Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_47.181531711708111e-112
KLLA0E04477g1551253822e-47
ADL117W1731183651e-44
Scas_715.27d1741373321e-39
CAGL0J02838g1601353302e-39
YER050C (RSM18)2021193072e-35
CAGL0K03223g59840651.2
YNR056C (BIO5)56137651.4
KLLA0C05104g21073604.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_47.18153
         (170 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_47.18153                                                         317   e-112
KLLA0E04477g complement(409814..410281) some similarities with s...   151   2e-47
ADL117W [1624] [Homologous to ScYER050C (RSM18) - SH] complement...   145   1e-44
Scas_715.27d                                                          132   1e-39
CAGL0J02838g complement(275124..275606) similar to sp|P40033 Sac...   131   2e-39
YER050C (RSM18) [1478] chr5 complement(253970..254578) Component...   122   2e-35
CAGL0K03223g 295542..297338 similar to tr|AAB65072 Saccharomyces...    30   1.2  
YNR056C (BIO5) [4639] chr14 complement(731615..733300) Transmemb...    30   1.4  
KLLA0C05104g complement(462684..463316) similar to sp|P39742 Sac...    28   4.7  

>Kwal_47.18153
          Length = 171

 Score =  317 bits (811), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 155/170 (91%)

Query: 1   MMSMRSCWHGTISTRAFTTGVPRFNLSFKIKLTPNEKSQINVKAKESGSSASQNKKIDPR 60
           MMSMRSCWHGTISTRAFTTGVPRFNLSFKIKLTPNEKSQINVKAKESGSSASQNKKIDPR
Sbjct: 1   MMSMRSCWHGTISTRAFTTGVPRFNLSFKIKLTPNEKSQINVKAKESGSSASQNKKIDPR 60

Query: 61  LVKKFQSGTTYDPFDFSLARLHXXXXXXXXXXXXXXXEKNGVDPLDLYTNPEFLSQFVTS 120
           LVKKFQSGTTYDPFDFSLARLH               EKNGVDPLDLYTNPEFLSQFVTS
Sbjct: 61  LVKKFQSGTTYDPFDFSLARLHLDKKFSSKNSSNDLFEKNGVDPLDLYTNPEFLSQFVTS 120

Query: 121 SGKILHRDVTGLSAKNQRRLSKAIRRCQAIGLMSKTHRDVSFLPSRIMGK 170
           SGKILHRDVTGLSAKNQRRLSKAIRRCQAIGLMSKTHRDVSFLPSRIMGK
Sbjct: 121 SGKILHRDVTGLSAKNQRRLSKAIRRCQAIGLMSKTHRDVSFLPSRIMGK 170

>KLLA0E04477g complement(409814..410281) some similarities with
           sp|P40033 Saccharomyces cerevisiae YER050c RSM18
           component of the mitochondrial ribosomal small subunit
           singleton, hypothetical start
          Length = 155

 Score =  151 bits (382), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 75/125 (60%), Positives = 91/125 (72%), Gaps = 3/125 (2%)

Query: 45  KESGSSASQN---KKIDPRLVKKFQSGTTYDPFDFSLARLHXXXXXXXXXXXXXXXEKNG 101
           KE  S A+     KK++ +L+K FQ G+ Y+PFDFSL R+H                K  
Sbjct: 26  KEGMSEANSKPTIKKLESKLIKNFQPGSVYNPFDFSLERIHLDKKFGVRPGSFDPFNKLK 85

Query: 102 VDPLDLYTNPEFLSQFVTSSGKILHRDVTGLSAKNQRRLSKAIRRCQAIGLMSKTHRDVS 161
           ++PLDLYTNPEFLS+FVTS+GKILHRDVTGLSAKNQRRL+KAI+RCQAIGLMSK H+D+S
Sbjct: 86  INPLDLYTNPEFLSRFVTSTGKILHRDVTGLSAKNQRRLTKAIKRCQAIGLMSKVHKDIS 145

Query: 162 FLPSR 166
            LP R
Sbjct: 146 VLPQR 150

>ADL117W [1624] [Homologous to ScYER050C (RSM18) - SH]
           complement(480459..480980) [522 bp, 173 aa]
          Length = 173

 Score =  145 bits (365), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 66/118 (55%), Positives = 87/118 (73%)

Query: 53  QNKKIDPRLVKKFQSGTTYDPFDFSLARLHXXXXXXXXXXXXXXXEKNGVDPLDLYTNPE 112
           Q KK+ P ++KKF +G+ YDPFDFS+ARLH               E+  +DPLDLYT+P 
Sbjct: 55  QVKKVPPEMMKKFATGSLYDPFDFSMARLHLEKKHRKNARKVDIFEELNLDPLDLYTSPA 114

Query: 113 FLSQFVTSSGKILHRDVTGLSAKNQRRLSKAIRRCQAIGLMSKTHRDVSFLPSRIMGK 170
            LS+FV ++GKILHRDVTGLS ++Q+R+S+A+RRCQAIGLMSKTH+DVS L   +M +
Sbjct: 115 ILSRFVGNTGKILHRDVTGLSVRSQKRMSRAVRRCQAIGLMSKTHKDVSLLSHSVMSE 172

>Scas_715.27d
          Length = 174

 Score =  132 bits (332), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 93/137 (67%), Gaps = 2/137 (1%)

Query: 32  LTPNEKSQINVKAKESGS-SASQNKKIDPRLVKKFQSGTTYDPFDFSLARLHXXXXXXXX 90
           L P  K  IN++  ++ S + S  K ID   VKKFQ G+ YDPFDFS+A+++        
Sbjct: 36  LQPTIKKNINLRESQAKSKTNSSVKAIDEVFVKKFQQGSIYDPFDFSMAKVNLDRKTKSL 95

Query: 91  XXXXXXXEKN-GVDPLDLYTNPEFLSQFVTSSGKILHRDVTGLSAKNQRRLSKAIRRCQA 149
                    +  ++PLDLY++P  L++F++S+GKILHRDVTGLSAKNQRRLSKAI+R Q+
Sbjct: 96  IGTSKTYNISYNINPLDLYSSPSELNKFISSTGKILHRDVTGLSAKNQRRLSKAIKRAQS 155

Query: 150 IGLMSKTHRDVSFLPSR 166
           IGL+SKTH+ V  LP R
Sbjct: 156 IGLLSKTHKHVDALPRR 172

>CAGL0J02838g complement(275124..275606) similar to sp|P40033
           Saccharomyces cerevisiae YER050c RSM18, hypothetical
           start
          Length = 160

 Score =  131 bits (330), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 70/135 (51%), Positives = 88/135 (65%), Gaps = 4/135 (2%)

Query: 30  IKLTPNEKSQINVKAKESGSSASQNKKIDPRLVKKFQSGTTYDPFDFSLARLHXXXXXXX 89
           + + P +KS I+V  + S  +    K I+   V +FQ    YDPFDFSL+RL+       
Sbjct: 28  VDMRPKKKSVIDVDFEGSRENI---KTINANFVPQFQRSAVYDPFDFSLSRLNLDRKMNR 84

Query: 90  -XXXXXXXXEKNGVDPLDLYTNPEFLSQFVTSSGKILHRDVTGLSAKNQRRLSKAIRRCQ 148
                    EK G++PL+ Y  PE LS +V S+GKILHRDVTGLSAKNQRR++KAIRRCQ
Sbjct: 85  PKIQHHDLFEKYGLNPLNFYARPEILSYYVGSTGKILHRDVTGLSAKNQRRMAKAIRRCQ 144

Query: 149 AIGLMSKTHRDVSFL 163
           AIGLMSKTHR  +FL
Sbjct: 145 AIGLMSKTHRFTNFL 159

>YER050C (RSM18) [1478] chr5 complement(253970..254578) Component of
           the mitochondrial ribosomal small subunit [609 bp, 202
           aa]
          Length = 202

 Score =  122 bits (307), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 64/119 (53%), Positives = 77/119 (64%), Gaps = 5/119 (4%)

Query: 36  EKSQINVKAKESGSSASQNKKIDPRLVKKFQSGTTYDPFDFSLARLHXXXXXXXXXXXXX 95
           EK  +N+   E G +  Q KKID  L KK   GT YDPFDFS+ R+H             
Sbjct: 88  EKKSVNI---EMGRT-QQTKKIDQSLSKKLPKGTIYDPFDFSMGRIHLDRKYQANKNSNR 143

Query: 96  X-XEKNGVDPLDLYTNPEFLSQFVTSSGKILHRDVTGLSAKNQRRLSKAIRRCQAIGLM 153
               K+G +PL+ Y  P  LS++VTS+G+I HRD+TGLSAKNQRRLSKAIRRCQAIGLM
Sbjct: 144 NDIMKSGANPLEFYARPRILSRYVTSTGRIQHRDITGLSAKNQRRLSKAIRRCQAIGLM 202

>CAGL0K03223g 295542..297338 similar to tr|AAB65072 Saccharomyces
           cerevisiae YHL019c involved in clathrin-independent
           transport, start by similarity
          Length = 598

 Score = 29.6 bits (65), Expect = 1.2,   Method: Composition-based stats.
 Identities = 15/40 (37%), Positives = 23/40 (57%), Gaps = 1/40 (2%)

Query: 2   MSMRSCWHGTISTRAFTTGVPRFNLSFKIKLTPNEKSQIN 41
           M  RS  HG I  R++ +G+P+  +S   KL  N+K  I+
Sbjct: 281 MVRRSLIHGQIVCRSYLSGMPKLKMSLN-KLLQNDKQFIS 319

>YNR056C (BIO5) [4639] chr14 complement(731615..733300)
           Transmembrane regulator of KAPA/DAPA transport, involved
           in biotin biosynthesis, member of the amino acid
           permease family of membrane transporters [1686 bp, 561
           aa]
          Length = 561

 Score = 29.6 bits (65), Expect = 1.4,   Method: Composition-based stats.
 Identities = 15/37 (40%), Positives = 20/37 (54%), Gaps = 3/37 (8%)

Query: 108 YTNPEFLSQFVTSSGKILHR---DVTGLSAKNQRRLS 141
           Y  P F+  FV    K +HR   DV  +S  N+RR+S
Sbjct: 471 YAVPSFIFLFVIKKEKFIHRIESDVNCVSRPNRRRMS 507

>KLLA0C05104g complement(462684..463316) similar to sp|P39742
           Saccharomyces cerevisiae YLR292c SEC72 ER
           protein-translocation complex subunit singleton, start
           by similarity
          Length = 210

 Score = 27.7 bits (60), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 36/73 (49%), Gaps = 10/73 (13%)

Query: 18  TTGVPRFNLSFKIKLTPNEKSQINVKAK-ESGSSASQNK-------KIDPRLVKKFQSGT 69
           T  VP  N +F+ +  PN ++   VK   +SG   +QNK       K+D  +  + ++  
Sbjct: 52  TALVPETNPNFQPQ--PNNETTNMVKNMFQSGMQQAQNKNIPDALRKVDLAVDMRNKARK 109

Query: 70  TYDPFDFSLARLH 82
            ++PF F L  LH
Sbjct: 110 PWEPFSFQLQELH 122

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.131    0.378 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 4,611,513
Number of extensions: 160429
Number of successful extensions: 523
Number of sequences better than 10.0: 11
Number of HSP's gapped: 520
Number of HSP's successfully gapped: 11
Length of query: 170
Length of database: 16,596,109
Length adjustment: 94
Effective length of query: 76
Effective length of database: 13,342,017
Effective search space: 1013993292
Effective search space used: 1013993292
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 58 (26.9 bits)