSVKKALTALLRDPGNSNCADCKLQSHPRWASWSLGVFVCIKCAGVHRSLGTHITKVK 62

Query: 62  SVDLDTWQEEHLRKVVEFGNNAAANAVYECKLSG-----NHTPDASKLSDFIRSKYELKK 116
           SVDLDTW+EEHL  +++  NN  AN  YE  L       N   D +KL  FIR+KYELKK
Sbjct: 63  SVDLDTWKEEHLEMLIKMRNNVEANRYYEANLPDSSSLKNGITDTNKLQLFIRTKYELKK 122

Query: 117 WLGSSANATTP 127
           W+G+    + P
Sbjct: 123 WVGTPREVSEP 133

 Score = 33.5 bits (75), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 14/15 (93%), Positives = 15/15 (100%)

Query: 202 RPDLKKSILSLYSRP 216
           RPDLKKSILSLYS+P
Sbjct: 212 RPDLKKSILSLYSKP 226

>Kwal_33.13101
          Length = 873

 Score = 83.6 bits (205), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 38/106 (35%), Positives = 66/106 (62%), Gaps = 3/106 (2%)

Query: 16  DPANGTCADCKTAGHPRWASWSLGVFICIRCAGIHRSLGTHISKVKSVDLDTWQEEHLRK 75
           D +N TC DC  +    W S +L   +CI+C+ +HRSLG+HISKV+S+ LD++    +++
Sbjct: 575 DASNTTCCDCGDSNQVEWISINLLCVLCIQCSAVHRSLGSHISKVRSLLLDSFTSREIKE 634

Query: 76  VVEFGNNAAANAVYECKLSGNHTPDASKLSD---FIRSKYELKKWL 118
           ++++ +N   N++YE +L+       S ++D   FI  KY  KK++
Sbjct: 635 LLKYVSNKNLNSIYEAELTQKSIIPGSSVADRTRFITDKYVSKKYV 680

>CAGL0G05445g complement(514769..515833) similar to sp|P35197
          Saccharomyces cerevisiae YDL226c GCS1 ADP-ribosylation
          factor GTPase-activating protein, start by similarity
          Length = 354

 Score = 79.7 bits (195), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 51/78 (65%), Gaps = 1/78 (1%)

Query: 4  PAVKKVLSALLRDPANGTCADCKTAGHPRWASWSLGVFICIRCAGIHRSLGTHISKVKSV 63
          P  ++ L  L +  AN  C DC  A +P+WAS   G+FIC+ CAG HRSLG HIS V+S+
Sbjct: 8  PDNRRRLLQLQKIGANKKCVDC-GAPNPQWASPKFGIFICLECAGTHRSLGVHISFVRSI 66

Query: 64 DLDTWQEEHLRKVVEFGN 81
           +D +++E L ++ E GN
Sbjct: 67 TMDQFKQEELVRMEEGGN 84

>Scas_677.6
          Length = 357

 Score = 79.7 bits (195), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 50/78 (64%), Gaps = 1/78 (1%)

Query: 4  PAVKKVLSALLRDPANGTCADCKTAGHPRWASWSLGVFICIRCAGIHRSLGTHISKVKSV 63
          P  ++ L  L +  AN  C DC  A +P+WAS   GVFIC+ CAG HRSLG HIS V+S+
Sbjct: 8  PDTRRRLLQLQKIGANKKCVDCH-APNPQWASPKFGVFICLECAGTHRSLGVHISFVRSI 66

Query: 64 DLDTWQEEHLRKVVEFGN 81
           +D ++ E L ++ + GN
Sbjct: 67 TMDQFKPEELERMEKGGN 84

>ABL164C [428] [Homologous to ScYDL226C (GCS1) - SH; ScYNL204C
           (SPS18) - SH] (91566..92648) [1083 bp, 360 aa]
          Length = 360

 Score = 77.8 bits (190), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 41/112 (36%), Positives = 61/112 (54%), Gaps = 2/112 (1%)

Query: 4   PAVKKVLSALLRDPANGTCADCKTAGHPRWASWSLGVFICIRCAGIHRSLGTHISKVKSV 63
           P  ++ L  L +   N  CADC  A +P+WAS   G+FIC+ CAGIHR LG HIS V+S+
Sbjct: 8   PDNRRRLLQLQKLGGNKKCADC-GAPNPQWASPKFGIFICLECAGIHRGLGVHISFVRSI 66

Query: 64  DLDTWQEEHLRKVVEFGNNAAANAVYECKLSGNHTPDASKLSDFIRSKYELK 115
            +D ++ E L + +E G NA  +            P  +K  + + + Y+ K
Sbjct: 67  TMDQFKPEELER-MEHGGNAQFHEYLAKHGVDQKLPQKAKYDNPVAASYKEK 117

>Kwal_23.4569
          Length = 370

 Score = 77.8 bits (190), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 51/78 (65%), Gaps = 1/78 (1%)

Query: 4  PAVKKVLSALLRDPANGTCADCKTAGHPRWASWSLGVFICIRCAGIHRSLGTHISKVKSV 63
          P  ++ L  L +  +N  C DC+ A +P+WAS   G+FIC+ CAG+HR LG HIS V+S+
Sbjct: 9  PDNRRRLLQLQKVGSNKKCVDCE-APNPQWASPKFGIFICLECAGLHRGLGVHISFVRSI 67

Query: 64 DLDTWQEEHLRKVVEFGN 81
           +D ++ E L ++ + GN
Sbjct: 68 TMDQFKPEELERMEKGGN 85

>Sklu_2267.4 YDL226C, Contig c2267 4691-5770 reverse complement
          Length = 359

 Score = 76.3 bits (186), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 34/78 (43%), Positives = 50/78 (64%), Gaps = 1/78 (1%)

Query: 4  PAVKKVLSALLRDPANGTCADCKTAGHPRWASWSLGVFICIRCAGIHRSLGTHISKVKSV 63
          P  ++ L  L +  +N  C DC  A +P+WAS   G+FIC+ CAGIHR LG HIS V+S+
Sbjct: 9  PDNRRRLLQLQKIGSNKKCIDC-NAPNPQWASPKFGIFICLECAGIHRGLGVHISFVRSI 67

Query: 64 DLDTWQEEHLRKVVEFGN 81
           +D ++ E L ++ + GN
Sbjct: 68 TMDQFKPEELARMEKGGN 85

>YDL226C (GCS1) [649] chr4 complement(51116..52174)
          GTPase-activating protein (GAP) for ADP-ribosylation
          factors Arf1p and Arf2p, involved in endocytosis,
          exocytosis, secretion, and mitochondrial and vacuolar
          organization, member of the Gcs1p/Glo3p/Sps18p family
          [1059 bp, 352 aa]
          Length = 352

 Score = 75.5 bits (184), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 34/78 (43%), Positives = 49/78 (62%), Gaps = 1/78 (1%)

Query: 4  PAVKKVLSALLRDPANGTCADCKTAGHPRWASWSLGVFICIRCAGIHRSLGTHISKVKSV 63
          P  ++ L  L +  AN  C DC  A +P+WA+   G FIC+ CAGIHR LG HIS V+S+
Sbjct: 8  PDTRRRLLQLQKIGANKKCMDC-GAPNPQWATPKFGAFICLECAGIHRGLGVHISFVRSI 66

Query: 64 DLDTWQEEHLRKVVEFGN 81
           +D ++ E L ++ + GN
Sbjct: 67 TMDQFKPEELLRMEKGGN 84

>KLLA0D18942g 1594560..1595633 similar to sp|P35197 Saccharomyces
           cerevisiae YDL226c GCS1 ADP-ribosylation factor
           GTPase-activating protein (ARF-GAP), start by similarity
          Length = 357

 Score = 75.5 bits (184), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 40/112 (35%), Positives = 61/112 (54%), Gaps = 2/112 (1%)

Query: 4   PAVKKVLSALLRDPANGTCADCKTAGHPRWASWSLGVFICIRCAGIHRSLGTHISKVKSV 63
           P  ++ L  L +   N  C DC  A +P+WAS   GVFIC+ CAGIHR LG HIS V+S+
Sbjct: 8   PDNRRRLLQLQKVGGNKKCLDC-GAHNPQWASPKFGVFICLECAGIHRGLGVHISFVRSI 66

Query: 64  DLDTWQEEHLRKVVEFGNNAAANAVYECKLSGNHTPDASKLSDFIRSKYELK 115
            +D ++ + L ++   GN+     + +  +  +  P   K  + I S Y+ K
Sbjct: 67  TMDQFKSDELVRMENGGNDKFTEYLEDHGIDSS-LPQKLKYDNVIASDYKDK 117

>KLLA0E06787g 618131..619678 similar to sp|P38682 Saccharomyces
           cerevisiae YER122c GLO3 zinc finger protein, start by
           similarity
          Length = 515

 Score = 74.3 bits (181), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 46/118 (38%), Positives = 59/118 (50%), Gaps = 22/118 (18%)

Query: 6   VKKVLSALLRDPANGTCADCKTAGHPRWASWSLGVFICIRCAGIHRSLGTHISKVKSVDL 65
           V KV + L     N  C DC  A +P W S   GV +CI C+G HR++GTHI+ VKS +L
Sbjct: 17  VTKVFARLTTKSENRACFDC-GAKNPTWTSVPFGVLLCIDCSGEHRNMGTHITFVKSSNL 75

Query: 66  DTWQEEHLRKVVEFGNNAAANAVYECKLSGNHTPDASKLSDFIRSKYELKKWLGSSAN 123
           D W   +LR+                KL GN      K  DF   K   K++LGSS+N
Sbjct: 76  DKWTVNNLRRF---------------KLGGN-----DKAKDFFL-KNNGKQYLGSSSN 112

>YDR524C (AGE1) [1336] chr4 complement(1487530..1488978)
           ADP-ribosylation factor (ARF) GTPase activating protein
           (GAP) with effector functions, involved in endocytosis
           and protein secretion [1449 bp, 482 aa]
          Length = 482

 Score = 73.9 bits (180), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 42/115 (36%), Positives = 66/115 (57%), Gaps = 11/115 (9%)

Query: 16  DPANGTCADCKTAGHPRWASWSLGVFICIRCAGIHRSLGTHISKVKSVDLDTWQEEHLRK 75
           D +N  C DC +     W S +L   +CI+C+G+HRSLG+HISK++S+ LD +    L  
Sbjct: 180 DKSNLKCCDCGSTATVEWVSINLLCILCIKCSGVHRSLGSHISKIRSLTLDNFTSLELMH 239

Query: 76  VVE-FGNNAAANAVYEC--------KLSGNHTPDASKLSDFIRSKYELKKWLGSS 121
           +++   +N+  NA+YE         K++ N   D S+ S FI  KY+ KK++  S
Sbjct: 240 LLQNNVSNSNVNAIYESNLRNFPVKKITAN--SDDSERSKFIIDKYQFKKFVIDS 292

>CAGL0H01617g 157279..158328 similar to tr|Q04412 Saccharomyces
           cerevisiae YDR524c AGE1, hypothetical start
          Length = 349

 Score = 73.2 bits (178), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 46/136 (33%), Positives = 73/136 (53%), Gaps = 10/136 (7%)

Query: 16  DPANGTCADCKTAGHPRWASWSLGVFICIRCAGIHRSLGTHISKVKSVDLDTWQEEHLRK 75
           D +N  C DC +  +  W S +L   +CI+C+G+HRSLG+HISKV+S+++D        K
Sbjct: 18  DESNKRCCDCGSRHNVDWVSINLLCVVCIQCSGVHRSLGSHISKVRSLNMDDLHSNRELK 77

Query: 76  --VVEFGNNAAANAVYECKL-SGNHTPDASKLSD---FIRSKYELKKWLGSSANATTPAS 129
             +V    N   N+VYE ++ +G      ++ +D   +I  KY  KK++  +  AT    
Sbjct: 78  YLLVNHLINRNVNSVYEARIPAGIKIRKDAQPADRARYIVDKYMHKKYVERTMQATL--- 134

Query: 130 GSNSVVTNSKPERTQE 145
            +NS + N K  R  E
Sbjct: 135 -TNSQMANDKDIRDTE 149

>Scas_685.25
          Length = 877

 Score = 73.2 bits (178), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 38/109 (34%), Positives = 63/109 (57%), Gaps = 7/109 (6%)

Query: 17  PANGTCADCKTA-GHPRWASWSLGVFICIRCAGIHRSLGTHISKVKSVDLDTW-QEEHLR 74
           P+N  C DC T+ G   W S +L   +CI+C+G+HRS+G HISK++S+ LD +  +E + 
Sbjct: 590 PSNQRCCDCNTSDGTVEWISLNLLCLVCIKCSGVHRSMGAHISKIRSLTLDNFTSKEMIY 649

Query: 75  KVVEFGNNAAANAVYECKLSGNHTPDASKLSD-----FIRSKYELKKWL 118
            +  + +N   N++YE   +   T  +S  +D     +I  KY  KK++
Sbjct: 650 LIKNYISNEKVNSIYESGTNNTQTRISSNATDSRRSQYINDKYRFKKFI 698

>AGL279C [4033] [Homologous to ScYER122C (GLO3) - SH]
          (182187..183542) [1356 bp, 451 aa]
          Length = 451

 Score = 72.0 bits (175), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 33/77 (42%), Positives = 45/77 (58%), Gaps = 1/77 (1%)

Query: 8  KVLSALLRDPANGTCADCKTAGHPRWASWSLGVFICIRCAGIHRSLGTHISKVKSVDLDT 67
          ++ S L   P N TC DC    +P W S   G+ +CI+C+G HR LG HI+ VKS +LD 
Sbjct: 17 EIFSKLNSKPENRTCFDCGNK-NPTWTSVPFGIMLCIQCSGEHRKLGVHITFVKSSNLDK 75

Query: 68 WQEEHLRKVVEFGNNAA 84
          W   +LR+    GN+ A
Sbjct: 76 WTINNLRRFKMGGNHRA 92

>Kwal_27.10676
          Length = 466

 Score = 72.0 bits (175), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 42/117 (35%), Positives = 58/117 (49%), Gaps = 22/117 (18%)

Query: 8   KVLSALLRDPANGTCADCKTAGHPRWASWSLGVFICIRCAGIHRSLGTHISKVKSVDLDT 67
           KV   L     N  C DC T  +P W S   GV +CI+C+ +HR+LG HI+ VKS +LD 
Sbjct: 17  KVFQKLASKQDNRACFDCGTK-NPTWTSVPFGVMLCIQCSAVHRNLGVHITFVKSSNLDK 75

Query: 68  WQEEHLRKVVEFGNNAAANAVYECKLSGNHTPDASKLSDFIRSKYELKKWLGSSANA 124
           W   +LR+                KL GNH     K  +F   K   K++LG++ +A
Sbjct: 76  WTVNNLRRF---------------KLGGNH-----KAREFFM-KNNGKQFLGTNVDA 111

>AFR725C [3918] [Homologous to ScYDR524C (AGE1) - SH]
           (1771660..1774281) [2622 bp, 873 aa]
          Length = 873

 Score = 72.0 bits (175), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 64/112 (57%), Gaps = 2/112 (1%)

Query: 16  DPANGTCADCKTAGHPRWASWSLGVFICIRCAGIHRSLGTHISKVKSVDLDTWQEEHLRK 75
           DP+N  C DC++     W S ++   +CI C+G+HRSLG H+SK++S+ LD++      +
Sbjct: 559 DPSNSACCDCRSDKQVEWISLNILCVVCINCSGVHRSLGAHVSKMRSLTLDSFSSPESLQ 618

Query: 76  VVEFGNNAAANAVYECKLSGNHTPDAS--KLSDFIRSKYELKKWLGSSANAT 125
           +++  +N   N++YE +      P+ S  +   +I  KY  KK++  + + +
Sbjct: 619 LLKCVSNQNVNSLYESEDLPPIFPENSIDQRKSYITDKYVSKKYVNRTEDIS 670

>Sklu_2181.3 YGL181W, Contig c2181 6465-7709
          Length = 414

 Score = 70.5 bits (171), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 51/131 (38%), Positives = 67/131 (51%), Gaps = 10/131 (7%)

Query: 3   SPAVKKVLSALLRDPANGT-CADCKTAGHPRWASWSLGVFICIRCAGIHRS-LGTHI--- 57
           S AV+K L  L+  P NG  C +C  A +P W S +LGVF+C RCA +HR  LG      
Sbjct: 6   SKAVEKELKDLVNLPENGNRCGEC-GAPYPTWCSVNLGVFLCGRCASVHRKVLGNRDDDA 64

Query: 58  -SKVKSVDLDTWQEEHLRKVVEFGNNAAANAVYECK---LSGNHTPDASKLSDFIRSKYE 113
            S VKS+ LD W+E  L  V   G N    +V+  K      +   D S +  FIR KY 
Sbjct: 65  HSDVKSLTLDRWKESDLDCVNNGGGNRRNKSVWNPKDHPFPFDGDDDKSAVEKFIRDKYI 124

Query: 114 LKKWLGSSANA 124
           L K+  ++  A
Sbjct: 125 LGKFRHTAIKA 135

>ACL055W [994] [Homologous to ScYGL181W (GTS1) - SH]
           complement(267925..269340) [1416 bp, 471 aa]
          Length = 471

 Score = 69.7 bits (169), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 62/120 (51%), Gaps = 10/120 (8%)

Query: 2   SSPAVKKVLSALLRDPANGT-CADCKTAGHPRWASWSLGVFICIRCAGIHRSL-----GT 55
           SS  V++ L AL+  P N   C +C  A +P W S +LG F+C RCA +HR +     G 
Sbjct: 5   SSRTVERELKALVSSPENANRCGECG-ATYPTWCSVNLGAFLCGRCAAVHRKVLTGEQGG 63

Query: 56  HISKVKSVDLDTWQEEHLRKVVEFGNNAAANAVYECK---LSGNHTPDASKLSDFIRSKY 112
             S VKS+ LD W  + L ++   G N   +  +  +      +   D S++ DFIR+KY
Sbjct: 64  PESHVKSLTLDRWTVDELEEITNSGGNRRNHHTWNVRNVAFPYDGDDDRSRVEDFIRNKY 123

>YNL204C (SPS18) [4399] chr14 complement(258374..259276)
           Sporulation-specific zinc finger protein involved in
           activation of sporulation, member of Gcs1p/Glo3p/Sps18p
           family of zinc-finger proteins [903 bp, 300 aa]
          Length = 300

 Score = 68.2 bits (165), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 56/98 (57%), Gaps = 1/98 (1%)

Query: 18  ANGTCADCKTAGHPRWASWSLGVFICIRCAGIHRSLGTHISKVKSVDLDTWQEEHLRKVV 77
            N  C +CK+  +P++ S S G+FIC+ CA + R +GT+I  VKS+ +D ++E+ +R+V 
Sbjct: 24  GNNNCFECKSV-NPQFVSCSFGIFICVNCANLLRGMGTNIFCVKSITMDNFEEKDVRRVE 82

Query: 78  EFGNNAAANAVYECKLSGNHTPDASKLSDFIRSKYELK 115
           + GNN   + + +  +  N  P   K  +     Y+ +
Sbjct: 83  KSGNNRFGSFLSKNGILQNGIPLREKYDNLFAKSYKRR 120

>Scas_672.9
          Length = 485

 Score = 68.9 bits (167), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 43/78 (55%), Gaps = 1/78 (1%)

Query: 7  KKVLSALLRDPANGTCADCKTAGHPRWASWSLGVFICIRCAGIHRSLGTHISKVKSVDLD 66
          ++V   L     N  C DC    +P W S   GV +CI+C+ +HR+LG HI+ VKS  LD
Sbjct: 16 QQVFQKLSSKLENRVCFDCGNK-NPTWTSVPFGVMLCIQCSAVHRNLGVHITFVKSSTLD 74

Query: 67 TWQEEHLRKVVEFGNNAA 84
           W   +LR+    GNN A
Sbjct: 75 KWTINYLRRFKLGGNNKA 92

>Scas_707.33
          Length = 396

 Score = 67.0 bits (162), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 42/128 (32%), Positives = 60/128 (46%), Gaps = 18/128 (14%)

Query: 3   SPAVKKVLSALLRDPANGT-CADCKTAGHPRWASWSLGVFICIRCAGIHRSL-----GTH 56
           +P ++  L  LL  P N   C +C +   P W S +LGVF+C RCA +HR +        
Sbjct: 18  NPNIENELRDLLNAPENANKCGECGST-FPTWCSINLGVFLCGRCASVHRKILNGREDDV 76

Query: 57  ISKVKSVDLDTWQEEHLRKVVEFGNNAAANAVYECKLSGNHTP-------DASKLSDFIR 109
            S +KS+ LD W  + +  + E G N   +  +  K    H P       D S +  FIR
Sbjct: 77  FSNLKSLSLDKWNNDDMDILAELGGNKGNHKFWNPK----HEPFPFDGDDDKSIVEHFIR 132

Query: 110 SKYELKKW 117
            KY L K+
Sbjct: 133 DKYILGKF 140

>CAGL0G03707g complement(355469..356929) similar to sp|P38682
          Saccharomyces cerevisiae YER122c GLO3, hypothetical
          start
          Length = 486

 Score = 66.6 bits (161), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 31/78 (39%), Positives = 44/78 (56%), Gaps = 1/78 (1%)

Query: 7  KKVLSALLRDPANGTCADCKTAGHPRWASWSLGVFICIRCAGIHRSLGTHISKVKSVDLD 66
          ++V + L     N  C DC    +P W S   GV +CI+C+ +HR+LG HI+ VKS  LD
Sbjct: 14 QQVFTKLGSRLENRVCFDCGNK-NPTWTSVPFGVLLCIQCSAVHRNLGVHITFVKSSTLD 72

Query: 67 TWQEEHLRKVVEFGNNAA 84
           W   +LR+    GN+ A
Sbjct: 73 KWTVNNLRRFKYGGNHKA 90

>YER122C (GLO3) [1552] chr5 complement(402867..404348)
          GTPase-activating protein (GAP) for ADP-ribosylation
          factors Arf1p and Arf2p, involved in retrograde
          transport between Golgi and ER as well as endocytosis
          [1482 bp, 493 aa]
          Length = 493

 Score = 66.6 bits (161), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 44/79 (55%), Gaps = 1/79 (1%)

Query: 6  VKKVLSALLRDPANGTCADCKTAGHPRWASWSLGVFICIRCAGIHRSLGTHISKVKSVDL 65
           ++V   L  +  N  C DC    +P W S   GV +CI+C+ +HR++G HI+ VKS  L
Sbjct: 15 TQQVFQKLGSNMENRVCFDCGNK-NPTWTSVPFGVMLCIQCSAVHRNMGVHITFVKSSTL 73

Query: 66 DTWQEEHLRKVVEFGNNAA 84
          D W   +LR+    GN+ A
Sbjct: 74 DKWTINNLRRFKLGGNHKA 92

>Kwal_47.17248
          Length = 311

 Score = 65.5 bits (158), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 61/124 (49%), Gaps = 10/124 (8%)

Query: 3   SPAVKKVLSALLRDPANGT-CADCKTAGHPRWASWSLGVFICIRCAGIHRS-LGTH---- 56
           S A ++ L  +L  P NG  C +C     P W S +LGVF+C RCA +HR+ LG      
Sbjct: 7   SKAAERELKNILNSPENGNKCGECGNT-FPTWCSINLGVFLCGRCASVHRNILGNRDDEI 65

Query: 57  ISKVKSVDLDTWQEEHLRKVVEFGNNAAANAVYECK---LSGNHTPDASKLSDFIRSKYE 113
            S V+S+ +D W    L ++ E G N     ++  +      +   D S +  F+R KY 
Sbjct: 66  YSDVRSLTMDRWSTRDLDEIAESGGNRRNRMLWNPQNVPFPFDGDEDKSAVEQFVREKYV 125

Query: 114 LKKW 117
           L K+
Sbjct: 126 LCKF 129

>Scas_602.10
          Length = 447

 Score = 65.1 bits (157), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 51/99 (51%), Gaps = 6/99 (6%)

Query: 22  CADCKTAGHPRWASWSLGVFICIRCAGIHRSLGTH---ISKVKSVDLDTWQEEHLRKVVE 78
           C +C    +P W S +  +F+C RCA +H+ +  H   +S +KS+ LD W  + L K + 
Sbjct: 25  CGECGLP-NPTWCSTTYNLFLCTRCATVHKKILNHDPDLSIIKSIKLDYWTNDELNKFIN 83

Query: 79  FGNNAAANAVYECKLSGNHTPDASKLSDFIRSKYELKKW 117
            G NA     +  K   N   D +   +F+R KY LKK+
Sbjct: 84  SGGNAYNKRFWNPKDIKNF--DDANWENFLRDKYILKKF 120

>CAGL0L06028g complement(675584..677101) weakly similar to sp|P40956
           Saccharomyces cerevisiae YGL181w GTS1, start by
           similarity
          Length = 505

 Score = 62.8 bits (151), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 41/122 (33%), Positives = 59/122 (48%), Gaps = 17/122 (13%)

Query: 10  LSALLRDPANGT-CADCKTAGHPRWASWSLGVFICIRCAGIHRS-LGTH-------ISKV 60
           L  ++  P NG  C +C +A  P W S +LGVF+C RCA +HR  LGT         S V
Sbjct: 20  LKDIVNAPENGNRCGECGSA-VPTWCSTNLGVFLCGRCASVHRKILGTDPDEESGIFSNV 78

Query: 61  KSVDLDTWQEEHLRKVVEFGNNAAANAVYECK-----LSGNHTPDASKLSDFIRSKYELK 115
           KS+ ++ W+ E +  V   G N      +  K       G+   D S +  F+R KY + 
Sbjct: 79  KSLSMERWEAEDIDSVASSGGNKGNMRKWNPKNEPFPFDGDE--DKSAVERFVREKYIIG 136

Query: 116 KW 117
           K+
Sbjct: 137 KY 138

>YGL181W (GTS1) [1810] chr7 (157910..159100) Putative zinc-finger
           transcription factor of the Gcs1p/Glo3p/Sps18p family,
           involved in heat resistance, flocculation, timing of bud
           emergence, and regulation of biological rhythms [1191
           bp, 396 aa]
          Length = 396

 Score = 60.5 bits (145), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 57/121 (47%), Gaps = 10/121 (8%)

Query: 6   VKKVLSALLRDPANGT-CADCKTAGHPRWASWSLGVFICIRCAGIHRS-LGTH----ISK 59
           V + L  L+    N   C +C    +P W S +LGVF+C RCA +HR   G+      S 
Sbjct: 13  VDRELKELINSSENANKCGECGNF-YPTWCSVNLGVFLCGRCASVHRKVFGSRDDDAFSN 71

Query: 60  VKSVDLDTWQEEHLRKVVEFGNNAAANAVYECK---LSGNHTPDASKLSDFIRSKYELKK 116
           VKS+ +D W  E + ++V  G N      +  K      +   D + +  +IR KY L K
Sbjct: 72  VKSLSMDRWTREDIDELVSLGGNKGNARFWNPKNVPFPFDGDDDKAIVEHYIRDKYILGK 131

Query: 117 W 117
           +
Sbjct: 132 F 132

>KLLA0C17138g 1497245..1498396 some similarities with sp|P40956
           Saccharomyces cerevisiae YGL181w GTS1 transcription
           factor of the GCS1P/GLO3P/SPS18P family singleton,
           hypothetical start
          Length = 383

 Score = 55.8 bits (133), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 51/99 (51%), Gaps = 9/99 (9%)

Query: 22  CADCKTAGHPRWASWSLGVFICIRCAGIHRS-LGTH----ISKVKSVDLDTWQEEHLRKV 76
           C +C T   P + S +LGVF+C RCA +HR  LG+      S VKS+ LD W +  ++ V
Sbjct: 26  CGECGTP-FPTYCSVNLGVFLCGRCASVHRKVLGSREDGATSIVKSLSLDRWSKRDVQTV 84

Query: 77  VEFGNNAAANAVYECK---LSGNHTPDASKLSDFIRSKY 112
            + G N   ++ +  K      +   D + +  FIR KY
Sbjct: 85  ADLGGNKHNSSFWNPKKEPFPFDGDEDRTAVEMFIRDKY 123

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.311    0.125    0.366 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 6,752,755
Number of extensions: 220888
Number of successful extensions: 607
Number of sequences better than 10.0: 36
Number of HSP's gapped: 583
Number of HSP's successfully gapped: 43
Length of query: 270
Length of database: 16,596,109
Length adjustment: 100
Effective length of query: 170
Effective length of database: 13,134,309
Effective search space: 2232832530
Effective search space used: 2232832530
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 61 (28.1 bits)