Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_47.1815141440920960.0
Sklu_2174.241339514490.0
ADL116C43536213270.0
CAGL0L00869g41940612171e-166
KLLA0E04455g42138411191e-151
YIL042C3943809491e-126
Scas_704.444434448431e-109
Kwal_14.18254924032259e-20
AAR157C5034182133e-18
AER270W4892742001e-16
KLLA0F27423g5122811877e-15
Scas_563.94922861832e-14
YGL059W4912871813e-14
CAGL0F07007g4852831804e-14
Sklu_2299.65304341804e-14
KLLA0C05654g4732811771e-13
Scas_698.14118381840.027
KLLA0A00638g1155103820.047
AFR284W1103105820.050
YIL147C (SLN1)122081760.29
Scas_671.16723144750.34
CAGL0H06567g116979720.74
Sklu_2226.7795145720.81
Kwal_55.19707114381720.87
YOL062C (APM4)49146691.6
Scas_689.1850480664.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_47.18151
         (409 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_47.18151                                                         811   0.0  
Sklu_2174.2 YIL042C, Contig c2174 576-1817 reverse complement         562   0.0  
ADL116C [1625] [Homologous to ScYIL042C - SH] (481045..482352) [...   515   0.0  
CAGL0L00869g complement(105236..106495) similar to sp|P40530 Sac...   473   e-166
KLLA0E04455g 408415..409680 similar to sp|P40530 Saccharomyces c...   435   e-151
YIL042C (YIL042C) [2625] chr9 complement(275107..276291) Protein...   370   e-126
Scas_704.44                                                           329   e-109
Kwal_14.1825                                                           91   9e-20
AAR157C [345] [Homologous to ScYGL059W - SH] (627130..628641) [1...    87   3e-18
AER270W [2772] [Homologous to NOHBY] complement(1131292..1132761...    82   1e-16
KLLA0F27423g complement(2537353..2538891) similar to ca|CA5524|I...    77   7e-15
Scas_563.9                                                             75   2e-14
YGL059W (YGL059W) [1920] chr7 (392226..393701) Protein with simi...    74   3e-14
CAGL0F07007g 687174..688631 highly similar to sp|P53170 Saccharo...    74   4e-14
Sklu_2299.6 YGL059W, Contig c2299 10909-12501 reverse complement       74   4e-14
KLLA0C05654g complement(504568..505989) similar to sp|P53170 Sac...    73   1e-13
Scas_698.14                                                            37   0.027
KLLA0A00638g complement(60378..63845) gi|5531277|emb|CAB50891.1 ...    36   0.047
AFR284W [3476] [Homologous to ScYIL147C (SLN1) - SH] complement(...    36   0.050
YIL147C (SLN1) [2530] chr9 complement(69791..73453) Two-componen...    34   0.29 
Scas_671.16                                                            33   0.34 
CAGL0H06567g 645707..649216 similar to sp|P39928 Saccharomyces c...    32   0.74 
Sklu_2226.7 YIL095W, Contig c2226 8986-11373                           32   0.81 
Kwal_55.19707                                                          32   0.87 
YOL062C (APM4) [4757] chr15 complement(210519..211994) Clathrin-...    31   1.6  
Scas_689.18                                                            30   4.4  

>Kwal_47.18151
          Length = 414

 Score =  811 bits (2096), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/409 (96%), Positives = 393/409 (96%)

Query: 1   MMFPGKMLTAVRGFSRLRYTRKAFHNGLHTLRPLQKVHGKSSLREMLREVGFEELYRIRS 60
           MMFPGKMLTAVRGFSRLRYTRKAFHNGLHTLRPLQKVHGKSSLREMLREVGFEELYRIRS
Sbjct: 1   MMFPGKMLTAVRGFSRLRYTRKAFHNGLHTLRPLQKVHGKSSLREMLREVGFEELYRIRS 60

Query: 61  NTELLIQDFAKKPIPAISYEFLTQYKVPLTDNEKYMLTIQTVNLLLTYTCRRLVAIQKLP 120
           NTELLIQDFAKKPIPAISYEFLTQYKVPLTDNEKYMLTIQTVNLLLTYTCRRLVAIQKLP
Sbjct: 61  NTELLIQDFAKKPIPAISYEFLTQYKVPLTDNEKYMLTIQTVNLLLTYTCRRLVAIQKLP 120

Query: 121 YIAVLNPNIEETXXXXXXXXXXXXXXXXPYGLHDQEVMAKKLTEFLDDHQDTLLTLSRGF 180
           YIAVLNPNIEET                PYGLHDQEVMAKKLTEFLDDHQDTLLTLSRGF
Sbjct: 121 YIAVLNPNIEETNRLYLRTLESLLSLNYPYGLHDQEVMAKKLTEFLDDHQDTLLTLSRGF 180

Query: 181 QEIMEFFPKESVFEFLNSHLRDRISMKLLATHYLAIVSQTSRDDRVIGVLHREMKISELV 240
           QEIMEFFPKESVFEFLNSHLRDRISMKLLATHYLAIVSQTSRDDRVIGVLHREMKISELV
Sbjct: 181 QEIMEFFPKESVFEFLNSHLRDRISMKLLATHYLAIVSQTSRDDRVIGVLHREMKISELV 240

Query: 241 CRVEEFVGDLCYVKYDQQVPIKILEGEDVTFPCIPTDLEYVLTELLKNSSRAHIEGSTSD 300
           CRVEEFVGDLCYVKYDQQVPIKILEGEDVTFPCIPTDLEYVLTELLKNSSRAHIEGSTSD
Sbjct: 241 CRVEEFVGDLCYVKYDQQVPIKILEGEDVTFPCIPTDLEYVLTELLKNSSRAHIEGSTSD 300

Query: 301 NNTAEKPVEVTIVRKDNDLKIRIRDFGGGIPPVVEDRMFDYSYSTVNTDAKDSGMSAYVI 360
           NNTAEKPVEVTIVRKDNDLKIRIRDFGGGIPPVVEDRMFDYSYSTVNTDAKDSGMSAYVI
Sbjct: 301 NNTAEKPVEVTIVRKDNDLKIRIRDFGGGIPPVVEDRMFDYSYSTVNTDAKDSGMSAYVI 360

Query: 361 PGADVCNVSGMGFGLPMCKAYMEMFNGTLDIQSLWGWGTDAYIYLKGPD 409
           PGADVCNVSGMGFGLPMCKAYMEMFNGTLDIQSLWGWGTDAYIYLKGPD
Sbjct: 361 PGADVCNVSGMGFGLPMCKAYMEMFNGTLDIQSLWGWGTDAYIYLKGPD 409

>Sklu_2174.2 YIL042C, Contig c2174 576-1817 reverse complement
          Length = 413

 Score =  562 bits (1449), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/395 (68%), Positives = 316/395 (80%), Gaps = 7/395 (1%)

Query: 16  RLRYTRKAFHNGLHTLRPLQKVHGKSSLREMLREVGFEELYRIRSNTELLIQDFAKKPIP 75
           RLR++  A      +L      H       +L  +GFE+LY+IRS+ ELLIQD+A KPIP
Sbjct: 20  RLRFSTTA------SLTIKHSSHHNRRNERLLSGLGFEQLYQIRSSIELLIQDYANKPIP 73

Query: 76  AISYEFLTQYKVPLTDNEKYMLTIQTVNLLLTYTCRRLVAIQKLP-YIAVLNPNIEETXX 134
           AISYE+L+ YK PLTDNEKY+L I+TVNLLL YTCRRL AIQKL  YIAV+NPN+EE+  
Sbjct: 74  AISYEYLSMYKPPLTDNEKYVLVIKTVNLLLAYTCRRLAAIQKLSXYIAVVNPNVEESNR 133

Query: 135 XXXXXXXXXXXXXXPYGLHDQEVMAKKLTEFLDDHQDTLLTLSRGFQEIMEFFPKESVFE 194
                         PYGLHDQE M  KLT+FLDDHQDTL+TLSRGF+E+MEF+ +E+VFE
Sbjct: 134 LYLKTLESLLSIDFPYGLHDQEAMVTKLTKFLDDHQDTLITLSRGFEEVMEFYQQEAVFE 193

Query: 195 FLNSHLRDRISMKLLATHYLAIVSQTSRDDRVIGVLHREMKISELVCRVEEFVGDLCYVK 254
           FLN HLRDRISMKLL THYLA+V Q  ++   IGVLH+ +KISEL+ RVEEFVGDLC+VK
Sbjct: 194 FLNQHLRDRISMKLLVTHYLALVQQQDKNSPAIGVLHKNLKISELIHRVEEFVGDLCFVK 253

Query: 255 YDQQVPIKILEGEDVTFPCIPTDLEYVLTELLKNSSRAHIEGSTSDNNTAEKPVEVTIVR 314
           YD+QVP+KIL G DVTFPCIPTDLEYVLTE+LKNSSRAHIE ST + +  EKP+EVTIVR
Sbjct: 254 YDRQVPVKILYGADVTFPCIPTDLEYVLTEILKNSSRAHIENSTKERDLTEKPIEVTIVR 313

Query: 315 KDNDLKIRIRDFGGGIPPVVEDRMFDYSYSTVNTDAKDSGMSAYVIPGADVCNVSGMGFG 374
            D DL+IRIRDFGGGIPP VEDRMF+YSYSTV  + KD+GMSAYVIPG +V NVSGMGFG
Sbjct: 314 SDCDLEIRIRDFGGGIPPEVEDRMFEYSYSTVQANTKDTGMSAYVIPGEEVNNVSGMGFG 373

Query: 375 LPMCKAYMEMFNGTLDIQSLWGWGTDAYIYLKGPD 409
           LPMCKAY+EMF+G+LDIQSL+GWGTD YI LKGP+
Sbjct: 374 LPMCKAYLEMFDGSLDIQSLYGWGTDVYIKLKGPE 408

>ADL116C [1625] [Homologous to ScYIL042C - SH] (481045..482352)
           [1308 bp, 435 aa]
          Length = 435

 Score =  515 bits (1327), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 242/362 (66%), Positives = 292/362 (80%), Gaps = 1/362 (0%)

Query: 47  LREVGFEELYRIRSNTELLIQDFAKKPIPAISYEFLTQYKVPLTDNEKYMLTIQTVNLLL 106
           L ++ FE+LY++RSN E+LIQD+AK+ IP I+YEFLT+Y  PL+DNE++ML+I+ +N+LL
Sbjct: 66  LSQLSFEQLYQLRSNLEMLIQDYAKREIPRITYEFLTEYVPPLSDNERFMLSIKVLNMLL 125

Query: 107 TYTCRRLVAIQKLPYIAVLNPNIEETXXXXXXXXXXXXXXXXPYGLHDQEVMAKKLTEFL 166
           TYTCRRL+A+Q+LPYIAV+NPNIEE+                PYGLHD   M +KL  FL
Sbjct: 126 TYTCRRLLALQRLPYIAVINPNIEESNRLYLKTLESLLAIELPYGLHDHAAMREKLITFL 185

Query: 167 DDHQDTLLTLSRGFQEIMEFFPKESVFEFLNSHLRDRISMKLLATHYLAIVSQTSRDDRV 226
           DDH DTL+TLS+GF+EIM+F+P++ VF+FLN HLRDR+SMKLL THYL +V Q+S  D  
Sbjct: 186 DDHGDTLVTLSKGFEEIMDFYPQQKVFDFLNIHLRDRLSMKLLVTHYLRLVEQSSGAD-C 244

Query: 227 IGVLHREMKISELVCRVEEFVGDLCYVKYDQQVPIKILEGEDVTFPCIPTDLEYVLTELL 286
           IGVL + + I+ELV R EEFVGDL +VKYD+ VP+ ILEG DVTF CIP DLEYVL E+L
Sbjct: 245 IGVLDKRLNIAELVKRTEEFVGDLTFVKYDRIVPVNILEGHDVTFACIPQDLEYVLQEIL 304

Query: 287 KNSSRAHIEGSTSDNNTAEKPVEVTIVRKDNDLKIRIRDFGGGIPPVVEDRMFDYSYSTV 346
           KNS+RAHIE  T  N +AEKP+EVTIVR   DL+IRIRDFGGGIPP VEDRMFDYSY+T 
Sbjct: 305 KNSARAHIENHTPSNYSAEKPIEVTIVRSYEDLEIRIRDFGGGIPPDVEDRMFDYSYTTS 364

Query: 347 NTDAKDSGMSAYVIPGADVCNVSGMGFGLPMCKAYMEMFNGTLDIQSLWGWGTDAYIYLK 406
             DAKD+GMSAY+IPG DV NVSGMGFGLP+CKAY+EMFNG LDI SLWGWGTD YI LK
Sbjct: 365 EKDAKDTGMSAYIIPGQDVSNVSGMGFGLPLCKAYVEMFNGELDIVSLWGWGTDVYIRLK 424

Query: 407 GP 408
           GP
Sbjct: 425 GP 426

>CAGL0L00869g complement(105236..106495) similar to sp|P40530
           Saccharomyces cerevisiae YIL042c, hypothetical start
          Length = 419

 Score =  473 bits (1217), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 233/406 (57%), Positives = 303/406 (74%), Gaps = 8/406 (1%)

Query: 9   TAVRGFSRLRYTRKAFHNGLHTLRPLQKVHGKSSLREMLREVGFEELYRIRSNTELLIQD 68
           +A+R     R   + FH     L+   K    ++ ++ L+ + F++ Y+IRSN ELLIQ+
Sbjct: 5   SALRLGGHRRVIGRQFHAASVLLKN-SKYGSVANYQDRLKHLEFDKHYKIRSNIELLIQE 63

Query: 69  FAKKPIPAISYEFLTQYKVPLTDNEKYMLTIQTVNLLLTYTCRRLVAIQKLPYIAVLNPN 128
           +A KPIP ++Y++LT YK PL+ NE+YMLTI+T+NLLL+YTCRRL AIQKLPY+A +NP+
Sbjct: 64  YASKPIPPLTYDYLTHYKPPLSANEEYMLTIKTINLLLSYTCRRLNAIQKLPYVAAVNPS 123

Query: 129 IEETXXXXXXXXXXXXXXXXPYGLHDQEVMAKKLTEFLDDHQDTLLTLSRGFQEIMEFFP 188
           IE++                PY LHD++++   L EFLDDHQDT+ TLSRG +EIM+F  
Sbjct: 124 IEKSYSLYLKTLESLLSIEFPYALHDKDIIHGLLIEFLDDHQDTVETLSRGLEEIMDFLE 183

Query: 189 KESVFEFLNSHLRDRISMKLLATHYLAIVSQTSRDD--RVIGVLHREMKISELVCRVEEF 246
           K+++F+FL+ HLRDRI+MK+LAT++LA VS  +RD    +IG +H+ + ++++V +V EF
Sbjct: 184 KDTIFKFLDEHLRDRIAMKILATNHLA-VSNHNRDSDPNMIGTIHKALPVADMVKKVSEF 242

Query: 247 VGDLCYVKYDQQV-PIKILEGEDVTFPCIPTDLEYVLTELLKNSSRAHIEGSTSDNNTAE 305
           V DLC+VKYDQ V P+KI  G DVTFPCIPT LEYVLTE+LKNS RAHIE +TS N   E
Sbjct: 243 VSDLCFVKYDQLVAPVKIYGGHDVTFPCIPTILEYVLTEILKNSYRAHIENTTSHNCLVE 302

Query: 306 KPVEVTIVRK---DNDLKIRIRDFGGGIPPVVEDRMFDYSYSTVNTDAKDSGMSAYVIPG 362
           KPVEV IV+    D +L+IRIRDFGGGIPP VE  +F+YSY+TV +D K+SG SAYVIPG
Sbjct: 303 KPVEVQIVKDEKYDEELEIRIRDFGGGIPPNVESHIFEYSYTTVESDKKESGASAYVIPG 362

Query: 363 ADVCNVSGMGFGLPMCKAYMEMFNGTLDIQSLWGWGTDAYIYLKGP 408
            D+  VSGMGFGLPMCKAY+EMF+G LDIQSLWGWGTD YI LKGP
Sbjct: 363 EDINIVSGMGFGLPMCKAYIEMFDGKLDIQSLWGWGTDVYIKLKGP 408

>KLLA0E04455g 408415..409680 similar to sp|P40530 Saccharomyces
           cerevisiae YIL042c, hypothetical start
          Length = 421

 Score =  435 bits (1119), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 228/384 (59%), Positives = 281/384 (73%), Gaps = 13/384 (3%)

Query: 25  HNGLHTLRPLQKVHGKSSLREMLREVGFEELYRIRSNTELLIQDFAKKPIPAISYEFLTQ 84
           HN LH     +  H K S +EM  E+ F+ELY IRSN + LIQD++   IP I + FL Q
Sbjct: 44  HNRLHR----RNNHRKRS-KEMT-ELNFQELYHIRSNIQHLIQDYSSYEIPKIDWAFLLQ 97

Query: 85  YKVPLTDNEKYMLTIQTVNLLLTYTCRRLVAIQKLPYIAVLNPNIEETXXXXXXXXXXXX 144
           Y+ PL DNEKY LTI+T+NLLLT TC RL ++Q+LPYIA++NPNIE++            
Sbjct: 98  YRGPLQDNEKYFLTIKTLNLLLTLTCHRLASLQELPYIALVNPNIEQSNRLYLKTLESLL 157

Query: 145 XXXXPYGLHDQEVMAKKLTEFLDDHQDTLLTLSRGFQEIMEFFPKESVFEFLNSHLRDRI 204
               PY L+D + +     EFL+DHQDTLLTLS G QE+  F+  E++F+FLN HL DRI
Sbjct: 158 SIEYPYDLYDTDKIQNLTEEFLNDHQDTLLTLSNGLQEVSRFYDPENIFKFLNKHLHDRI 217

Query: 205 SMKLLATHYLAIVSQTSRDDRVIGVLHREMKISELVCRVEEFVGDLCYVKYDQQVPIKIL 264
            MKLL T+YL ++ QTS D+ VIGV+H+++ IS+LV R  EFV DL ++KYD+ VP+KI+
Sbjct: 218 LMKLLTTNYLKLLEQTSSDE-VIGVIHKDLHISDLVTRTNEFVNDLTFIKYDKTVPVKIM 276

Query: 265 EGEDVTFPCIPTDLEYVLTELLKNSSRAHIEGSTSDNNTAEKPVEVTIVRKDNDLKIRIR 324
           EG DV F  IPTDLEYVL ELLKNSSRAHIE      N  +K VEVTIV+ D+ L+IRIR
Sbjct: 277 EGSDVKFSYIPTDLEYVLQELLKNSSRAHIE------NNVDKDVEVTIVKNDDQLEIRIR 330

Query: 325 DFGGGIPPVVEDRMFDYSYSTVNTDAKDSGMSAYVIPGADVCNVSGMGFGLPMCKAYMEM 384
           DFGGGI P VEDR+FDYS+ST   + KDSGMS YV+PG +V NV+GMGFGLPMCKAY+E+
Sbjct: 331 DFGGGIDPQVEDRVFDYSFSTTVKEEKDSGMSDYVLPGQEVQNVAGMGFGLPMCKAYLEL 390

Query: 385 FNGTLDIQSLWGWGTDAYIYLKGP 408
           FNGTLDIQSLWGWGTD YI L GP
Sbjct: 391 FNGTLDIQSLWGWGTDVYIRLHGP 414

>YIL042C (YIL042C) [2625] chr9 complement(275107..276291) Protein
           with similarity to mitochondrial branched chain
           alpha-ketoacid and pyruvate dehydrogenase protein
           kinases [1185 bp, 394 aa]
          Length = 394

 Score =  370 bits (949), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 181/380 (47%), Positives = 257/380 (67%), Gaps = 12/380 (3%)

Query: 34  LQKVHGKSSLREMLREVGFEELYRIRSNTELLIQDFAKKPIPAISYEFLTQYKVPLTDNE 93
           ++  H +    E+L ++ F++ Y+IRSN ELLIQD+A KPI  ++YE+  QY+ PLT  E
Sbjct: 13  MRWAHRQRPSHELLSQLSFDQHYKIRSNIELLIQDYASKPIAPLNYEYFLQYRPPLTKKE 72

Query: 94  KYMLTIQTVNLLLTYTCRRLVAIQKLPYIAVLNPNIEETXXXXXXXXXXXXXXXXPYGLH 153
           +YMLTI+T+NLLL+ TC+RL AIQ+LPY AV+NP+IE T                PY LH
Sbjct: 73  EYMLTIKTINLLLSLTCKRLNAIQRLPYNAVINPHIERTNSLYLKSLQTLLSIAYPYELH 132

Query: 154 DQEVMAKKLTEFLDDHQDTLLTLSRGFQEIMEFFPKESVFEFLNSHLRDRISMKLLATHY 213
           +   +  K TE LDDH+D ++ L++G QEI   +PK  + +FLN HL++RI+MKLL THY
Sbjct: 133 NPPKIQAKFTELLDDHEDAIVVLAKGLQEIQSCYPKFQISQFLNFHLKERITMKLLVTHY 192

Query: 214 LAIVSQTSRD--DRVIGVLHREMKISELVCRVEEFVGDLCYVKYD-QQVPIKIL-EGEDV 269
           L++++Q   D   R+IG+LHR++ I++L+  V ++V D+C+VK++ Q+ P+ I    +D+
Sbjct: 193 LSLMAQNKGDTNKRMIGILHRDLPIAQLIKHVSDYVNDICFVKFNTQRTPVLIHPPSQDI 252

Query: 270 TFPCIPTDLEYVLTELLKNSSRAHIEGSTSDNNTAEKPVEVTIVRKDND-LKIRIRDFGG 328
           TF CIP  LEY++TE+ KN+  A I            P+E+ +++ D+D L +RIRD GG
Sbjct: 253 TFTCIPPILEYIMTEVFKNAFEAQIALGKE-----HMPIEINLLKPDDDELYLRIRDHGG 307

Query: 329 GIPPVVEDRMFDYSYSTVNTDAKDSGMSAYVIPGADVCNVSGMGFGLPMCKAYMEMFNGT 388
           GI P VE  MF+YSYST    + DS  +   +PG  + NVSGMGFGLPMCK Y+E+F G 
Sbjct: 308 GITPEVEALMFNYSYSTHTQQSADSESTD--LPGEQINNVSGMGFGLPMCKTYLELFGGK 365

Query: 389 LDIQSLWGWGTDAYIYLKGP 408
           +D+QSL GWGTD YI LKGP
Sbjct: 366 IDVQSLLGWGTDVYIKLKGP 385

>Scas_704.44
          Length = 443

 Score =  329 bits (843), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 181/444 (40%), Positives = 266/444 (59%), Gaps = 50/444 (11%)

Query: 7   MLTAVRGFSRL----RYTRKAFHNGL----HTLRPLQKVHGKSSLREMLREVGFEELYRI 58
           ML +   F+RL      TR  F + +    HT       H K+++   L  + F+  Y+I
Sbjct: 1   MLQSTIRFARLGNKSLLTRPFFCSSITGNRHTTHAHHLKHNKAAIN--LSHLDFQAYYKI 58

Query: 59  RSNTELLIQDFAKKPIPAISYEFLTQYKVPLTDNEKYMLTIQTVNLLLTYTCRRLVAIQK 118
           RSN ELLIQD+++KPIP +SY+FLT+Y+ PL+  EKY L I+T+N L++ TCR+L  IQ 
Sbjct: 59  RSNIELLIQDYSRKPIPPLSYKFLTEYQKPLSQTEKYNLAIKTINQLISLTCRQLSLIQN 118

Query: 119 LPYIAVLNPNIEETXXXXXXXXXXXXXXXXPYGLHDQEVMAKKLTEFLDDHQDTLLTLSR 178
           LPYI +LNP I +                 PY L+  +++   L    ++H DTLL LS 
Sbjct: 119 LPYIVLLNPKINQINSLYLKTLESLLSITFPYDLYKNDLILSLLNHLNEEHNDTLLVLSD 178

Query: 179 GFQEI-MEFFPKESVFEFLNSHLRDRISMKLLATHYLAIVSQTSRDDRVIGVLHREMKIS 237
           G +EI  E    E++ +FL+ H+RDRI+MKL+  ++LA++S  +  D +IG++H+ +KIS
Sbjct: 179 GLKEINNELLSNEAISKFLDVHIRDRITMKLIILNHLALLSPKTEPD-MIGIIHKRVKIS 237

Query: 238 ELVCRVEEFVGDLCYVKYDQQVP-------IKILEGEDVTFPCIPTDLEYVLTELLKNSS 290
           + + +  EFV DLC +K++  +        I  + GE++ FPCIP  LEYVLTE+LKNS 
Sbjct: 238 QFINQTFEFVNDLCQLKFNLPMSTTGNSSMITYITGEEIEFPCIPVILEYVLTEILKNSM 297

Query: 291 RAHIEGSTSDNNTAEKPVEVTIVRKDND-LKIRIRDFGGGIPPVVEDRMFDYSYSTV--- 346
           +AHIE      N   KP+E++I   D+D L +RIRD+GGGI P +E ++F YS+ST    
Sbjct: 298 KAHIE------NDVTKPIEISIFETDSDELTVRIRDYGGGIDPKIEPKIFQYSFSTTLDS 351

Query: 347 --------------NTDA------KDSGMSAYVIPGADVCN-VSGMGFGLPMCKAYMEMF 385
                          TD+       DS +   ++PG    N +SGMG+GLP+CK Y+E+F
Sbjct: 352 TFSKIHEENNGNQRETDSVIGSCQNDSSVPQLMMPGEVENNTISGMGYGLPLCKNYLELF 411

Query: 386 NGTLDIQSLWGWGTDAYIYLKGPD 409
           +G + IQ+LWG GTD YI +KGP+
Sbjct: 412 DGDITIQNLWGLGTDVYIKVKGPN 435

>Kwal_14.1825
          Length = 492

 Score = 91.3 bits (225), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 103/403 (25%), Positives = 164/403 (40%), Gaps = 73/403 (18%)

Query: 69  FAKKPIPAISYEFLTQYKVPLTDNEKYMLTIQTVNL-------LLTYTCRRLVAIQKLPY 121
             KKP P +S   L QY     D+   +   + VN        L+T    ++  +Q LP+
Sbjct: 82  LTKKPHP-VSLSQLAQY----FDDSTALTKQKIVNSGNFVKDELVTRIAHKIHLLQTLPF 136

Query: 122 IAVLNPNIEETXXXXXXXXXXXXXXXXPYGLHDQEVMAKKLTEFLDDHQD-TLLTLSRGF 180
             V N +  +                    L D E  AK L   L D     L  L  G 
Sbjct: 137 NVVNNFHFSQVYESYYNIFERFRRYPSIKTLEDNERFAKFLHTILSDFNSLNLPHLIMGA 196

Query: 181 QE--IMEFFPKESVFEFLNSHLRDRISMKLLATHYLAIVSQTSRDDR----VIGVLHREM 234
            E  I++  P E + E ++S LR RIS +L+   +L+I S      +    V+G + +E 
Sbjct: 197 LECRILDLCPPEKMDEVISSLLRARISRRLIVEEHLSITSNYHSGKKENTLVLGDIFQEC 256

Query: 235 KISELV----CRVEEFVGDLCYVKYDQQVPIKILEGE-DVTFPCIPTDLEYVLTELLKNS 289
              E +       E+F+ D+ YV    ++P  I++G+ D+ F  +P  L+Y+L E+L+NS
Sbjct: 257 SAREFLLGAKSMCEKFIQDMYYVGI--KLPEFIIDGKTDLKFYFLPLHLKYLLGEVLRNS 314

Query: 290 SRAHIEGSTSDNNTAEKPVEVTIVRKDNDLKIRIRDFGGGIP------------------ 331
             A ++          +P+ VT+V  ++    RI D  GGIP                  
Sbjct: 315 YEATMQEYIRLGLKDPEPITVTVVSNESSFIFRISDRAGGIPHDEKTIWSFGKSKELARK 374

Query: 332 --------PVVE---------------DRMFDYSYST---VNTDAKDSGMSAYVIPGADV 365
                   P ++                  F Y +++   +N     +G+  +  P   +
Sbjct: 375 SLSNFHKLPGLQTVSLYDHVTDHHPGHSSTFPYKFTSLEPINASNLPTGLHKFEKPLLGL 434

Query: 366 CNVSG---MGFGLPMCKAYMEMFNGTLDIQSLWGWGTDAYIYL 405
              S    +G GL MCK Y E +NG L + SL G+GTD  + L
Sbjct: 435 LERSSRYKLGIGLAMCKVYAEYWNGDLTVHSLQGYGTDTVLKL 477

>AAR157C [345] [Homologous to ScYGL059W - SH] (627130..628641) [1512
           bp, 503 aa]
          Length = 503

 Score = 86.7 bits (213), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 99/418 (23%), Positives = 166/418 (39%), Gaps = 83/418 (19%)

Query: 61  NTELLIQDFAKKPIPAISYEFLTQYKVPLTDNEKYMLTIQTV--------NLLLTYTCRR 112
           N ++L++ + ++   A+S + L QY      ++   LT Q V          L      +
Sbjct: 81  NRKVLVERYLQRQPHAVSLKHLAQYY-----DDSNRLTKQKVIRSGQFAKEELTVRMAHK 135

Query: 113 LVAIQKLPYIAVLNPNIEETXXXXXXXXXXXXXXXXPYGLHDQEVMAKKLTEFLDDHQD- 171
           L  +Q LP+  V N +  +                    L D E  A+ L + + D    
Sbjct: 136 LRELQDLPFNVVNNFHFVQVYESYYNIFERFRRFPAIRTLEDNERFAELLHQIMSDFNSL 195

Query: 172 TLLTLSRGFQE--IMEFFPKESVFEFLNSHLRDRISMKLLATHYLAIVSQ----TSRDDR 225
            L  L  G  E  I++ +P++++   ++S LR RIS +L+   +L++ S      S +  
Sbjct: 196 NLPHLIMGALESCILDLYPQDAMDRLMSSFLRARISRRLIVEEHLSVTSNYMSGKSENTL 255

Query: 226 VIGVLHREMKISELVCRV----EEFVGDLCYVKYDQQVPIKILEG-EDVTFPCIPTDLEY 280
           V+G + +E    E +       E  + D+ Y   D  +P  I++G  D+ F  +P+ L Y
Sbjct: 256 VLGDIFQECSAREYLLHAARICENAIRDMFYP--DIPLPDFIIDGCADLRFYFLPSQLHY 313

Query: 281 VLTELLKNSSRAHIEGSTSDNNTAEKPVEVTIVRKDNDLKIRIRDFGGGIPPVVEDRMFD 340
           +  E L+NS  A ++ +         P+ VT+V+       RI D GGGIP    DR   
Sbjct: 314 LFGETLRNSYEATVKEAIRRGLPKPDPITVTVVQNPESYLFRISDRGGGIPH--PDRTI- 370

Query: 341 YSYSTVNTDAKDSGMSAYVIPGADV------------------CNVSG------------ 370
           +S+      A+ +  + + +PGA                    C +S             
Sbjct: 371 WSFGKSKLLAQQALDNFHKLPGAQTVSLYDHMYDADARRVAAACKLSNTSLQSMAETNLT 430

Query: 371 -----------------------MGFGLPMCKAYMEMFNGTLDIQSLWGWGTDAYIYL 405
                                  +G GL MCK Y E +NG L + S+ G GTD  + L
Sbjct: 431 KGRYKFDFPRPLVGLLERPFRYKLGIGLAMCKVYAEYWNGDLTVHSIHGHGTDTVLKL 488

>AER270W [2772] [Homologous to NOHBY] complement(1131292..1132761)
           [1470 bp, 489 aa]
          Length = 489

 Score = 81.6 bits (200), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 65/274 (23%), Positives = 121/274 (44%), Gaps = 37/274 (13%)

Query: 169 HQDTLLTLSRGF----QEIMEFFPKESVFEFLNSHLRDRISMKLLATHYLAIVSQTSRDD 224
           H  T++TL+RG     +         S+  +L+     RI +++L   +L+++ Q    D
Sbjct: 205 HDATVVTLARGLLRWKRTQKNNVVDASIKGYLDRFYMGRIGIRMLIGQHLSLLEQAMHSD 264

Query: 225 RV--------------IGVLHREMKISELVCRVEEFVGDLCYVKYD---------QQVPI 261
                           +G++    K++++     +    +C   Y+           +PI
Sbjct: 265 LACEHVPGAVGSDADYVGIVCTRTKVAQVADIAIDRARHICAEYYNLYEAPKVELHTIPI 324

Query: 262 KILEGE---DVTFPCIPTDLEYVLTELLKNSSRAHIEGSTSDNNTAEK-------PVEVT 311
           K  +     ++ F  +P+ L ++L E+LKN+ RA +E +   N            PV+V 
Sbjct: 325 KRDDSSGLREIEFTYVPSHLVHMLFEVLKNALRATVESTIQKNPGVTDYDSLRFPPVKVI 384

Query: 312 IVRKDNDLKIRIRDFGGGIPPVVEDRMFDYSYSTVNTDAKDSGMSAYVIPGADVCNVSGM 371
           I     +L ++I D GGGI       ++ Y Y+T+  D +DS +            ++G 
Sbjct: 385 ISEGTEELAVKISDEGGGIARSNLPLVWTYLYTTMTDDEQDSLIDGDSTLSGSCPPMAGY 444

Query: 372 GFGLPMCKAYMEMFNGTLDIQSLWGWGTDAYIYL 405
           G+GL + + Y   F G L + S+ G+GTD Y++L
Sbjct: 445 GYGLALSRLYARHFGGDLRLLSMDGYGTDVYLHL 478

>KLLA0F27423g complement(2537353..2538891) similar to
           ca|CA5524|IPF2861 Candida albicans putative pyruvate
           dehydrogenase kinase, hypothetical start
          Length = 512

 Score = 76.6 bits (187), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 69/281 (24%), Positives = 127/281 (45%), Gaps = 50/281 (17%)

Query: 169 HQDTLLTLSRGFQEIMEFFPK----ESVFEFLNSHLRDRISMKLLATHYLAIVSQTSR-- 222
           H  T++TL++G  +  +   +    +S+  FL+     RI +++L    LA++    +  
Sbjct: 227 HDATVITLAKGVLKWKKTHQQNVVDDSIQSFLDRFYLSRIGIRMLIGQQLALLESARQPA 286

Query: 223 -------DDRVIGVLHREMKISELVCRVEEFVGDLCYVKYD--QQVPIKIL--------- 264
                  D+  +G++  +  I++L     +    +C   Y   +   +++L         
Sbjct: 287 EGPFDEDDEDWVGIICTKTNITQLSKTAIDNARHICAEHYGLYEAPKVQLLTFPLDYRPS 346

Query: 265 ---------EGEDVTFPCIPTDLEYVLTELLKNSSRAHIEGSTSDNNTAEK------PVE 309
                    E  D+ F  +P  L ++L E LKN+ RA +E +   N + +K       V+
Sbjct: 347 TEEKSGCPNESPDIEFMYVPGHLIHMLFETLKNALRATVEKTIEKNPSVDKYDLKFPDVK 406

Query: 310 VTIVRKDNDLKIRIRDFGGGIPPVVEDRMFDYSYSTVNTDAK----DSGMSA-YVIPGAD 364
           V I     DL ++I D GGGI       ++ Y Y+T+  + +    D  MS  + IP   
Sbjct: 407 VIITEGTEDLTVKISDEGGGIARSNLPLVWTYLYTTMPENEQIGLMDEEMSQNFRIP--- 463

Query: 365 VCNVSGMGFGLPMCKAYMEMFNGTLDIQSLWGWGTDAYIYL 405
              ++G G+GL + + Y   F G L + S+ G+GTD Y++L
Sbjct: 464 ---MAGYGYGLALSRLYARYFGGDLKLMSMEGFGTDVYLHL 501

>Scas_563.9
          Length = 492

 Score = 75.1 bits (183), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 70/286 (24%), Positives = 115/286 (40%), Gaps = 66/286 (23%)

Query: 183 IMEFFPKESVFEFLNSHLRDRISMKLLATHYLAI----VSQTSRDDRVIGVLHREMKISE 238
           I+E  P++ +   L+S LR RIS +L+   +L+I    +S    +  V+G + +E +  +
Sbjct: 195 ILELLPRDEIDALLSSLLRARISRRLIVEEHLSISANYLSGKKENTLVLGDIFQECQALD 254

Query: 239 LVCRVEEFVGDLCYVKYDQQVPIK--ILEGE-DVTFPCIPTDLEYVLTELLKNSSRAHIE 295
                           Y   +PI   I+EG+ D+TF  +PT L+Y+L E+L+N   A I+
Sbjct: 255 YFMEASRTCEKFVKAMYFDDIPIPELIIEGQKDLTFYFLPTHLQYILGEILRNIYEATIK 314

Query: 296 GSTSDNNTAEKPVEVTIVRKDNDLKIRIRDFGGGIPPVVEDRMFDYSYSTVNTDAKDSGM 355
                     +P+ +TIV+ D+    R  D  GGI    ED    +S+      A +S  
Sbjct: 315 DYIRKGLAKPEPIVITIVKNDSSFIFRFSDKAGGILHHEED---IWSFGKSKERAAESLN 371

Query: 356 SAYVIPGADVC----------------------------NVSGMG----------FGLP- 376
           + + +PG                                ++  MG          F +P 
Sbjct: 372 NFHKLPGLQTVSLYDHLYNGEEHDMNTRTLMANRPYMHTSLEAMGHSNLKKGPYKFEMPL 431

Query: 377 -----------------MCKAYMEMFNGTLDIQSLWGWGTDAYIYL 405
                            MCK Y E +NG L + ++ G GTD  + L
Sbjct: 432 IEMLERAPRYKLGIGLAMCKIYAEYWNGDLSLTTIPGHGTDTVLTL 477

>YGL059W (YGL059W) [1920] chr7 (392226..393701) Protein with
           similarity to human branched-chain alpha-ketoacid
           dehydrogenase kinase, transcription is induced by the
           drug FK506 in a GCN4-dependent manner [1476 bp, 491 aa]
          Length = 491

 Score = 74.3 bits (181), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 72/287 (25%), Positives = 124/287 (43%), Gaps = 66/287 (22%)

Query: 183 IMEFFPKESVFEFLNSHLRDRISMKLLAT-HYLAIVSQTSRDDR---VIGVLHREMKISE 238
           I++ +P+E + + L+  LR RIS +L+   H +   + TS  +    V+G + +E    +
Sbjct: 192 ILDLYPREKMDQLLSDLLRARISRRLIVEEHVVYTANYTSGKEENTLVLGDIFQECSAKK 251

Query: 239 LVCRVEE----FVGDLCYVKYDQQVPIKILEGE-DVTFPCIPTDLEYVLTELLKNSSRAH 293
            +    E    F+ D+ Y K D  +P  I+EG+  ++F  +PT L+Y+L E+L+N+  A 
Sbjct: 252 YLLEASEESQKFIQDM-YFK-DIPMPEFIIEGDTQLSFYFLPTHLKYLLGEILRNTYEAT 309

Query: 294 IEGSTSDNNTAEKPVEVTIVRKDNDLKIRIRDFGGGI----------------------- 330
           ++          +P+ VT+V  D     RI D  GG+                       
Sbjct: 310 MKHYIRKGLEKPEPIIVTVVSNDESYLFRISDKAGGVLHDDENLWSFGKSKERAQESLNN 369

Query: 331 ----PPVVEDRMFD--YSYSTVNTDAKD-----------------------SGMSAYVIP 361
               P +    ++D  +S++  N+  K                        +G   Y  P
Sbjct: 370 FHKLPGLQTVSIYDEVHSHTKYNSKLKSLQSITLKPYMHTSLEPMSYPSIINGHIKYETP 429

Query: 362 GADVCNVS---GMGFGLPMCKAYMEMFNGTLDIQSLWGWGTDAYIYL 405
             ++   S    +G GL MCK Y E +NG L + S+ G+GTD  + L
Sbjct: 430 LIELLKRSFRYKLGIGLAMCKVYAEYWNGDLSLHSMPGYGTDVVLKL 476

>CAGL0F07007g 687174..688631 highly similar to sp|P53170
           Saccharomyces cerevisiae YGL059w, hypothetical start
          Length = 485

 Score = 73.9 bits (180), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 66/283 (23%), Positives = 124/283 (43%), Gaps = 65/283 (22%)

Query: 184 MEFFPKESVFEFLNSHLRDRISMKLLATHYLAIV----SQTSRDDRVIGVLHREMKISEL 239
           ++ +P + + + L+  LR RIS +L+   +++I     S   ++  V+G + +E    E 
Sbjct: 192 LDLYPTDKMDKLLSDLLRARISRRLIVEEHISIADNYFSGKKKNTLVLGDIFQECSAKEH 251

Query: 240 VCRV----EEFVGDLCYVKYDQQVP---IKILEGEDVTFPCIPTDLEYVLTELLKNSSRA 292
           +       E+F+ D+    Y + +P   +KI    D+ F  +P+ L+Y+L E+L+N+  A
Sbjct: 252 ILGASKICEKFIQDM----YFESIPMPELKINGETDLKFYFLPSHLKYLLGEILRNTYEA 307

Query: 293 HIEGSTSDNNTAEKPVEVTIVRKDNDLKIRIRDFGGGIPPVVEDR--------------- 337
            I+          +P+ +TI++ +     RI D  GG+    +D                
Sbjct: 308 TIKDYIRKGLPKPEPIVITIIKNEESYLFRICDRAGGLAHHHDDNNIWSFGKTKEQAAQS 367

Query: 338 --------------MFDYSYST----------VNTDAK---DSGMSAYVIPGADVCNVS- 369
                         ++D+ Y+           +NT  +    S +++ V  G +V  +  
Sbjct: 368 ISNFHKLPGLQTVSLYDHLYNNTEDRQVNRAYINTSLEPMAHSNIASAVATGYEVPLLKL 427

Query: 370 -------GMGFGLPMCKAYMEMFNGTLDIQSLWGWGTDAYIYL 405
                   +G GL MCK Y E +NG L + S+ G+GTD  + L
Sbjct: 428 LKRSFRYKLGIGLAMCKVYAEYWNGDLTLHSIHGFGTDTVLKL 470

>Sklu_2299.6 YGL059W, Contig c2299 10909-12501 reverse complement
          Length = 530

 Score = 73.9 bits (180), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 97/434 (22%), Positives = 172/434 (39%), Gaps = 85/434 (19%)

Query: 48  REVGFEELYRIRSNTELLIQDFAKKPIPAISYEFLTQYKVPLTDNEKYMLTIQTVNL--- 104
           R V  +  Y+   N  +L Q +  K    +S + L  Y     D+   +  ++ +N    
Sbjct: 91  RYVNMQHYYQ---NKNILWQKYLTKSPNPVSLKQLAMY----YDDSNKLTKLKIINSGRF 143

Query: 105 ----LLTYTCRRLVAIQKLPYIAVLNPNIEETXXXXXXXXXXXXXXXXPYGLHDQEVMAK 160
               L     ++L  +Q LP+  V N +  +                    + D    A+
Sbjct: 144 VKEELAIRIAQKLHLLQNLPFNVVNNFHFVQVYESYYNIFERFRKFPHIKNIEDNYKFAE 203

Query: 161 KLTEFLDDHQD-TLLTLSRGFQE--IMEFFPKESVFEFLNSHLRDRISMKLLATHYLAIV 217
            L + L D     L  L  G  E  I++ + +E + E +++ LR RIS +L+   +L+I 
Sbjct: 204 FLYQILSDFNSLNLPHLIMGALECRILDLYKQEQMDELISTLLRARISRRLIVEEHLSIT 263

Query: 218 SQTSRDDR----VIGVLHREMKISELVCRV----EEFVGDLCYVKYDQQVPIKILEGE-D 268
           S  +   +    V+G + +E    + +       E F+ D+ +      +P  +++G+ D
Sbjct: 264 SNFASGKKENTLVLGDIFQECCARDYLLEASQMCEAFIKDMFFDGI--PLPKFVIDGDTD 321

Query: 269 VTFPCIPTDLEYVLTELLKNSSRAHIEGSTSDNNTAEKPVEVTIVRKDNDLKIRIRDFGG 328
           + F  +P+ L+Y+L E L+NS  A ++           P+ VTI+  ++    RI D GG
Sbjct: 322 LKFYFLPSHLKYLLGETLRNSYEATVKEYIRLGLDNPHPITVTIISNNHSFLFRISDRGG 381

Query: 329 GIP--------------------------PVVED-RMFDYSYSTVN-------TDAKDSG 354
           GIP                          P ++   ++DY Y  ++         +KD  
Sbjct: 382 GIPHDDKTIWSFGKSKKLAKESLDNFHKLPGLQTVSLYDYMYQGIHDGKISQRITSKDDL 441

Query: 355 MSAY----VIPGADVCNVSGM-------------------GFGLPMCKAYMEMFNGTLDI 391
              Y    + P +D     G+                   G GL +CK Y E +NG L +
Sbjct: 442 NQPYRYTSLEPMSDTNLHKGLYKLEKPLLGLLERSSRYKLGIGLAVCKVYAEYWNGDLTV 501

Query: 392 QSLWGWGTDAYIYL 405
            S+ G+GTD  + L
Sbjct: 502 HSIHGYGTDTVLKL 515

>KLLA0C05654g complement(504568..505989) similar to sp|P53170
           Saccharomyces cerevisiae YGL059w, start by similarity
          Length = 473

 Score = 72.8 bits (177), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 64/281 (22%), Positives = 119/281 (42%), Gaps = 65/281 (23%)

Query: 183 IMEFFPKESVFEFLNSHLRDRISMKLLATHYLAIVSQ----TSRDDRVIGVLHREMKISE 238
           I++ +P++ +   ++  LR RIS +L+   +L+I S        +  V+G + ++    E
Sbjct: 185 ILDLYPQDKMDALISDLLRARISRRLIVEEHLSITSNYLSGKKENTLVLGDIFQKCNAKE 244

Query: 239 L------VCRVEEFVGDLCYVKYDQQVPIKILEGE-DVTFPCIPTDLEYVLTELLKNSSR 291
                  VC  E ++ ++ +     ++P  I+ G+ ++ F  +P+ L+++L E+L+NS  
Sbjct: 245 YLNGAREVC--EAYINNMYFAGI--KMPELIINGDTELEFYFLPSHLKFLLGEILRNSYE 300

Query: 292 AHIEGSTSDNNTAEKPVEVTIVRKDNDLKIRIRDFGGGIPPVVEDRMFDYSYSTVNTDAK 351
             ++ +         PV VTI+  D     RI D GGG+P    D+   +S+      AK
Sbjct: 301 VTVKETIRLGLEKAPPVTVTIISNDQSYLFRISDRGGGVPH--SDKQI-WSFGKSKELAK 357

Query: 352 DSGMSAYVIPGADVCNVSG----------------------------------------- 370
            S  + + +PG    ++                                           
Sbjct: 358 QSLDNFHHLPGLQTLSLYDSSNGAHLKSDRYRQTSLDRMSENNLTKGKFKVGQPLMELLK 417

Query: 371 ------MGFGLPMCKAYMEMFNGTLDIQSLWGWGTDAYIYL 405
                 +G GL +CK Y E +NG L + S+ G+GTD  + L
Sbjct: 418 RSPRYKLGIGLALCKVYAEYWNGDLTVHSIQGYGTDTVLKL 458

>Scas_698.14
          Length = 1183

 Score = 37.0 bits (84), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 37/81 (45%), Gaps = 15/81 (18%)

Query: 319 LKIRIRDFGGGIPPVVEDRMFDYSYSTVNTDAKDSGMSAYVIPGADVCNVSGMGFGLPMC 378
           + I ++D G GI P ++  +F+       T ++  G               G G GL +C
Sbjct: 839 IAIEVQDTGPGIDPSLQKSVFEPFVQGDQTLSRQYG---------------GTGLGLSIC 883

Query: 379 KAYMEMFNGTLDIQSLWGWGT 399
           +    M NGT++++S  G G+
Sbjct: 884 RQLANMMNGTMELKSEVGVGS 904

>KLLA0A00638g complement(60378..63845) gi|5531277|emb|CAB50891.1
           Kluyveromyces lactis SLN1 homologue, start by similarity
          Length = 1155

 Score = 36.2 bits (82), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 25/103 (24%), Positives = 45/103 (43%), Gaps = 15/103 (14%)

Query: 297 STSDNNTAEKPVEVTIVRKDNDLKIRIRDFGGGIPPVVEDRMFDYSYSTVNTDAKDSGMS 356
           S++D++T E       V K   + + + D G GI P +++ +F+       T ++  G  
Sbjct: 827 SSTDSDTEENTFRDLKVPKTWVISMEVEDTGSGIDPSLQESVFEPFVQGDQTLSRQYG-- 884

Query: 357 AYVIPGADVCNVSGMGFGLPMCKAYMEMFNGTLDIQSLWGWGT 399
                        G G GL +C+   +M  GT+ + S  G G+
Sbjct: 885 -------------GTGLGLSICRQLAKMMKGTMKLDSKVGVGS 914

>AFR284W [3476] [Homologous to ScYIL147C (SLN1) - SH]
           complement(947124..950435) [3312 bp, 1103 aa]
          Length = 1103

 Score = 36.2 bits (82), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 42/105 (40%), Gaps = 26/105 (24%)

Query: 299 SDNNTA----EKPVEVTIVRKDNDLKIRIRDFGGGIPPVVEDRMFDYSYSTVNTDAKDSG 354
           SDNN      EKP    IV       I ++D G GI P + + +F        T ++  G
Sbjct: 784 SDNNVTMSKLEKPRSWVIV-------IEVQDTGPGIEPSLHESVFKPFVQGDQTLSRQYG 836

Query: 355 MSAYVIPGADVCNVSGMGFGLPMCKAYMEMFNGTLDIQSLWGWGT 399
                          G G GL +C+    M  GT+ ++S  G G+
Sbjct: 837 ---------------GTGLGLSICRQLATMMKGTMKLESKVGSGS 866

>YIL147C (SLN1) [2530] chr9 complement(69791..73453) Two-component
           signal transducer involved in the osmotic stress signal
           transduction pathway that initiates a phosphorelay from
           Sln1p to Ypd1p to the response regulators Ssk1p and
           Skn7p [3663 bp, 1220 aa]
          Length = 1220

 Score = 33.9 bits (76), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 35/81 (43%), Gaps = 15/81 (18%)

Query: 319 LKIRIRDFGGGIPPVVEDRMFDYSYSTVNTDAKDSGMSAYVIPGADVCNVSGMGFGLPMC 378
           + I + D G GI P +++ +F        T ++  G               G G GL +C
Sbjct: 853 ISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYG---------------GTGLGLSIC 897

Query: 379 KAYMEMFNGTLDIQSLWGWGT 399
           +    M +GT+ ++S  G G+
Sbjct: 898 RQLANMMHGTMKLESKVGVGS 918

>Scas_671.16
          Length = 723

 Score = 33.5 bits (75), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 33/144 (22%), Positives = 67/144 (46%), Gaps = 33/144 (22%)

Query: 160 KKLTEFLDDHQDTLLTLSRGFQE--IMEFFPKESVFEFLNSHLRDRISMKLLATHYLAIV 217
           + +  ++D H      L+  ++   +ME+     + +F+N+ L++R++ K +    L I+
Sbjct: 83  RHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRLQNRLTEKEI----LNIL 138

Query: 218 SQTSRDDRVI-----GVLHREMKISE-LVCRVEEF----VGDLC-YVKYDQQVPIKILEG 266
           SQT +    +      ++HR++KI   L+    EF     G +C Y++            
Sbjct: 139 SQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVCSYIRP----------- 187

Query: 267 EDVTFPCIPTDLEYVLTELLKNSS 290
                P  P +L YV  ++LKN++
Sbjct: 188 -----PRNPQELAYVQHDVLKNTT 206

>CAGL0H06567g 645707..649216 similar to sp|P39928 Saccharomyces
           cerevisiae YIL147c SLN1, hypothetical start
          Length = 1169

 Score = 32.3 bits (72), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 34/79 (43%), Gaps = 15/79 (18%)

Query: 321 IRIRDFGGGIPPVVEDRMFDYSYSTVNTDAKDSGMSAYVIPGADVCNVSGMGFGLPMCKA 380
           I + D G GI P + + +F+       T ++  G               G G GL +C+ 
Sbjct: 806 IEVEDTGPGIDPKLHESVFEPFVQGDQTLSRQYG---------------GTGLGLSICRQ 850

Query: 381 YMEMFNGTLDIQSLWGWGT 399
              M +GT+ ++S  G G+
Sbjct: 851 LATMMHGTMKLESKVGVGS 869

>Sklu_2226.7 YIL095W, Contig c2226 8986-11373
          Length = 795

 Score = 32.3 bits (72), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 36/145 (24%), Positives = 66/145 (45%), Gaps = 35/145 (24%)

Query: 160 KKLTEFLDDHQDTLLTLSRGFQEI---MEFFPKESVFEFLNSHLRDRISMKLLATHYLAI 216
           K +  ++D H     +L+ G  E+   ME+  +  + +F+N+ L++R    L     L I
Sbjct: 82  KFVVSYIDSHA-AKSSLNNGSYEVFLLMEYCARGGLIDFMNTRLQNR----LKEFEVLKI 136

Query: 217 VSQTSRDDRVIGVL-----HREMKISELVC------RVEEFVGDLCYVKYDQQVPIKILE 265
           +SQ S+    +  L     HR++KI  ++       +V +F G +C V            
Sbjct: 137 MSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDF-GSVCGV------------ 183

Query: 266 GEDVTFPCIPTDLEYVLTELLKNSS 290
              +  P  P +L YV  ++LKN++
Sbjct: 184 ---IRPPKNPQELNYVQHDILKNTT 205

>Kwal_55.19707
          Length = 1143

 Score = 32.3 bits (72), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 19/81 (23%), Positives = 34/81 (41%), Gaps = 15/81 (18%)

Query: 319 LKIRIRDFGGGIPPVVEDRMFDYSYSTVNTDAKDSGMSAYVIPGADVCNVSGMGFGLPMC 378
           + + + D G GI P + + +F+       T ++  G               G G GL +C
Sbjct: 825 ISMEVHDTGPGIDPALHESVFEPFVQGDQTLSRQYG---------------GTGLGLSIC 869

Query: 379 KAYMEMFNGTLDIQSLWGWGT 399
           +    M +GT+ + S  G G+
Sbjct: 870 RQLATMMHGTMKLDSQVGVGS 890

>YOL062C (APM4) [4757] chr15 complement(210519..211994)
           Clathrin-associated protein (AP) complex, medium subunit
           [1476 bp, 491 aa]
          Length = 491

 Score = 31.2 bits (69), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 25/46 (54%), Gaps = 3/46 (6%)

Query: 181 QEIMEFFPKESVFEFLNSHLRDRISMKLLATHYLAIVSQTSRDDRV 226
             I+EF P +   E +  H+RD I++    T    IV+ ++RD+ +
Sbjct: 314 NHIIEFVPPDGSMELMKYHVRDNINLPFKVT---PIVTHSTRDNEI 356

>Scas_689.18
          Length = 504

 Score = 30.0 bits (66), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 36/80 (45%), Gaps = 6/80 (7%)

Query: 210 ATHYLAIVSQTSRDDRVIGVLHREMKISELVCRVEEFVGDLCYVKYDQQVPIKILEGEDV 269
           AT    ++S    +D+     H+   I  +  R  + +GD C    D+ +   +L+ E  
Sbjct: 151 ATENQPLLSHKDLEDQTSHHHHQTSLIDLISNRNTDVIGDCC----DKHLCTPLLKSE-- 204

Query: 270 TFPCIPTDLEYVLTELLKNS 289
           T PC+PT L   L+    NS
Sbjct: 205 TIPCVPTALHSSLSIKSTNS 224

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.322    0.139    0.408 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 12,707,254
Number of extensions: 539749
Number of successful extensions: 1580
Number of sequences better than 10.0: 32
Number of HSP's gapped: 1583
Number of HSP's successfully gapped: 39
Length of query: 409
Length of database: 16,596,109
Length adjustment: 104
Effective length of query: 305
Effective length of database: 12,995,837
Effective search space: 3963730285
Effective search space used: 3963730285
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 63 (28.9 bits)