Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_47.1816352251527400.0
Sklu_2260.352351623110.0
KLLA0F27599g52251520850.0
CAGL0J02882g53052420440.0
Scas_715.4452852620290.0
YER052C (HOM3)52751820140.0
ADL086C55251220150.0
Scas_34.1*23924010061e-135
YDL010W23171900.004
AAL061C420108740.47
CAGL0H01441g42740740.61
Kwal_55.2197345542683.0
CAGL0D03894g48540673.7
CAGL0K03795g129550674.7
Sklu_2105.3948140658.3
CAGL0M13475g920115648.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_47.18163
         (515 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_47.18163                                                        1060   0.0  
Sklu_2260.3 YER052C, Contig c2260 3320-4891 reverse complement        894   0.0  
KLLA0F27599g 2558178..2559746 highly similar to sp|P10869 Saccha...   807   0.0  
CAGL0J02882g complement(277395..278987) highly similar to sp|P10...   791   0.0  
Scas_715.44                                                           786   0.0  
YER052C (HOM3) [1480] chr5 complement(256374..257957) Aspartate ...   780   0.0  
ADL086C [1655] [Homologous to ScYER052C (HOM3) - SH] (533181..53...   780   0.0  
Scas_34.1*                                                            392   e-135
YDL010W (YDL010W) [848] chr4 (432327..433022) Protein predicted ...    39   0.004
AAL061C [126] [Homologous to ScYDR300C (PRO1) - SH; ScYHR033W - ...    33   0.47 
CAGL0H01441g complement(140740..142023) highly similar to sp|P32...    33   0.61 
Kwal_55.21973                                                          31   3.0  
CAGL0D03894g 389509..390966 similar to sp|P32264 Saccharomyces c...    30   3.7  
CAGL0K03795g 349549..353436 similar to sp|Q04217 Saccharomyces c...    30   4.7  
Sklu_2105.3 YEL061C, Contig c2105 5732-8578 reverse complement         30   8.3  
CAGL0M13475g 1324998..1327760 similar to sp|P49955 Saccharomyces...    29   8.9  

>Kwal_47.18163
          Length = 522

 Score = 1060 bits (2740), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 515/515 (100%), Positives = 515/515 (100%)

Query: 1   MSSQTNWIVQKFGGTSVGKFPEQIVNEIVKVYTTKYKNNVAVVCSARSSDTKAEGTTSRL 60
           MSSQTNWIVQKFGGTSVGKFPEQIVNEIVKVYTTKYKNNVAVVCSARSSDTKAEGTTSRL
Sbjct: 1   MSSQTNWIVQKFGGTSVGKFPEQIVNEIVKVYTTKYKNNVAVVCSARSSDTKAEGTTSRL 60

Query: 61  LRACDLVCNSDPAFADVLQKVRDDHISNAKQRITSPDLQQKLIHDTNAELDLVEKYLNAS 120
           LRACDLVCNSDPAFADVLQKVRDDHISNAKQRITSPDLQQKLIHDTNAELDLVEKYLNAS
Sbjct: 61  LRACDLVCNSDPAFADVLQKVRDDHISNAKQRITSPDLQQKLIHDTNAELDLVEKYLNAS 120

Query: 121 QVLGEVSLRTMDLVMSCGEKLSCLFMAALCNEYGVRAQYVDLSSVIPHDYECRQGTLDTS 180
           QVLGEVSLRTMDLVMSCGEKLSCLFMAALCNEYGVRAQYVDLSSVIPHDYECRQGTLDTS
Sbjct: 121 QVLGEVSLRTMDLVMSCGEKLSCLFMAALCNEYGVRAQYVDLSSVIPHDYECRQGTLDTS 180

Query: 181 FYTFLVRAFKEKLAPVLEAHSQGTPVVPVITGFFGLVPMGLLNGVGRGYTDLCAALIAVG 240
           FYTFLVRAFKEKLAPVLEAHSQGTPVVPVITGFFGLVPMGLLNGVGRGYTDLCAALIAVG
Sbjct: 181 FYTFLVRAFKEKLAPVLEAHSQGTPVVPVITGFFGLVPMGLLNGVGRGYTDLCAALIAVG 240

Query: 241 LNADELQVWKEVDGIFTADPRKVPQARLLGSVTPEEASELTYYGSEVIHPFTMEQVIRAK 300
           LNADELQVWKEVDGIFTADPRKVPQARLLGSVTPEEASELTYYGSEVIHPFTMEQVIRAK
Sbjct: 241 LNADELQVWKEVDGIFTADPRKVPQARLLGSVTPEEASELTYYGSEVIHPFTMEQVIRAK 300

Query: 301 IPIRIKNVQNPTGDGTVIYPDNIAKKGESTPPHPPVTLSNSFFEQKKRGATAITSKSDIV 360
           IPIRIKNVQNPTGDGTVIYPDNIAKKGESTPPHPPVTLSNSFFEQKKRGATAITSKSDIV
Sbjct: 301 IPIRIKNVQNPTGDGTVIYPDNIAKKGESTPPHPPVTLSNSFFEQKKRGATAITSKSDIV 360

Query: 361 VVSIHSNKKTLSHGFLAQIFTTLDKYKLVVDLISTSEVHVSMALPVPDVDSSKALKKAVE 420
           VVSIHSNKKTLSHGFLAQIFTTLDKYKLVVDLISTSEVHVSMALPVPDVDSSKALKKAVE
Sbjct: 361 VVSIHSNKKTLSHGFLAQIFTTLDKYKLVVDLISTSEVHVSMALPVPDVDSSKALKKAVE 420

Query: 421 ELKVLGAVELTKKLVIVSLVGKQMKQFIGIAGTMFTTLAEQGINIEMISQGANEINISCV 480
           ELKVLGAVELTKKLVIVSLVGKQMKQFIGIAGTMFTTLAEQGINIEMISQGANEINISCV
Sbjct: 421 ELKVLGAVELTKKLVIVSLVGKQMKQFIGIAGTMFTTLAEQGINIEMISQGANEINISCV 480

Query: 481 IDEEDALKALQSIHSKLLDLDSDVGLGKAVNEKLE 515
           IDEEDALKALQSIHSKLLDLDSDVGLGKAVNEKLE
Sbjct: 481 IDEEDALKALQSIHSKLLDLDSDVGLGKAVNEKLE 515

>Sklu_2260.3 YER052C, Contig c2260 3320-4891 reverse complement
          Length = 523

 Score =  894 bits (2311), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/516 (83%), Positives = 473/516 (91%), Gaps = 1/516 (0%)

Query: 1   MSSQTNWIVQKFGGTSVGKFPEQIVNEIVKVYTTKYKNNVAVVCSARSSDTKAEGTTSRL 60
           M  ++NWIVQKFGGTSVGKFPEQIV +IVKVYTT+Y+NNVAVVCSARSS TKAEGTTSRL
Sbjct: 1   MFEKSNWIVQKFGGTSVGKFPEQIVEQIVKVYTTQYENNVAVVCSARSSYTKAEGTTSRL 60

Query: 61  LRACDLVCNSDPAFADVLQKVRDDHISNAKQRITSPDLQQKLIHDTNAELDLVEKYLNAS 120
           L AC+L  N+DP F DVLQ VR+DH+SNA+++I    LQQKL+ DTNAELDLVEKYL+AS
Sbjct: 61  LNACELAANNDPTFTDVLQLVRNDHVSNAQEKIKDSTLQQKLVKDTNAELDLVEKYLSAS 120

Query: 121 QVLGEVSLRTMDLVMSCGEKLSCLFMAALCNEYGVRAQYVDLSSVIPHDYECRQGTLDTS 180
           Q+LGEVS RTMDLVMSCGEKLSCLFMAALCN+ GV AQYVDLS V+P DYEC+ G+LD +
Sbjct: 121 QILGEVSSRTMDLVMSCGEKLSCLFMAALCNDLGVPAQYVDLSFVVPTDYECKDGSLDNN 180

Query: 181 FYTFLVRAFKEKLAPVLEAHSQGTPVVPVITGFFGLVPMGLLNGVGRGYTDLCAALIAVG 240
           FYTFLV AFKE L PVL++HS G PVVPVITGFFGLVPMGLLNGVGRGYTDLCAALIAVG
Sbjct: 181 FYTFLVNAFKEALQPVLKSHSIGKPVVPVITGFFGLVPMGLLNGVGRGYTDLCAALIAVG 240

Query: 241 LNADELQVWKEVDGIFTADPRKVPQARLLGSVTPEEASELTYYGSEVIHPFTMEQVIRAK 300
           LNADELQVWKEVDGIFTADPRKVPQARLL SVTPEEASELTYYGSEVIHPFTMEQVIRAK
Sbjct: 241 LNADELQVWKEVDGIFTADPRKVPQARLLSSVTPEEASELTYYGSEVIHPFTMEQVIRAK 300

Query: 301 IPIRIKNVQNPTGDGTVIYPDNIAKKGESTPPHPPVTLSNSFFEQKKRGATAITSKSDIV 360
           IPIRIKNVQNPTG+GTVIYPDNIAKKGESTPPHPPVTL++SFFE K+RGATAIT+K+DIV
Sbjct: 301 IPIRIKNVQNPTGEGTVIYPDNIAKKGESTPPHPPVTLTSSFFETKRRGATAITTKNDIV 360

Query: 361 VVSIHSNKKTLSHGFLAQIFTTLDKYKLVVDLISTSEVHVSMALPVPDVDSSKALKKAVE 420
           V++IHSNKKTLSHGFLAQIF+ LDKYKLVVDLISTSEVHVSMALPVPD +SS+ALK AVE
Sbjct: 361 VLNIHSNKKTLSHGFLAQIFSVLDKYKLVVDLISTSEVHVSMALPVPDAESSRALKSAVE 420

Query: 421 ELKVLGAVELTKKLVIVSLVGKQMKQFIGIAGTMFTTLAEQGINIEMISQGANEINISCV 480
           EL  LG+++LTKK+ IVSLVGKQMKQFIGIAGTMFTTLAEQ INIEMISQGANEINISCV
Sbjct: 421 ELNRLGSIDLTKKMAIVSLVGKQMKQFIGIAGTMFTTLAEQNINIEMISQGANEINISCV 480

Query: 481 IDEEDALKALQSIHSKLLDLDS-DVGLGKAVNEKLE 515
           IDE+D++KALQSIH+KLLD +S  +    AVNE+LE
Sbjct: 481 IDEQDSIKALQSIHAKLLDENSGSLDFEHAVNERLE 516

>KLLA0F27599g 2558178..2559746 highly similar to sp|P10869
           Saccharomyces cerevisiae YER052c HOM3 L-aspartate
           4-P-transferase singleton, start by similarity
          Length = 522

 Score =  807 bits (2085), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/515 (74%), Positives = 446/515 (86%)

Query: 1   MSSQTNWIVQKFGGTSVGKFPEQIVNEIVKVYTTKYKNNVAVVCSARSSDTKAEGTTSRL 60
           M   +NW+VQKFGGTS+GKF +QIVNEI+KVY+ +Y NNVAVVCSARSS TKAEGTTSRL
Sbjct: 1   MIETSNWVVQKFGGTSIGKFSKQIVNEIIKVYSQEYDNNVAVVCSARSSYTKAEGTTSRL 60

Query: 61  LRACDLVCNSDPAFADVLQKVRDDHISNAKQRITSPDLQQKLIHDTNAELDLVEKYLNAS 120
           L ACDL  N++  + +VL  V  DH++NA++ +    +Q+ LI DT  E+++V +YL+AS
Sbjct: 61  LLACDLASNNNYEYKNVLDLVERDHVANAEESVKDITIQETLIEDTKREINIVRRYLDAS 120

Query: 121 QVLGEVSLRTMDLVMSCGEKLSCLFMAALCNEYGVRAQYVDLSSVIPHDYECRQGTLDTS 180
           QVLGEVS RT+DLVMS GEKLSCL++ ALC + GV A+YVDLS ++P DYEC++GTLD S
Sbjct: 121 QVLGEVSTRTLDLVMSLGEKLSCLYVTALCQDNGVNARYVDLSFIVPSDYECKEGTLDNS 180

Query: 181 FYTFLVRAFKEKLAPVLEAHSQGTPVVPVITGFFGLVPMGLLNGVGRGYTDLCAALIAVG 240
           FYTFLV AF+EKL+P+L+    GT ++PVITGFFG+VPMGLLNGVGRGYTDLCAALIAV 
Sbjct: 181 FYTFLVTAFREKLSPILKETENGTKIIPVITGFFGVVPMGLLNGVGRGYTDLCAALIAVA 240

Query: 241 LNADELQVWKEVDGIFTADPRKVPQARLLGSVTPEEASELTYYGSEVIHPFTMEQVIRAK 300
           LNADELQVWKEVDGIFTADPRKVPQARLL +VTP+EA+ELTYYGSEVIHPFTMEQVIR  
Sbjct: 241 LNADELQVWKEVDGIFTADPRKVPQARLLDTVTPDEAAELTYYGSEVIHPFTMEQVIRTH 300

Query: 301 IPIRIKNVQNPTGDGTVIYPDNIAKKGESTPPHPPVTLSNSFFEQKKRGATAITSKSDIV 360
           IPIRIKNVQNP G+GT+IYP + AKKGESTPPHPPV L++S FE KK+GATAIT+KSDIV
Sbjct: 301 IPIRIKNVQNPKGNGTIIYPSDQAKKGESTPPHPPVALTSSIFESKKKGATAITTKSDIV 360

Query: 361 VVSIHSNKKTLSHGFLAQIFTTLDKYKLVVDLISTSEVHVSMALPVPDVDSSKALKKAVE 420
           VV+IHSNKKTLSHGFLA++F+TLDKYKLVVDLISTSEVHVSMALPVPD DS KAL+ AVE
Sbjct: 361 VVNIHSNKKTLSHGFLAEMFSTLDKYKLVVDLISTSEVHVSMALPVPDSDSLKALRCAVE 420

Query: 421 ELKVLGAVELTKKLVIVSLVGKQMKQFIGIAGTMFTTLAEQGINIEMISQGANEINISCV 480
           ELK LG V++ KK+ IVSLVGKQMKQF+GIAGTMFTTLAEQ INIEMISQGANEINISCV
Sbjct: 421 ELKRLGTVDVIKKMAIVSLVGKQMKQFVGIAGTMFTTLAEQHINIEMISQGANEINISCV 480

Query: 481 IDEEDALKALQSIHSKLLDLDSDVGLGKAVNEKLE 515
           IDE +A++ALQSIH+KLLD   +     AVNE+LE
Sbjct: 481 IDESNAVRALQSIHAKLLDSPQNENFESAVNERLE 515

>CAGL0J02882g complement(277395..278987) highly similar to sp|P10869
           Saccharomyces cerevisiae YER052c HOM3, hypothetical
           start
          Length = 530

 Score =  791 bits (2044), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/524 (74%), Positives = 450/524 (85%), Gaps = 16/524 (3%)

Query: 2   SSQTNWIVQKFGGTSVGKFPEQIVNEIVKVYTTK-----YKNNVAVVCSARSSDTKAEGT 56
           S+ +NW+VQKFGGTSVGKFP QIV+EIVK Y++      + N+VAVVCSARSS TK EGT
Sbjct: 6   SATSNWVVQKFGGTSVGKFPVQIVDEIVKYYSSSKQDGGFDNDVAVVCSARSSYTKQEGT 65

Query: 57  TSRLLRACDLVCNSDPAFADVLQKVRDDHISNAKQRITSPDLQQKLIHDTNAELDLVEKY 116
           TSRLL+ CDL  + D  ++D+++ +R DH+SNA++ +    L  KLI DTN EL LV+KY
Sbjct: 66  TSRLLKCCDL-ASQDQEYSDIIETIRQDHVSNAERFLEDSPLVAKLIDDTNKELALVDKY 124

Query: 117 LNASQVLGEVSLRTMDLVMSCGEKLSCLFMAALCNEYGVRAQYVDLSSVIPHDYECRQGT 176
           L+AS+VLGEVS RT+DLVMSCGEKLSCLF+ ALCN+ G +A+YVDLS+V+P DY+    T
Sbjct: 125 LSASKVLGEVSNRTIDLVMSCGEKLSCLFITALCNDRGCKAKYVDLSNVVPSDYQTT--T 182

Query: 177 LDTSFYTFLVRAFKEKLAPVLEAHSQGTPVVPVITGFFGLVPMGLLNGVGRGYTDLCAAL 236
           LDTSFYTFLV+A KEKL P + +  +   +VPV TGFFG +PMGLLNGVGRGYTDLCAAL
Sbjct: 183 LDTSFYTFLVQALKEKLEPFVNSKER---IVPVFTGFFGFIPMGLLNGVGRGYTDLCAAL 239

Query: 237 IAVGLNADELQVWKEVDGIFTADPRKVPQARLLGSVTPEEASELTYYGSEVIHPFTMEQV 296
           IAV LNADELQVWKEVDGIFTADPRKVPQARLL SVTPEEASELTYYGSEVIHPFTMEQV
Sbjct: 240 IAVALNADELQVWKEVDGIFTADPRKVPQARLLDSVTPEEASELTYYGSEVIHPFTMEQV 299

Query: 297 IRAKIPIRIKNVQNPTGDGTVIYPDNIAKKGESTPPHPPVTLSNSFFEQKKRGATAITSK 356
           IRAKIPIRIKNVQNP G+GT+IYPDN+AKKGESTPPHPP  LS++FFE+K+RGATAIT+K
Sbjct: 300 IRAKIPIRIKNVQNPKGNGTIIYPDNVAKKGESTPPHPPEALSSTFFEKKRRGATAITTK 359

Query: 357 SDIVVVSIHSNKKTLSHGFLAQIFTTLDKYKLVVDLISTSEVHVSMALPVPDVDSSKALK 416
           +DIVV+++HSNKKTLSHGFLAQIFT LDKYKLVVDLISTSEVHVSMALP+PD DS KAL+
Sbjct: 360 NDIVVLNVHSNKKTLSHGFLAQIFTVLDKYKLVVDLISTSEVHVSMALPIPDSDSMKALR 419

Query: 417 KAVEELKVLGAVELTKKLVIVSLVGKQMKQFIGIAGTMFTTLAEQGINIEMISQGANEIN 476
            AVE+LK LG+V++ KK+ IVSLVGKQMKQFIGIAGTMFTTLAEQGINIEMISQGANEIN
Sbjct: 420 SAVEKLKPLGSVDIIKKMSIVSLVGKQMKQFIGIAGTMFTTLAEQGINIEMISQGANEIN 479

Query: 477 ISCVIDEEDALKALQSIHSKLLDLDSDVGLG-----KAVNEKLE 515
           ISCVIDE D++KALQSIH KLLD   + G G     KAV+E+LE
Sbjct: 480 ISCVIDEMDSIKALQSIHKKLLDELPENGSGSEQFEKAVDERLE 523

>Scas_715.44
          Length = 528

 Score =  786 bits (2029), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/526 (73%), Positives = 446/526 (84%), Gaps = 17/526 (3%)

Query: 1   MSSQTNWIVQKFGGTSVGKFPEQIVNEIVKVYT----TKYKNNVAVVCSARSSDTKAEGT 56
           +S  +NW+VQKFGGTSVGKFP QIV++I+K Y+      Y NNVAVVCSARSS TKAEGT
Sbjct: 2   LSPPSNWVVQKFGGTSVGKFPVQIVDDIIKFYSDPSNKTYNNNVAVVCSARSSYTKAEGT 61

Query: 57  TSRLLRACDLVCNSDPAFADVLQKVRDDHISNAKQRITSPDLQQKLIHDTNAELDLVEKY 116
           TSRLLR CDL  + +  F D+++ ++ DHI NA++ +  P LQ KLI DT  EL LV+KY
Sbjct: 62  TSRLLRCCDL-ASQEMEFNDIIEVIKADHIDNAERYVQDPVLQTKLIADTTKELTLVKKY 120

Query: 117 LNASQVLGEVSLRTMDLVMSCGEKLSCLFMAALCNEYGVRAQYVDLSSVIPHDYECRQGT 176
           L+AS++LGEVS RT+DLVMS GEKLSCLFM AL N+ G +A+YVDL+ ++P DY      
Sbjct: 121 LDASKILGEVSTRTIDLVMSVGEKLSCLFMTALLNDRGCKAKYVDLTHIVPSDYNAT--V 178

Query: 177 LDTSFYTFLVRAFKEKLAPVLEAHSQGTPVVPVITGFFGLVPMGLLNGVGRGYTDLCAAL 236
           LD SFYTFL +AFKEKL P +E+  +   V+PV TGFFGLVPMGLLNGVGRGYTDLCAAL
Sbjct: 179 LDNSFYTFLFQAFKEKLQPFIESKER---VIPVFTGFFGLVPMGLLNGVGRGYTDLCAAL 235

Query: 237 IAVGLNADELQVWKEVDGIFTADPRKVPQARLLGSVTPEEASELTYYGSEVIHPFTMEQV 296
           IAV +NADELQVWKEVDGIFTADPRKVPQARLL SVTPEEASELTYYGSEVIHPFTMEQV
Sbjct: 236 IAVAVNADELQVWKEVDGIFTADPRKVPQARLLASVTPEEASELTYYGSEVIHPFTMEQV 295

Query: 297 IRAKIPIRIKNVQNPTGDGTVIYPDNIAKKGESTPPHPPVTLSNSFFEQKKRGATAITSK 356
           I+AKIPIRIKNVQNP G+GT+IYPDNIAKKGESTPPHPP TLS+SFFE++KRGATAIT+K
Sbjct: 296 IQAKIPIRIKNVQNPRGEGTIIYPDNIAKKGESTPPHPPETLSSSFFERRKRGATAITTK 355

Query: 357 SDIVVVSIHSNKKTLSHGFLAQIFTTLDKYKLVVDLISTSEVHVSMALPVPDVDSSKALK 416
           +DIVV++IHSNKKTLSHGFLAQIFT LDK+KLVVDLISTSEVHVSMALP+PD +S K+L+
Sbjct: 356 NDIVVINIHSNKKTLSHGFLAQIFTILDKFKLVVDLISTSEVHVSMALPIPDSESHKSLR 415

Query: 417 KAVEELKVLGAVELTKKLVIVSLVGKQMKQFIGIAGTMFTTLAEQGINIEMISQGANEIN 476
           +AVE+L+VLG V++TKK+ IVSLVGKQMKQFIGIAGTMFTTLAEQGINIEMISQGANEIN
Sbjct: 416 QAVEKLRVLGHVDVTKKMAIVSLVGKQMKQFIGIAGTMFTTLAEQGINIEMISQGANEIN 475

Query: 477 ISCVIDEEDALKALQSIHSKLLDLD-------SDVGLGKAVNEKLE 515
           ISCVIDE D+LKALQSIH+KLLD         +      A+NE+LE
Sbjct: 476 ISCVIDETDSLKALQSIHAKLLDAHEASLEEMTTGNFEHAINERLE 521

>YER052C (HOM3) [1480] chr5 complement(256374..257957) Aspartate
           kinase (L-aspartate 4-P-transferase), catalyzes the
           first step in the common pathway for methionine and
           threonine biosynthesis [1584 bp, 527 aa]
          Length = 527

 Score =  780 bits (2014), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/518 (73%), Positives = 444/518 (85%), Gaps = 10/518 (1%)

Query: 2   SSQTNWIVQKFGGTSVGKFPEQIVNEIVKVYTTK--YKNNVAVVCSARSSDTKAEGTTSR 59
           SS +NW+VQKFGGTSVGKFP QIV++IVK Y+      NNVAVVCSARSS TKAEGTTSR
Sbjct: 9   SSHSNWVVQKFGGTSVGKFPVQIVDDIVKHYSKPDGPNNNVAVVCSARSSYTKAEGTTSR 68

Query: 60  LLRACDLVCNSDPAFADVLQKVRDDHISNAKQRITSPDLQQKLIHDTNAELDLVEKYLNA 119
           LL+ CDL  + +  F D+++ +R DHI NA + I +P LQ KL+ DTN EL+LV+KYLNA
Sbjct: 69  LLKCCDLA-SQESEFQDIIEVIRQDHIDNADRFILNPALQAKLVDDTNKELELVKKYLNA 127

Query: 120 SQVLGEVSLRTMDLVMSCGEKLSCLFMAALCNEYGVRAQYVDLSSVIPHDYECRQGTLDT 179
           S+VLGEVS RT+DLVMSCGEKLSCLFM ALCN+ G +A+YVDLS ++P D+      LD 
Sbjct: 128 SKVLGEVSSRTVDLVMSCGEKLSCLFMTALCNDRGCKAKYVDLSHIVPSDFSA--SALDN 185

Query: 180 SFYTFLVRAFKEKLAPVLEAHSQGTPVVPVITGFFGLVPMGLLNGVGRGYTDLCAALIAV 239
           SFYTFLV+A KEKLAP + A  +   +VPV TGFFGLVP GLLNGVGRGYTDLCAALIAV
Sbjct: 186 SFYTFLVQALKEKLAPFVSAKER---IVPVFTGFFGLVPTGLLNGVGRGYTDLCAALIAV 242

Query: 240 GLNADELQVWKEVDGIFTADPRKVPQARLLGSVTPEEASELTYYGSEVIHPFTMEQVIRA 299
            +NADELQVWKEVDGIFTADPRKVP+ARLL SVTPEEASELTYYGSEVIHPFTMEQVIRA
Sbjct: 243 AVNADELQVWKEVDGIFTADPRKVPEARLLDSVTPEEASELTYYGSEVIHPFTMEQVIRA 302

Query: 300 KIPIRIKNVQNPTGDGTVIYPDNIAKKGESTPPHPPVTLSNSFFEQKKRGATAITSKSDI 359
           KIPIRIKNVQNP G+GT+IYPDN+AKKGESTPPHPP  LS+SF+E++KRGATAIT+K+DI
Sbjct: 303 KIPIRIKNVQNPLGNGTIIYPDNVAKKGESTPPHPPENLSSSFYEKRKRGATAITTKNDI 362

Query: 360 VVVSIHSNKKTLSHGFLAQIFTTLDKYKLVVDLISTSEVHVSMALPVPDVDSSKALKKAV 419
            V++IHSNKKTLSHGFLAQIFT LDKYKLVVDLISTSEVHVSMALP+PD DS K+L++A 
Sbjct: 363 FVINIHSNKKTLSHGFLAQIFTILDKYKLVVDLISTSEVHVSMALPIPDADSLKSLRQAE 422

Query: 420 EELKVLGAVELTKKLVIVSLVGKQMKQFIGIAGTMFTTLAEQGINIEMISQGANEINISC 479
           E+L++LG+V++TKKL IVSLVGK MKQ+IGIAGTMFTTLAE+GINIEMISQGANEINISC
Sbjct: 423 EKLRILGSVDITKKLSIVSLVGKHMKQYIGIAGTMFTTLAEEGINIEMISQGANEINISC 482

Query: 480 VIDEEDALKALQSIHSKLLDLDSDVG--LGKAVNEKLE 515
           VI+E D++KALQ IH+KLL   ++       A++E+LE
Sbjct: 483 VINESDSIKALQCIHAKLLSERTNTSNQFEHAIDERLE 520

>ADL086C [1655] [Homologous to ScYER052C (HOM3) - SH]
           (533181..534839) [1659 bp, 552 aa]
          Length = 552

 Score =  780 bits (2015), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/512 (73%), Positives = 441/512 (86%)

Query: 4   QTNWIVQKFGGTSVGKFPEQIVNEIVKVYTTKYKNNVAVVCSARSSDTKAEGTTSRLLRA 63
           +TNW+VQKFGGTS+GKFP  IVN+IVKV++  Y  NVAVVCSARSS TK+EGTTSRLL A
Sbjct: 33  KTNWVVQKFGGTSIGKFPTNIVNDIVKVFSHDYGKNVAVVCSARSSYTKSEGTTSRLLMA 92

Query: 64  CDLVCNSDPAFADVLQKVRDDHISNAKQRITSPDLQQKLIHDTNAELDLVEKYLNASQVL 123
           CD   + D  F D+++ +R+DH+ NA   I   +++ +L+  TN ELD VE+YL ASQ+L
Sbjct: 93  CDAAASYDETFQDIVRVIREDHVENASHHIKDAEIRVRLVEQTNDELDQVERYLQASQIL 152

Query: 124 GEVSLRTMDLVMSCGEKLSCLFMAALCNEYGVRAQYVDLSSVIPHDYECRQGTLDTSFYT 183
           GEVS RTMDLVMS GEKLSCLF+ ALC + GV A+YVD SS++P D+ C +G+LD SFY 
Sbjct: 153 GEVSNRTMDLVMSVGEKLSCLFLTALCEDCGVTAEYVDFSSIVPTDFRCAEGSLDNSFYA 212

Query: 184 FLVRAFKEKLAPVLEAHSQGTPVVPVITGFFGLVPMGLLNGVGRGYTDLCAALIAVGLNA 243
            LV AFKE+LA +++A+ +G  +VPVITGFFGL+PMGLLNGVGRGYTDLCAAL+AV LNA
Sbjct: 213 LLVVAFKERLAQIVQANKEGKRIVPVITGFFGLLPMGLLNGVGRGYTDLCAALVAVALNA 272

Query: 244 DELQVWKEVDGIFTADPRKVPQARLLGSVTPEEASELTYYGSEVIHPFTMEQVIRAKIPI 303
           DELQVWKEVDGIFTADPRKVPQARLL +VTPEEA+ELTYYGSEVIHPFTMEQVIRAKIPI
Sbjct: 273 DELQVWKEVDGIFTADPRKVPQARLLETVTPEEAAELTYYGSEVIHPFTMEQVIRAKIPI 332

Query: 304 RIKNVQNPTGDGTVIYPDNIAKKGESTPPHPPVTLSNSFFEQKKRGATAITSKSDIVVVS 363
           RIKNVQNPTGDGTVIY DNIAKKGESTPPHPP+++S+SFFEQ+KRGATAIT+K+DIVV++
Sbjct: 333 RIKNVQNPTGDGTVIYADNIAKKGESTPPHPPISVSSSFFEQRKRGATAITTKNDIVVLN 392

Query: 364 IHSNKKTLSHGFLAQIFTTLDKYKLVVDLISTSEVHVSMALPVPDVDSSKALKKAVEELK 423
           IHSNKKTLSHGFLAQIFT LD YKL+VDLISTSEVHVSMALPVPD DS ++L+ AVEELK
Sbjct: 393 IHSNKKTLSHGFLAQIFTILDNYKLIVDLISTSEVHVSMALPVPDSDSQRSLRNAVEELK 452

Query: 424 VLGAVELTKKLVIVSLVGKQMKQFIGIAGTMFTTLAEQGINIEMISQGANEINISCVIDE 483
            LG V+L KK+ IVSLVGKQMK FIGIAG MFTTL+EQ INIEMISQGANEINISCVIDE
Sbjct: 453 KLGTVDLIKKMAIVSLVGKQMKHFIGIAGAMFTTLSEQNINIEMISQGANEINISCVIDE 512

Query: 484 EDALKALQSIHSKLLDLDSDVGLGKAVNEKLE 515
           +++++ALQSIH+KLL+  +    G  +N +LE
Sbjct: 513 KNSVRALQSIHAKLLEPLAPTSSGAVLNGRLE 544

>Scas_34.1*
          Length = 239

 Score =  392 bits (1006), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 188/240 (78%), Positives = 207/240 (86%), Gaps = 1/240 (0%)

Query: 57  TSRLLRACDLVCNSDPAFADVLQKVRDDHISNAKQRITSPDLQQKLIHDTNAELDLVEKY 116
           TSRLL AC+L  N+DP F DVLQ VR+DH+SNA+++I    LQQKL+ DTNAELDLVEKY
Sbjct: 1   TSRLLNACELAANNDPTFTDVLQLVRNDHVSNAQEKIKDSTLQQKLVKDTNAELDLVEKY 60

Query: 117 LNASQVLGEVSLRTMDLVMSCGEKLSCLFMAALCNEYGVRAQYVDLSSVIPHDYECRQGT 176
           L+ASQ+LGEVS RTMDLVMSCGEKLSCLFMAALCN+ GV AQYVDLS V+P DYEC+ G+
Sbjct: 61  LSASQILGEVSSRTMDLVMSCGEKLSCLFMAALCNDLGVPAQYVDLSFVVPTDYECKDGS 120

Query: 177 LDTSFYTFLVRAFKEKLAPVLEAHSQGTPVVPVITGFFGLVPMGLLNGVGRGYTDLCAAL 236
           LD +FYTFLV AFKE L PVL++HS G PVVPVITGFFGLVPMGLLNGVGRGYTDLCAAL
Sbjct: 121 LDNNFYTFLVNAFKEALQPVLKSHSIGKPVVPVITGFFGLVPMGLLNGVGRGYTDLCAAL 180

Query: 237 IAVGLNADELQVWKEVDGIFTADPRKVPQARLLGSVTPEEASELTYYGSEVIHPFTMEQV 296
           IAVGLNADELQVWKEVDGIFTADPR+  +   L SVTPE A  LTYYGS VIHPFTMEQV
Sbjct: 181 IAVGLNADELQVWKEVDGIFTADPRRFLKQDCLSSVTPERAL-LTYYGSGVIHPFTMEQV 239

>YDL010W (YDL010W) [848] chr4 (432327..433022) Protein predicted to
           have structural similarity to disulfide oxidoreductases
           [696 bp, 231 aa]
          Length = 231

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 36/71 (50%), Gaps = 6/71 (8%)

Query: 197 LEAHSQGTPV---VPVITGFFGLVPMGLLNGVGRGYTDLCAALIAVGLNADELQVWKEVD 253
           L+ H  G  +   + ++TG  G VP  L+NGV RG  +    L   G   + LQVW   D
Sbjct: 161 LDKHGHGEELQEYIKLVTGR-GTVPNLLVNGVSRGGNEEIKKLHTQGKLLESLQVWS--D 217

Query: 254 GIFTADPRKVP 264
           G F+ + R+ P
Sbjct: 218 GKFSVEQREKP 228

>AAL061C [126] [Homologous to ScYDR300C (PRO1) - SH; ScYHR033W - SH]
           (239518..240780) [1263 bp, 420 aa]
          Length = 420

 Score = 33.1 bits (74), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 49/108 (45%), Gaps = 15/108 (13%)

Query: 174 QGTLDTSFYTFLVRAFKEKLAPVLEAHSQ---GTPVVPVITGFFGLVPMGL--------- 221
           QG L  + +  L R F EK+A +L   +     +        F  L+ MG+         
Sbjct: 84  QGRL-IARWDSLFRPFNEKIAQILLTRNDIVDWSQYKNAQNTFHELLAMGVTPIVNENDT 142

Query: 222 --LNGVGRGYTDLCAALIAVGLNADELQVWKEVDGIFTADPRKVPQAR 267
             ++GV  G  D  +A+ A  + AD L +  +VD ++T +PR  P A+
Sbjct: 143 LSISGVKFGDNDTLSAITAGLIGADYLFLMTDVDCLYTDNPRTNPDAK 190

>CAGL0H01441g complement(140740..142023) highly similar to sp|P32264
           Saccharomyces cerevisiae YDR300c PRO1 glutamate
           5-kinase, hypothetical start
          Length = 427

 Score = 33.1 bits (74), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 25/40 (62%)

Query: 228 GYTDLCAALIAVGLNADELQVWKEVDGIFTADPRKVPQAR 267
           G  D  +A+ A  ++AD L +  +VD ++TADPR  P A+
Sbjct: 154 GDNDTLSAITAGLIHADYLFLLTDVDCLYTADPRSDPDAK 193

>Kwal_55.21973
          Length = 455

 Score = 30.8 bits (68), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 21/42 (50%), Gaps = 1/42 (2%)

Query: 326 KGESTPPHPPVTLSNSFFEQKKRGATAITSKSDIVVVSIHSN 367
           K +   PHPP  L   F+ +KK+    +T K D+   S H N
Sbjct: 6   KRQHLDPHPP-RLQCEFYLEKKKRRCGMTRKQDVAYCSEHFN 46

>CAGL0D03894g 389509..390966 similar to sp|P32264 Saccharomyces
           cerevisiae YDR300c PRO1 or sp|P38690 Saccharomyces
           cerevisiae YHR033w, hypothetical start
          Length = 485

 Score = 30.4 bits (67), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 24/40 (60%)

Query: 228 GYTDLCAALIAVGLNADELQVWKEVDGIFTADPRKVPQAR 267
           G  D  +A+ A  ++AD L +  +VD ++T +PR  P A+
Sbjct: 146 GDNDTLSAITAALVSADHLFLLTDVDCLYTENPRTNPDAK 185

>CAGL0K03795g 349549..353436 similar to sp|Q04217 Saccharomyces
           cerevisiae YMR128w ECM16, start by similarity
          Length = 1295

 Score = 30.4 bits (67), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 29/50 (58%), Gaps = 3/50 (6%)

Query: 398 VHVSMALPVPDVDSSKALKKAVEELKVLGAVELTKKLVIVSLVGKQMKQF 447
           +H  +  P P     ++LKKA+E L+ LGA++  +K   V+  GK+M  F
Sbjct: 894 IHNIVNFPFPTPPDKESLKKAIELLQYLGALDDKEK---VTEDGKKMSLF 940

>Sklu_2105.3 YEL061C, Contig c2105 5732-8578 reverse complement
          Length = 948

 Score = 29.6 bits (65), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 36/140 (25%), Positives = 66/140 (47%), Gaps = 20/140 (14%)

Query: 35  KYKNNVAVVCSARSSDTKAEGTTSRLLRACD---LVCNSDPAFADVLQKVRDDHISNAKQ 91
           ++KN   +VC+  +    A  T    L+ C+   L C S+    DVL     DH+++ KQ
Sbjct: 534 QHKNEQDLVCTIHTL-KDAIYTVQNSLKNCEDYQLQCKSE--MEDVLY----DHVTSFKQ 586

Query: 92  RITSPDLQQKLIHDT-----NAELDLVEKYLNASQVLGEVSLRTMDLVMSCGEKLSCLFM 146
            I       K  H +     +  +D++++ L  SQVL  +   ++D+  SC EK   +  
Sbjct: 587 SIHEQLAAMKASHSSRHLGIDGNIDIIQEEL--SQVLESICSTSVDVCRSCVEK---ILE 641

Query: 147 AALCNEYGVRAQYVDLSSVI 166
           +   +   +R   +D+S+V+
Sbjct: 642 SNPKHFESIRRDLLDISTVV 661

>CAGL0M13475g 1324998..1327760 similar to sp|P49955 Saccharomyces
           cerevisiae YMR288w component of a multiprotein splicing
           factor, hypothetical start
          Length = 920

 Score = 29.3 bits (64), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 29/115 (25%), Positives = 44/115 (38%), Gaps = 17/115 (14%)

Query: 225 VGRGYTDLCAALIAVGLNADELQVWKEVDGIFTADPRKVPQARLLGSVTPEEASELTYYG 284
           + +   DLCAALI V  N DE+ +  ++  I             LG V PE    +    
Sbjct: 566 IRQNAADLCAALIPVISNCDEVVILNKLSIILYES---------LGEVYPEVLGAILAAL 616

Query: 285 SEVIHPFTME-------QVIRAKIPIRIKNVQNPTGDGTVIYPDNIAKKGESTPP 332
             ++H   ++       Q++ +  PI   N        T+     IA KG S  P
Sbjct: 617 ERIVHILNIDTIQPPINQILPSLTPI-FSNANRKVQMNTIRLVGIIALKGPSYAP 670

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.133    0.374 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 15,965,469
Number of extensions: 668990
Number of successful extensions: 2189
Number of sequences better than 10.0: 23
Number of HSP's gapped: 2220
Number of HSP's successfully gapped: 23
Length of query: 515
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 409
Effective length of database: 12,926,601
Effective search space: 5286979809
Effective search space used: 5286979809
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 64 (29.3 bits)