Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_47.1816722722511471e-162
KLLA0F27577g172772622e-28
ADL085C273762518e-26
Scas_666.12121611755e-16
KLLA0F23672g123581668e-15
AFL223W165581653e-14
Kwal_26.8461123611598e-14
Sklu_2444.35641361681e-13
CAGL0L03828g121581553e-13
YNL111C (CYB5)120611553e-13
KLLA0A12111g236581606e-13
CAGL0K03069g194551532e-12
Scas_571.2602911574e-12
Scas_571.1d609661565e-12
YML054C (CYB2)591531558e-12
KLLA0B14795g556521541e-11
Kwal_23.2823560741486e-11
Scas_696.36426671451e-10
Kwal_27.10332378561442e-10
CAGL0K10736g593871433e-10
AAL183W377581397e-10
KLLA0D01639g381571381e-09
Kwal_14.807578531381e-09
YMR272C (SCS7)384601371e-09
Sklu_2258.5580881372e-09
KLLA0D02640g589541311e-08
Kwal_26.8046198551242e-08
Scas_717.14189591243e-08
YMR073C201451075e-06
KLLA0C05566g477581088e-06
KLLA0E18535g148561049e-06
AAR153C478801071e-05
Scas_563.6497591061e-05
CAGL0F03399g380601052e-05
Sklu_2299.3480581042e-05
CAGL0I00418g490571033e-05
AAL078W59262963e-04
Sklu_2032.3522102945e-04
Kwal_14.184528858918e-04
KLLA0C10692g52060910.001
YGL055W (OLE1)51057900.002
Kwal_23.569351343840.008
YOL007C34184700.42
AGR269W32482661.6
AFL079W53867633.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_47.18167
         (225 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_47.18167                                                         446   e-162
KLLA0F27577g 2556662..2557180 some similarities with sp|Q9M5B0 P...   105   2e-28
ADL085C [1656] [Homologous to NOHBY] (535296..536117) [822 bp, 2...   101   8e-26
Scas_666.12                                                            72   5e-16
KLLA0F23672g 2212223..2212594 some similarities with sp|P40312 S...    69   8e-15
AFL223W [2972] [Homologous to ScYNL111C (CYB5) - SH] complement(...    68   3e-14
Kwal_26.8461                                                           66   8e-14
Sklu_2444.3 , Contig c2444 10960-12654                                 69   1e-13
CAGL0L03828g 440663..441028 similar to sp|P40312 Saccharomyces c...    64   3e-13
YNL111C (CYB5) [4482] chr14 complement(416940..417302) Cytochrom...    64   3e-13
KLLA0A12111g 1053506..1054216 some similarities with sp|P09437 H...    66   6e-13
CAGL0K03069g complement(284361..284945) weakly similar to sp|Q04...    64   2e-12
Scas_571.2                                                             65   4e-12
Scas_571.1d                                                            65   5e-12
YML054C (CYB2) [3916] chr13 complement(165533..167308) Cytochrom...    64   8e-12
KLLA0B14795g 1299429..1301099 similar to sp|P00175 Saccharomyces...    64   1e-11
Kwal_23.2823                                                           62   6e-11
Scas_696.36                                                            60   1e-10
Kwal_27.10332                                                          60   2e-10
CAGL0K10736g 1045298..1047079 highly similar to sp|P00175 Saccha...    60   3e-10
AAL183W [4] [Homologous to ScYMR272C (SCS7) - SH] complement(137...    58   7e-10
KLLA0D01639g complement(146344..147489) similar to sp|Q03529 Sac...    58   1e-09
Kwal_14.807                                                            58   1e-09
YMR272C (SCS7) [4226] chr13 complement(809622..810776) Ceramide ...    57   1e-09
Sklu_2258.5 YML054C, Contig c2258 8274-10016 reverse complement        57   2e-09
KLLA0D02640g complement(225482..227251) gi|5262950|emb|CAB45871....    55   1e-08
Kwal_26.8046                                                           52   2e-08
Scas_717.14                                                            52   3e-08
YMR073C (YMR073C) [4032] chr13 complement(412267..412872) Protei...    46   5e-06
KLLA0C05566g complement(497877..499310) similar to sp|P21147 Sac...    46   8e-06
KLLA0E18535g 1641507..1641953 some similarities with ca|CA1511|I...    45   9e-06
AAR153C [341] [Homologous to ScYGL055W (OLE1) - SH] (619953..621...    46   1e-05
Scas_563.6                                                             45   1e-05
CAGL0F03399g complement(333955..335097) highly similar to sp|Q03...    45   2e-05
Sklu_2299.3 YGL055W, Contig c2299 5338-6780 reverse complement         45   2e-05
CAGL0I00418g 30058..31530 highly similar to sp|P21147 Saccharomy...    44   3e-05
AAL078W [109] [Homologous to ScYGL055W - NSH] complement(209600....    42   3e-04
Sklu_2032.3 , Contig c2032 4286-5854                                   41   5e-04
Kwal_14.1845                                                           40   8e-04
KLLA0C10692g complement(916718..918280) weakly similar to sp|P21...    40   0.001
YGL055W (OLE1) [1924] chr7 (398629..400161) Stearoyl-CoA desatur...    39   0.002
Kwal_23.5693                                                           37   0.008
YOL007C (YOL007C) [4809] chr15 complement(311342..312367) Protei...    32   0.42 
AGR269W [4580] [Homologous to ScYLR271W - SH] complement(1243098...    30   1.6  
AFL079W [3114] [Homologous to NOHBY] complement(290134..291750) ...    29   3.9  

>Kwal_47.18167
          Length = 227

 Score =  446 bits (1147), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 215/225 (95%), Positives = 215/225 (95%)

Query: 1   MPLTNMKKVRFCLQNETPGPDDSTSQTSSQLPFISSDEVATHTDADDCWISIHGKVYDVS 60
           MPLTNMKKVRFCLQNETPGPDDSTSQTSSQLPFISSDEVATHTDADDCWISIHGKVYDVS
Sbjct: 1   MPLTNMKKVRFCLQNETPGPDDSTSQTSSQLPFISSDEVATHTDADDCWISIHGKVYDVS 60

Query: 61  SYLPQHPGGAQVMLKLAGKDATVPFDEVGHSIESLIYGLGPRACVGILKSRPRAPPVKQQ 120
           SYLPQHPGGAQVMLKLAGKDATVPFDEVGHSIESLIYGLGPRACVGILKSRPRAPPVKQQ
Sbjct: 61  SYLPQHPGGAQVMLKLAGKDATVPFDEVGHSIESLIYGLGPRACVGILKSRPRAPPVKQQ 120

Query: 121 PLAATHNKQWEHTCAWKEESLLQPQFCFAEANSASKDLGFTISAPYCSDALLNRRLXXXX 180
           PLAATHNKQWEHTCAWKEESLLQPQFCFAEANSASKDLGFTISAPYCSDALLNRRL    
Sbjct: 121 PLAATHNKQWEHTCAWKEESLLQPQFCFAEANSASKDLGFTISAPYCSDALLNRRLTTVA 180

Query: 181 XXXXXXLCISILLYMKLRYPSMMEYAVYHALPDELLIDDYEIPAW 225
                 LCISILLYMKLRYPSMMEYAVYHALPDELLIDDYEIPAW
Sbjct: 181 TVVVMVLCISILLYMKLRYPSMMEYAVYHALPDELLIDDYEIPAW 225

>KLLA0F27577g 2556662..2557180 some similarities with sp|Q9M5B0
           Petunia hybrida Cytochrome b5 DIF-F, hypothetical start
          Length = 172

 Score =  105 bits (262), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 59/77 (76%)

Query: 32  PFISSDEVATHTDADDCWISIHGKVYDVSSYLPQHPGGAQVMLKLAGKDATVPFDEVGHS 91
           P I+ DEVA H+   DCW  IHGKVYD++S+L +HPGGAQV+LK AGKD+T+ FD++GHS
Sbjct: 4   PLITMDEVARHSSRSDCWTVIHGKVYDITSFLHKHPGGAQVLLKYAGKDSTLQFDDIGHS 63

Query: 92  IESLIYGLGPRACVGIL 108
           +ESL Y L P A  G L
Sbjct: 64  MESLAYDLDPGALKGTL 80

>ADL085C [1656] [Homologous to NOHBY] (535296..536117) [822 bp, 273
           aa]
          Length = 273

 Score =  101 bits (251), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 43/76 (56%), Positives = 58/76 (76%)

Query: 31  LPFISSDEVATHTDADDCWISIHGKVYDVSSYLPQHPGGAQVMLKLAGKDATVPFDEVGH 90
           L  IS +EV+ HT  DDCW  IHG+VYD++  L  HPGG +++LK AG+DAT+PFD+VGH
Sbjct: 90  LRKISIEEVSQHTSRDDCWFIIHGRVYDITGLLENHPGGTKILLKYAGRDATLPFDDVGH 149

Query: 91  SIESLIYGLGPRACVG 106
           S+ESLIY + P + +G
Sbjct: 150 SMESLIYDMAPGSYLG 165

>Scas_666.12
          Length = 121

 Score = 72.0 bits (175), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 31/61 (50%), Positives = 44/61 (72%)

Query: 35 SSDEVATHTDADDCWISIHGKVYDVSSYLPQHPGGAQVMLKLAGKDATVPFDEVGHSIES 94
          S  ++A H   DD WI I GKVYDVS +L +HPGG +++ +LAG+DAT  F ++GHS ++
Sbjct: 6  SYQQIAEHNKPDDAWIIIEGKVYDVSKFLDEHPGGDEIIFELAGQDATEHFLDIGHSDDA 65

Query: 95 L 95
          L
Sbjct: 66 L 66

>KLLA0F23672g 2212223..2212594 some similarities with sp|P40312
          Saccharomyces cerevisiae YNL111c CYB5 cytochrome b5
          singleton, hypothetical start
          Length = 123

 Score = 68.6 bits (166), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 26/58 (44%), Positives = 43/58 (74%)

Query: 38 EVATHTDADDCWISIHGKVYDVSSYLPQHPGGAQVMLKLAGKDATVPFDEVGHSIESL 95
          EV+ H   DD W+ I GKVYD + ++ +HPGG ++++ L G+DAT PF+++GHS +++
Sbjct: 9  EVSEHKTVDDLWMIIDGKVYDCTKFVDEHPGGDEILVDLGGQDATGPFEDIGHSDDAI 66

>AFL223W [2972] [Homologous to ScYNL111C (CYB5) - SH]
           complement(19601..20098) [498 bp, 165 aa]
          Length = 165

 Score = 68.2 bits (165), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 27/58 (46%), Positives = 43/58 (74%)

Query: 38  EVATHTDADDCWISIHGKVYDVSSYLPQHPGGAQVMLKLAGKDATVPFDEVGHSIESL 95
           E+A H   +D W+ I+GKVYD + +  +HPGG +V++ LAG+DAT PF ++GHS +++
Sbjct: 48  EIAEHNSENDLWLIINGKVYDCTKFAEEHPGGDEVLIDLAGQDATEPFADIGHSDDAV 105

>Kwal_26.8461
          Length = 123

 Score = 65.9 bits (159), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 42/61 (68%)

Query: 35 SSDEVATHTDADDCWISIHGKVYDVSSYLPQHPGGAQVMLKLAGKDATVPFDEVGHSIES 94
          S  E+A H    D W+ I GKVYD + ++ +HPGG +V++ L G+DAT PF ++GHS ++
Sbjct: 6  SYKEIAEHNTEKDLWMIIDGKVYDCTKFMDEHPGGEEVLVDLGGQDATGPFADIGHSDDA 65

Query: 95 L 95
          +
Sbjct: 66 V 66

>Sklu_2444.3 , Contig c2444 10960-12654
          Length = 564

 Score = 69.3 bits (168), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 68/136 (50%), Gaps = 15/136 (11%)

Query: 34  ISSDEVATHTDADDCWISIHGKVYDVSSYLPQHPGGAQVMLKLAGKDATVPF-----DEV 88
           I+ DEV  H + DDCWI ++G VYD++ ++  HPGGA  ++++AG+DAT  F     DEV
Sbjct: 88  ITVDEVKLHNNIDDCWIVLNGDVYDITEFIKIHPGGAARLMEVAGRDATEKFHMIHSDEV 147

Query: 89  GHSIESLIYGLGPRAC-----VGILKSRPRAPPVKQQPLAATHN-KQWEHTCAWKEESLL 142
              ++  I  +G         V   + R +    K  PL+A  N   +EH      + +L
Sbjct: 148 LEKMKEYITLVGKLEGEFSNEVSEEELRIQELRAKMPPLSAIFNGSDFEHVA----KKVL 203

Query: 143 QPQFCFAEANSASKDL 158
            P   F  A  AS + 
Sbjct: 204 SPSTYFYYATGASDEF 219

>CAGL0L03828g 440663..441028 similar to sp|P40312 Saccharomyces
          cerevisiae YNL111c CYB5, start by similarity
          Length = 121

 Score = 64.3 bits (155), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 27/58 (46%), Positives = 39/58 (67%)

Query: 38 EVATHTDADDCWISIHGKVYDVSSYLPQHPGGAQVMLKLAGKDATVPFDEVGHSIESL 95
          +V+ H    DCWI I G VYDVS +L +HPGG +++ +  G DAT  F ++GHS ++L
Sbjct: 9  QVSEHNKEGDCWIIIDGSVYDVSKFLDEHPGGDEIIFEHRGTDATGDFVDIGHSDDAL 66

>YNL111C (CYB5) [4482] chr14 complement(416940..417302) Cytochrome
          b5 [363 bp, 120 aa]
          Length = 120

 Score = 64.3 bits (155), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 29/61 (47%), Positives = 41/61 (67%)

Query: 35 SSDEVATHTDADDCWISIHGKVYDVSSYLPQHPGGAQVMLKLAGKDATVPFDEVGHSIES 94
          S  EVA H   ++ WI I  KVYDVS +  +HPGG ++++ L G+DAT  F ++GHS E+
Sbjct: 6  SYQEVAEHNGPENFWIIIDDKVYDVSQFKDEHPGGDEIIMDLGGQDATESFVDIGHSDEA 65

Query: 95 L 95
          L
Sbjct: 66 L 66

>KLLA0A12111g 1053506..1054216 some similarities with sp|P09437
           Hansenula anomala Cytochrome B2, mitochondrial precursor
           (EC 1.1.2.3) (L-lactate dehydrogenase [Cytochrome])
           (L-lactate ferricytochrome C oxidoreductase) (L-LCR),
           hypothetical start
          Length = 236

 Score = 66.2 bits (160), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 26/58 (44%), Positives = 38/58 (65%)

Query: 34  ISSDEVATHTDADDCWISIHGKVYDVSSYLPQHPGGAQVMLKLAGKDATVPFDEVGHS 91
           +S  EV +H   DDCWI I G VYD++ +L +HPGG   +++ AG+DAT  F ++  S
Sbjct: 81  VSVKEVKSHNRIDDCWIVIDGDVYDITGFLSKHPGGVTRLMEFAGRDATERFHQMHSS 138

>CAGL0K03069g complement(284361..284945) weakly similar to sp|Q04772
           Saccharomyces cerevisiae YMR073c, hypothetical start
          Length = 194

 Score = 63.5 bits (153), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 28/55 (50%), Positives = 41/55 (74%), Gaps = 1/55 (1%)

Query: 34  ISSDEVATHTDADDCWISIHGKVYDVSSYLPQHPGGAQVML-KLAGKDATVPFDE 87
           I + E+A H  A+DCW  I+GKVY +SSYL  HPGGA++++ K +G+D+TV F+ 
Sbjct: 119 IDAHELARHNTAEDCWTVINGKVYSISSYLSFHPGGAKILIDKSSGQDSTVLFNR 173

>Scas_571.2
          Length = 602

 Score = 65.1 bits (157), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 37/91 (40%), Positives = 52/91 (57%), Gaps = 4/91 (4%)

Query: 22  DSTSQTSSQLP---FISSDEVATHTDADDCWISIHGKVYDVSSYLPQHPGGAQVMLKLAG 78
           +S  Q  S+L     I   EVA H    DCWI I+G VYD++S++P HPGGA ++   AG
Sbjct: 74  NSEIQNESKLAPKRVIDPSEVARHNTPADCWIVINGVVYDLTSFIPVHPGGADIIKSNAG 133

Query: 79  KDATVPFDEVGHSIESLIYGLGPRACVGILK 109
           KD T  F+ + H+   +   L P+  +G LK
Sbjct: 134 KDVTAIFEPI-HAPGVIEKYLPPKCRIGTLK 163

>Scas_571.1d
          Length = 609

 Score = 64.7 bits (156), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 43/66 (65%)

Query: 21  DDSTSQTSSQLPFISSDEVATHTDADDCWISIHGKVYDVSSYLPQHPGGAQVMLKLAGKD 80
           +D   + SS    IS+DEV  H   +DCWI I+G+VYD++S++  HPGG+ ++   AGKD
Sbjct: 82  NDVKLELSSTKSPISTDEVTKHNSENDCWIVINGQVYDLTSFMSIHPGGSDIIKLNAGKD 141

Query: 81  ATVPFD 86
            +  F+
Sbjct: 142 VSAIFN 147

>YML054C (CYB2) [3916] chr13 complement(165533..167308) Cytochrome
           b2 [L-(+)-lactate cytochrome c oxidoreductase],
           catalyzes the conversion of L-lactate to pyruvate [1776
           bp, 591 aa]
          Length = 591

 Score = 64.3 bits (155), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 28/53 (52%), Positives = 35/53 (66%)

Query: 34  ISSDEVATHTDADDCWISIHGKVYDVSSYLPQHPGGAQVMLKLAGKDATVPFD 86
           IS  EVA H   DDCW+ I+G VYD++ +LP HPGG  V+   AGKD T  F+
Sbjct: 91  ISPAEVAKHNKPDDCWVVINGYVYDLTRFLPNHPGGQDVIKFNAGKDVTAIFE 143

>KLLA0B14795g 1299429..1301099 similar to sp|P00175 Saccharomyces
           cerevisiae YML054c CYB2 lactate dehydrogenase cytochrome
           b2 singleton, start by similarity
          Length = 556

 Score = 63.9 bits (154), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 34/52 (65%)

Query: 34  ISSDEVATHTDADDCWISIHGKVYDVSSYLPQHPGGAQVMLKLAGKDATVPF 85
           +S  EV  H   DDCWI I  +VYD++ +L QHPGG   +++ AG+DAT  F
Sbjct: 81  VSVKEVKMHNRIDDCWIVIDNEVYDITKFLSQHPGGVARLMEFAGRDATERF 132

>Kwal_23.2823
          Length = 560

 Score = 61.6 bits (148), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 31/74 (41%), Positives = 45/74 (60%), Gaps = 1/74 (1%)

Query: 38  EVATHTDADDCWISIHGKVYDVSSYLPQHPGGAQVMLKLAGKDATVPFDEVGHSIESLIY 97
           EV  H   +DCWI ++ +VYDV+S++  HPGG Q +L++AG DAT  F ++ HS + L  
Sbjct: 85  EVMLHNKLNDCWIVLNDEVYDVTSFIAAHPGGVQRILEVAGSDATEKFYQI-HSEDVLNK 143

Query: 98  GLGPRACVGILKSR 111
                  VG LK +
Sbjct: 144 MKEKLVYVGKLKGK 157

>Scas_696.36
          Length = 426

 Score = 60.5 bits (145), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 40/67 (59%), Gaps = 1/67 (1%)

Query: 17  TPGPDDSTSQTSSQLPFISSDEVATHTDADDCWISIHG-KVYDVSSYLPQHPGGAQVMLK 75
           T   +  +S  S  L   S D+VA H   +DCW++++  K+YDVS +L  HP G + +LK
Sbjct: 41  TTRRNQMSSNVSKTLELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILK 100

Query: 76  LAGKDAT 82
            AGKD T
Sbjct: 101 HAGKDIT 107

>Kwal_27.10332
          Length = 378

 Score = 60.1 bits (144), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 37/56 (66%), Gaps = 1/56 (1%)

Query: 28 SSQLPFISSDEVATHTDADDCWISIHG-KVYDVSSYLPQHPGGAQVMLKLAGKDAT 82
          +  LP  S+ +V  H  ADDCW+++   K+YDV+ +L  HPGG  ++++ AGKD T
Sbjct: 3  TKTLPLYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDIT 58

>CAGL0K10736g 1045298..1047079 highly similar to sp|P00175
           Saccharomyces cerevisiae YML054c CYB2 lactate
           dehydrogenase cytochrome b2, hypothetical start
          Length = 593

 Score = 59.7 bits (143), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 48/87 (55%), Gaps = 1/87 (1%)

Query: 25  SQTSSQLPFISSDEVATHTDADDCWISIHGKVYDVSSYLPQHPGGAQVMLKLAGKDATVP 84
           ++  S  P IS  EV  H   +DCW+ I G VYD+++++  HPGG  ++   AGKD T  
Sbjct: 81  AKFDSSKPKISPSEVIKHNTPEDCWVVIDGYVYDLTNFIALHPGGPDIIKTNAGKDVTAI 140

Query: 85  FDEVGHSIESLIYGLGPRACVGILKSR 111
           FD + H  +++   + P   +G L  +
Sbjct: 141 FDPI-HPPDAIEKYIKPEQHIGPLDGK 166

>AAL183W [4] [Homologous to ScYMR272C (SCS7) - SH]
          complement(13713..14846) [1134 bp, 377 aa]
          Length = 377

 Score = 58.2 bits (139), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 27/58 (46%), Positives = 35/58 (60%), Gaps = 1/58 (1%)

Query: 26 QTSSQLPFISSDEVATHTDADDCWISI-HGKVYDVSSYLPQHPGGAQVMLKLAGKDAT 82
            S  LP  S   +  HTD   CW+S+ + K+YDVS +L +HPGG Q +L  AGKD T
Sbjct: 1  MVSKTLPLYSKATLQKHTDRTSCWVSVGNRKIYDVSQFLDEHPGGDQYILDYAGKDIT 58

>KLLA0D01639g complement(146344..147489) similar to sp|Q03529
          Saccharomyces cerevisiae YMR272c SCS7 required for
          hydroxylation of ceramide singleton, start by
          similarity
          Length = 381

 Score = 57.8 bits (138), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 38/57 (66%), Gaps = 1/57 (1%)

Query: 27 TSSQLPFISSDEVATHTDADDCWISIHG-KVYDVSSYLPQHPGGAQVMLKLAGKDAT 82
          +S  LP  S  ++  H D +DCW+S++  K+Y+V+ +L +HPGGA+ +L  AG D T
Sbjct: 3  SSRILPLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDIT 59

>Kwal_14.807
          Length = 578

 Score = 57.8 bits (138), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 34/53 (64%)

Query: 34  ISSDEVATHTDADDCWISIHGKVYDVSSYLPQHPGGAQVMLKLAGKDATVPFD 86
           I   EVA H+  DDCW+ I+G VYD+S ++  HPGG  ++   AGKD +  F+
Sbjct: 79  IRPQEVAKHSKPDDCWVVINGYVYDLSDFIAVHPGGPAIIKANAGKDVSAIFN 131

>YMR272C (SCS7) [4226] chr13 complement(809622..810776) Ceramide
          hydroxylase that hydroxylates the C-26 fatty-acyl
          moiety of inositol-phosphorylceramide [1155 bp, 384 aa]
          Length = 384

 Score = 57.4 bits (137), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 36/60 (60%), Gaps = 1/60 (1%)

Query: 24 TSQTSSQLPFISSDEVATHTDADDCWISIHG-KVYDVSSYLPQHPGGAQVMLKLAGKDAT 82
          ++ TS  L   S   V  H  A+DCW++    K+YDV+ +L +HPGG + +L  AGKD T
Sbjct: 2  STNTSKTLELFSKKTVQEHNTANDCWVTYQNRKIYDVTRFLSEHPGGDESILDYAGKDIT 61

>Sklu_2258.5 YML054C, Contig c2258 8274-10016 reverse complement
          Length = 580

 Score = 57.4 bits (137), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 48/88 (54%), Gaps = 2/88 (2%)

Query: 21  DDSTSQTSSQLPFISSDEVATHTDADDCWISIHGKVYDVSSYLPQHPGGAQVMLKLAGKD 80
           ++ T   SS+ P I   +VA H D  DCW+ I G VYD++ ++  HPGG  ++   AGKD
Sbjct: 69  ENGTVTDSSKKP-IDPQDVAKHNDPKDCWVVIDGYVYDLTEFIHSHPGGPTIIENNAGKD 127

Query: 81  ATVPFDEVGHSIESLIYGLGPRACVGIL 108
            T  F  + H+ + +   + P   +G L
Sbjct: 128 VTAIFGPI-HAPDVIEKYIAPEKRIGPL 154

>KLLA0D02640g complement(225482..227251) gi|5262950|emb|CAB45871.1
           Kluyveromyces lactis cytochrome b2, start by similarity
          Length = 589

 Score = 55.1 bits (131), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 33/54 (61%)

Query: 32  PFISSDEVATHTDADDCWISIHGKVYDVSSYLPQHPGGAQVMLKLAGKDATVPF 85
           P +S  EVA H+   DCW+ I G VY+++ ++  HPGG  ++   AGKD T  F
Sbjct: 88  PKVSPTEVAKHSSPKDCWVVIEGYVYNLTDFISAHPGGPAIIENNAGKDVTKIF 141

>Kwal_26.8046
          Length = 198

 Score = 52.4 bits (124), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 36/55 (65%), Gaps = 1/55 (1%)

Query: 34  ISSDEVATHTDADDCWISIHGKVYDVSSYLPQHPGGAQVMLK-LAGKDATVPFDE 87
           I+  ++A H   +DCW  I+ KVY +SSYL  HPGG  +++K  AGKD T  F++
Sbjct: 123 INKAQLAQHKAPEDCWCVINQKVYCISSYLDFHPGGVDILMKGAAGKDCTSMFNK 177

>Scas_717.14
          Length = 189

 Score = 52.4 bits (124), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 27/59 (45%), Positives = 36/59 (61%), Gaps = 3/59 (5%)

Query: 32  PF--ISSDEVATHTDADDCWISIHGKVYDVSSYLPQHPGGAQVMLK-LAGKDATVPFDE 87
           PF  I++  +  HT   DCW    GKVY VS YL  HPGG  ++ +  AGKD+TV F++
Sbjct: 109 PFLKINNSILQRHTSRTDCWTIYKGKVYCVSDYLEYHPGGPDIIFQNCAGKDSTVLFNQ 167

>YMR073C (YMR073C) [4032] chr13 complement(412267..412872) Protein
           containing a heme-binding domain, has a region of
           moderate similarity to a region of flavohemoprotein
           b5+b5R (human b5&b5R), which is an NAD(P)H
           oxidoreductase that may act as an oxygen sensor [606 bp,
           201 aa]
          Length = 201

 Score = 45.8 bits (107), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 27/45 (60%)

Query: 46  DDCWISIHGKVYDVSSYLPQHPGGAQVMLKLAGKDATVPFDEVGH 90
           D+ W  I+GKVYD+SSYL  HPGG  +++K    D  + +    H
Sbjct: 138 DELWCVINGKVYDISSYLKFHPGGTDILIKHRNSDDLITYFNKYH 182

>KLLA0C05566g complement(497877..499310) similar to sp|P21147
           Saccharomyces cerevisiae YGL055w OLE1 stearoyl-CoA
           desaturase singleton, start by similarity
          Length = 477

 Score = 46.2 bits (108), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 33/58 (56%)

Query: 29  SQLPFISSDEVATHTDADDCWISIHGKVYDVSSYLPQHPGGAQVMLKLAGKDATVPFD 86
           S+LP    DE      +++  + I G V+DVS Y+ +HPGG  ++    GKDAT  F+
Sbjct: 377 SKLPVWDKDEFMEKLKSNNGLVVISGIVHDVSGYITEHPGGETLIQASLGKDATKAFN 434

>KLLA0E18535g 1641507..1641953 some similarities with
           ca|CA1511|IPF9972.3eoc Candida albicans unknown
           function, 3-prime end, hypothetical start
          Length = 148

 Score = 44.7 bits (104), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 33/56 (58%)

Query: 32  PFISSDEVATHTDADDCWISIHGKVYDVSSYLPQHPGGAQVMLKLAGKDATVPFDE 87
           P +  ++ A   + D+ W  I+ KVY + +YL  HPGG  ++ + AGKD T  F++
Sbjct: 68  PPLRVNKEALKANKDNFWCVINRKVYCIKAYLSYHPGGEVILKQCAGKDVTSLFNK 123

>AAR153C [341] [Homologous to ScYGL055W (OLE1) - SH]
           (619953..621389) [1437 bp, 478 aa]
          Length = 478

 Score = 45.8 bits (107), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 40/80 (50%), Gaps = 5/80 (6%)

Query: 12  CLQNETPGPDDSTSQTS-----SQLPFISSDEVATHTDADDCWISIHGKVYDVSSYLPQH 66
            +Q +    D++ S+ +     SQLP     E    +  +   + I G V+DVS Y+ +H
Sbjct: 354 LIQQKQKKLDNARSRLNWGTPLSQLPVWDRSEFVRASRENSGLVVISGIVHDVSGYITEH 413

Query: 67  PGGAQVMLKLAGKDATVPFD 86
           PGG  ++    GKDAT  F+
Sbjct: 414 PGGETLIQAALGKDATRAFN 433

>Scas_563.6
          Length = 497

 Score = 45.4 bits (106), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 32/59 (54%)

Query: 27  TSSQLPFISSDEVATHTDADDCWISIHGKVYDVSSYLPQHPGGAQVMLKLAGKDATVPF 85
           T  +LP     E       +   + I G ++D+S+Y+P+HPGG  ++ +  GKDAT  F
Sbjct: 392 TLDELPVWDKKEFVEQAQLNKNLVVISGIIHDISNYIPEHPGGESLIKQALGKDATRAF 450

>CAGL0F03399g complement(333955..335097) highly similar to
          sp|Q03529 Saccharomyces cerevisiae YMR272c SCS7
          required for hydroxylation of ceramide, hypothetical
          start
          Length = 380

 Score = 45.1 bits (105), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 31/60 (51%), Gaps = 2/60 (3%)

Query: 25 SQTSSQLPFISSDEVATHTDADDCWISIH-GKVYDVSSYLPQHPGGAQVMLK-LAGKDAT 82
          + +S  L       +A H   DDCW+S H  K+YDVS YL  HP  A  + K L GK  T
Sbjct: 5  ADSSKTLELFPQSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVHKALDGKHGT 64

>Sklu_2299.3 YGL055W, Contig c2299 5338-6780 reverse complement
          Length = 480

 Score = 44.7 bits (104), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 33/58 (56%)

Query: 29  SQLPFISSDEVATHTDADDCWISIHGKVYDVSSYLPQHPGGAQVMLKLAGKDATVPFD 86
           +QLP    +E      ++   + + G V+DVS Y+ +HPGG  ++   AGKDAT  F+
Sbjct: 377 TQLPVWDKEEFMKSLKSNPGLVIVSGIVHDVSGYITEHPGGETLIQAAAGKDATKAFN 434

>CAGL0I00418g 30058..31530 highly similar to sp|P21147 Saccharomyces
           cerevisiae YGL055w OLE1 stearoyl-CoA desaturase, start
           by similarity
          Length = 490

 Score = 44.3 bits (103), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 32/57 (56%)

Query: 29  SQLPFISSDEVATHTDADDCWISIHGKVYDVSSYLPQHPGGAQVMLKLAGKDATVPF 85
           + LP  + +E       +D  + + G V+DVS Y+ +HPGG +++    GKDAT  F
Sbjct: 384 ADLPAWTKEEFLEKNRENDGLVIVGGIVHDVSGYITEHPGGEKLLKNALGKDATKAF 440

>AAL078W [109] [Homologous to ScYGL055W - NSH]
           complement(209600..211378) [1779 bp, 592 aa]
          Length = 592

 Score = 41.6 bits (96), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 37/62 (59%), Gaps = 5/62 (8%)

Query: 30  QLPFISSDEVAT-----HTDADDCWISIHGKVYDVSSYLPQHPGGAQVMLKLAGKDATVP 84
           +LP I+ ++ AT     + + +   ++I G ++DV+ ++  HPGG  +++   GKDAT  
Sbjct: 465 RLPMITPEQFATVARKDYEEKEKALVAIEGIIHDVTPFMHDHPGGMALVVASVGKDATPA 524

Query: 85  FD 86
           F+
Sbjct: 525 FN 526

>Sklu_2032.3 , Contig c2032 4286-5854
          Length = 522

 Score = 40.8 bits (94), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 47/102 (46%), Gaps = 8/102 (7%)

Query: 30  QLPFISSDEVATHTDAD-----DCWISIHGKVYDVSSYLPQHPGGAQVMLKLAGKDATVP 84
           +LP++S +  A    ++        ++I G V+DV+ ++  HPGG  ++    GKDAT  
Sbjct: 388 RLPYMSPENFAKLAQSEYRTNKRALVAIEGIVHDVTPFIYDHPGGVTLVETSIGKDATAA 447

Query: 85  FDEVGHSIESLIYGLGPRACVGILKSRPRAPPVKQQPLAATH 126
           F+   +S       L     + +L+   R P   QQ +   H
Sbjct: 448 FNGAVYSHSRAARNLLATMRIAVLR---RGPMEVQQTVWEKH 486

>Kwal_14.1845
          Length = 288

 Score = 39.7 bits (91), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 31/58 (53%)

Query: 29  SQLPFISSDEVATHTDADDCWISIHGKVYDVSSYLPQHPGGAQVMLKLAGKDATVPFD 86
           +QLP     +   +   +   + I G V+DVS+Y+ +HPGG  ++     KDAT  F+
Sbjct: 185 TQLPVWDKQQFMENIKTNPGLVIISGIVHDVSNYITEHPGGETLIKAALNKDATKAFN 242

>KLLA0C10692g complement(916718..918280) weakly similar to sp|P21147
           Saccharomyces cerevisiae YGL055w OLE1 stearoyl-CoA
           desaturase singleton, hypothetical start
          Length = 520

 Score = 39.7 bits (91), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 34/60 (56%), Gaps = 3/60 (5%)

Query: 27  TSSQLPFISSDEVATHTDADDCWISIHGKVYDVSSYLPQHPGGAQVMLKLAGKDATVPFD 86
           TS Q   ++ DE   +  A   +++I G V+DV+ ++  HPGG  ++    GKDAT  F+
Sbjct: 391 TSLQFVKLAKDEYIKNRKA---YVAIEGIVHDVTPFIYDHPGGVTLVETSIGKDATQAFN 447

>YGL055W (OLE1) [1924] chr7 (398629..400161) Stearoyl-CoA desaturase
           (delta-9 fatty acid desaturase), required for synthesis
           of unsaturated fatty acids [1533 bp, 510 aa]
          Length = 510

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 28/57 (49%)

Query: 29  SQLPFISSDEVATHTDADDCWISIHGKVYDVSSYLPQHPGGAQVMLKLAGKDATVPF 85
           + LP          +  +   + I G V+DVS Y+ +HPGG  ++    GKDAT  F
Sbjct: 407 TDLPMWDKQTFLAKSKENKGLVIISGIVHDVSGYISEHPGGETLIKTALGKDATKAF 463

>Kwal_23.5693
          Length = 513

 Score = 37.0 bits (84), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 27/43 (62%)

Query: 49  WISIHGKVYDVSSYLPQHPGGAQVMLKLAGKDATVPFDEVGHS 91
           +++I G V+DV+ ++  HPGG  ++    GKDAT  F+   +S
Sbjct: 403 FVAIEGVVHDVTPFIHDHPGGVALVETSIGKDATQAFNGAVYS 445

>YOL007C (YOL007C) [4809] chr15 complement(311342..312367) Protein
           of unknown function [1026 bp, 341 aa]
          Length = 341

 Score = 31.6 bits (70), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 40/84 (47%), Gaps = 11/84 (13%)

Query: 12  CLQNETPGPDDSTSQTSSQLPFISSDEVATHTDADD--CWI-SIHGKVYDVSSYLPQHPG 68
            L N+T   D+  S       FIS  E+   +DA++   W  S    +YD  S  P+ PG
Sbjct: 229 LLNNKTDANDNFRSSM-----FISPTEIL-QSDANNSNTWSQSNESAIYDSLSSTPREPG 282

Query: 69  GAQVMLKLAGKDATVPFDEVGHSI 92
             Q++ K    D+T PF+   +++
Sbjct: 283 ATQILGKFT--DSTNPFNYTSYNL 304

>AGR269W [4580] [Homologous to ScYLR271W - SH]
           complement(1243098..1244072) [975 bp, 324 aa]
          Length = 324

 Score = 30.0 bits (66), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 36/82 (43%), Gaps = 5/82 (6%)

Query: 53  HGKVYDVSSYLPQHPGGAQVMLKLAGKDATV--PFDEVGHSIESLIYGLGPRACVGILKS 110
           HG   D+S+ +P+   G Q+M K+  K   V    D +  ++   +  +G R   GI + 
Sbjct: 87  HGAPVDLSASMPK---GFQMMAKMGYKTGGVLGTGDGLSRALRQPLSAVGQRTRTGIKQR 143

Query: 111 RPRAPPVKQQPLAATHNKQWEH 132
            PRA        +    ++W H
Sbjct: 144 PPRADGEGHPEASVAEYREWLH 165

>AFL079W [3114] [Homologous to NOHBY] complement(290134..291750)
          [1617 bp, 538 aa]
          Length = 538

 Score = 28.9 bits (63), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 31/67 (46%), Gaps = 5/67 (7%)

Query: 31 LPFISSDEVATHTDADDCWISIHGKVYDVSSYLPQHPGGAQVMLKLAGKDATVPFDEVG- 89
          +  +S  EV       +  +     V  +  ++  HPGG + +  + G+DAT   DE+  
Sbjct: 1  MAVLSKSEVEERIANGEVIVIYKSAVLKLDKWIKYHPGGDKAIYHMVGRDAT---DEMNA 57

Query: 90 -HSIESL 95
           HS ES+
Sbjct: 58 YHSDESV 64

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.134    0.421 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,262,511
Number of extensions: 277509
Number of successful extensions: 656
Number of sequences better than 10.0: 48
Number of HSP's gapped: 650
Number of HSP's successfully gapped: 48
Length of query: 225
Length of database: 16,596,109
Length adjustment: 98
Effective length of query: 127
Effective length of database: 13,203,545
Effective search space: 1676850215
Effective search space used: 1676850215
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 59 (27.3 bits)