Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_47.1814832331915640.0
Sklu_2174.333031912721e-177
ADL115W33331610821e-148
CAGL0L00891g3413179191e-124
YIL041W3263188871e-119
KLLA0E04433g3023138641e-116
Scas_704.453293177691e-101
Kwal_55.212273763381853e-15
AFR309C3643521782e-14
KLLA0E04543g3893991668e-13
Scas_676.184441051501e-10
CAGL0L08492g3852371491e-10
YPR148C435691473e-10
Kwal_56.2261874061760.17
CAGL0K08844g50857672.1
Kwal_26.7204111787645.1
Scas_684.3747043635.5
CAGL0D02376g69523636.0
Sklu_2369.2795144637.4
ACR068W1805148629.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_47.18148
         (319 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_47.18148                                                         607   0.0  
Sklu_2174.3 YIL041W, Contig c2174 2044-3036                           494   e-177
ADL115W [1626] [Homologous to ScYIL041W - SH] complement(483166....   421   e-148
CAGL0L00891g 106804..107829 similar to sp|P40531 Saccharomyces c...   358   e-124
YIL041W (YIL041W) [2626] chr9 (276524..277504) Cytoplasmic prote...   346   e-119
KLLA0E04433g complement(406764..407672) similar to sp|P40531 Sac...   337   e-116
Scas_704.45                                                           300   e-101
Kwal_55.21227                                                          76   3e-15
AFR309C [3501] [Homologous to ScYPR148C - SH] (1000084..1001178)...    73   2e-14
KLLA0E04543g 412009..413178 similar to sgd|S0006352 Saccharomyce...    69   8e-13
Scas_676.18                                                            62   1e-10
CAGL0L08492g 929051..930208 similar to tr|Q06523 Saccharomyces c...    62   1e-10
YPR148C (YPR148C) [5564] chr16 complement(826827..828134) Protei...    61   3e-10
Kwal_56.22618                                                          34   0.17 
CAGL0K08844g 886583..888109 similar to sp|P23180 Saccharomyces c...    30   2.1  
Kwal_26.7204                                                           29   5.1  
Scas_684.37                                                            29   5.5  
CAGL0D02376g complement(244241..246328) similar to tr|Q12309 Sac...    29   6.0  
Sklu_2369.2 YIL068C, Contig c2369 801-3188                             29   7.4  
ACR068W [1115] [Homologous to ScYHR023W (MYO1) - SH] complement(...    28   9.2  

>Kwal_47.18148
          Length = 323

 Score =  607 bits (1564), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/319 (95%), Positives = 304/319 (95%)

Query: 1   MSFNSFADSVNRKFQEISSQVSQRAQEAQLDKKFKDLSTAVSQKTQDFTTQLPSLAQSTQ 60
           MSFNSFADSVNRKFQEISSQVSQRAQEAQLDKKFKDLSTAVSQKTQDFTTQLPSLAQSTQ
Sbjct: 1   MSFNSFADSVNRKFQEISSQVSQRAQEAQLDKKFKDLSTAVSQKTQDFTTQLPSLAQSTQ 60

Query: 61  RLMQEKLGQVTDISQLPQDYVELENKIDRMKLVYENFLKVTQVYENESYDYPNNVRDSVN 120
           RLMQEKLGQVTDISQLPQDYVELENKIDRMKLVYENFLKVTQVYENESYDYPNNVRDSVN
Sbjct: 61  RLMQEKLGQVTDISQLPQDYVELENKIDRMKLVYENFLKVTQVYENESYDYPNNVRDSVN 120

Query: 121 EFSSIVGTKLHELSRATSTNEAQSVLISPGPHKDPKTLNYALSKVALTSSEYLNKSPGAE 180
           EFSSIVGTKLHELSRATSTNEAQSVLISPGPHKDPKTLNYALSKVALTSSEYLNKSPGAE
Sbjct: 121 EFSSIVGTKLHELSRATSTNEAQSVLISPGPHKDPKTLNYALSKVALTSSEYLNKSPGAE 180

Query: 181 DSEVSSSLLKYSDVQAKIAQARLHQDTLIQTKFXXXXXXXXXXXXXXXQKARKNVENKRL 240
           DSEVSSSLLKYSDVQAKIAQARLHQDTLIQTKF               QKARKNVENKRL
Sbjct: 181 DSEVSSSLLKYSDVQAKIAQARLHQDTLIQTKFNKKLRAALADDLNRAQKARKNVENKRL 240

Query: 241 QYDIARANLANARPEKEASLRVQMESLEDEFAQATDDAVVIMQKVAESSELLKDLRELVA 300
           QYDIARANLANARPEKEASLRVQMESLEDEFAQATDDAVVIMQKVAESSELLKDLRELVA
Sbjct: 241 QYDIARANLANARPEKEASLRVQMESLEDEFAQATDDAVVIMQKVAESSELLKDLRELVA 300

Query: 301 AQAEYYKQSAELLSEFLPQ 319
           AQAEYYKQSAELLSEFLPQ
Sbjct: 301 AQAEYYKQSAELLSEFLPQ 319

>Sklu_2174.3 YIL041W, Contig c2174 2044-3036
          Length = 330

 Score =  494 bits (1272), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 247/319 (77%), Positives = 277/319 (86%), Gaps = 1/319 (0%)

Query: 1   MSFNSFADSVNRKFQEISSQVSQRAQEAQLDKKFKDLSTAVSQKTQDFTTQLPSLAQSTQ 60
           MSFN+FADS+N+KFQE+S+ VSQ+AQEAQLDKKFKDLS AVSQ+TQD TT LPSLAQSTQ
Sbjct: 1   MSFNAFADSLNKKFQELSTSVSQKAQEAQLDKKFKDLSQAVSQRTQDLTTSLPSLAQSTQ 60

Query: 61  RLMQEKLGQVTDISQLPQDYVELENKIDRMKLVYENFLKVTQVYENESYDYPNNVRDSVN 120
           RL+QE+LGQVTDISQLPQ+Y+ELEN+IDR++LVYENFLKVTQVYE+ESYDYPNNVRDSVN
Sbjct: 61  RLVQERLGQVTDISQLPQEYLELENRIDRIRLVYENFLKVTQVYEHESYDYPNNVRDSVN 120

Query: 121 EFSSIVGTKLHELSRATSTNEAQSVLISPGPHKDPKTLNYALSKVALTSSEYLNKSPGAE 180
           EFS  V +KLHELS A+ST+EAQ++LISPGP KDPKTLNYALSKVALTSSEYL+KS G E
Sbjct: 121 EFSKTVSSKLHELSHASSTDEAQNILISPGPAKDPKTLNYALSKVALTSSEYLSKS-GHE 179

Query: 181 DSEVSSSLLKYSDVQAKIAQARLHQDTLIQTKFXXXXXXXXXXXXXXXQKARKNVENKRL 240
           D  ++++LLKYSDVQAKIAQARL QDTLIQTKF                KARK VENKRL
Sbjct: 180 DETIATALLKYSDVQAKIAQARLQQDTLIQTKFNKKLRETLASDLNKAVKARKEVENKRL 239

Query: 241 QYDIARANLANARPEKEASLRVQMESLEDEFAQATDDAVVIMQKVAESSELLKDLRELVA 300
           QYDIARANLANA+PEKEASLRVQMESLEDEFAQAT+DA  +MQ V  SSE LKDL ELV+
Sbjct: 240 QYDIARANLANAKPEKEASLRVQMESLEDEFAQATEDATGVMQDVIASSEFLKDLSELVS 299

Query: 301 AQAEYYKQSAELLSEFLPQ 319
           AQ  YYK S ELLS+FLPQ
Sbjct: 300 AQLAYYKLSTELLSDFLPQ 318

>ADL115W [1626] [Homologous to ScYIL041W - SH]
           complement(483166..484167) [1002 bp, 333 aa]
          Length = 333

 Score =  421 bits (1082), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 206/316 (65%), Positives = 258/316 (81%), Gaps = 1/316 (0%)

Query: 1   MSFNSFADSVNRKFQEISSQVSQRAQEAQLDKKFKDLSTAVSQKTQDFTTQLPSLAQSTQ 60
           MSFN+FADS +++FQEISS V Q+AQEAQLDKK KDLS +VSQ+TQD T+ LPSLAQ+TQ
Sbjct: 1   MSFNAFADSFSKRFQEISSTVQQKAQEAQLDKKLKDLSLSVSQRTQDLTSNLPSLAQTTQ 60

Query: 61  RLMQEKLGQVTDISQLPQDYVELENKIDRMKLVYENFLKVTQVYENESYDYPNNVRDSVN 120
           R +QE+LGQVTDISQ+P++YVELE ++DR KL+Y+NFLKV+Q+YE+ESYDYP ++ DSVN
Sbjct: 61  RRVQERLGQVTDISQMPEEYVELEQRVDRTKLIYDNFLKVSQIYESESYDYPQHISDSVN 120

Query: 121 EFSSIVGTKLHELSRATSTNEAQSVLISPGPHKDPKTLNYALSKVALTSSEYLNKSPGAE 180
           +FS  V  K+ EL++AT+T EAQS+LISPGP ++PKTLNYALSKVALTSSEYL+KS G++
Sbjct: 121 DFSKTVTGKVQELTKATTTEEAQSILISPGPARNPKTLNYALSKVALTSSEYLSKS-GSD 179

Query: 181 DSEVSSSLLKYSDVQAKIAQARLHQDTLIQTKFXXXXXXXXXXXXXXXQKARKNVENKRL 240
           D   +  LLKYSDVQAKIAQARL QDTLIQT+F                ++RK V+ KRL
Sbjct: 180 DVVTADILLKYSDVQAKIAQARLQQDTLIQTRFNRRLREKLNTQFAEAMQSRKQVDQKRL 239

Query: 241 QYDIARANLANARPEKEASLRVQMESLEDEFAQATDDAVVIMQKVAESSELLKDLRELVA 300
           QYDIARAN   ARPEK+ASLRVQME+LED+FAQ+T+DAV +MQ V + +E LK+ +ELV 
Sbjct: 240 QYDIARANFTAARPEKQASLRVQMETLEDQFAQSTEDAVALMQAVIDDTEFLKEFQELVT 299

Query: 301 AQAEYYKQSAELLSEF 316
           AQ  ++K +AELLS F
Sbjct: 300 AQLGFHKAAAELLSGF 315

>CAGL0L00891g 106804..107829 similar to sp|P40531 Saccharomyces
           cerevisiae YIL041w, hypothetical start
          Length = 341

 Score =  358 bits (919), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 183/317 (57%), Positives = 231/317 (72%), Gaps = 21/317 (6%)

Query: 2   SFNSFADSVNRKFQEISSQVSQRAQEAQLDKKFKDLSTAVSQKTQDFTTQLPSLAQSTQR 61
           +FNSFA+S+    Q  S+                     VSQKT + +T +P+LAQSTQR
Sbjct: 3   NFNSFANSLRENLQSFSN--------------------TVSQKTHELSTNIPTLAQSTQR 42

Query: 62  LMQEKLGQVTDISQLPQDYVELENKIDRMKLVYENFLKVTQVYENESYDYPNNVRDSVNE 121
           ++QEKLGQVTDISQLPQ+Y+ELENK+D +K+VYE+FL+VT VYENESYDYP  V +SVNE
Sbjct: 43  MVQEKLGQVTDISQLPQEYLELENKVDTIKIVYEHFLQVTAVYENESYDYPKYVSESVNE 102

Query: 122 FSSIVGTKLHELSRATSTNEAQSVLISPGPHKDPKTLNYALSKVALTSSEYLNKS-PGAE 180
           FS  +  K+ ELS+ATS  EAQ++L++PGP K+PKTLNYA+SKVAL +SEYLN S     
Sbjct: 103 FSKNMAAKVQELSKATSATEAQNILVAPGPVKEPKTLNYAMSKVALNASEYLNHSFDDPM 162

Query: 181 DSEVSSSLLKYSDVQAKIAQARLHQDTLIQTKFXXXXXXXXXXXXXXXQKARKNVENKRL 240
           D+++S  LL YSDVQ K+AQARL QDT IQTKF                KARK+V++KRL
Sbjct: 163 DAKLSKVLLNYSDVQTKVAQARLQQDTQIQTKFNKVIRENLAESIARANKARKDVQSKRL 222

Query: 241 QYDIARANLANARPEKEASLRVQMESLEDEFAQATDDAVVIMQKVAESSELLKDLRELVA 300
           QYD+AR NL NA+PEKEA LRVQME+LED+FAQAT+DA V+MQ+V  S+  L  L+EL  
Sbjct: 223 QYDVARTNLQNAKPEKEAGLRVQMETLEDQFAQATEDATVVMQEVIASANFLPSLKELAT 282

Query: 301 AQAEYYKQSAELLSEFL 317
           AQ EYY+QSA+L+ EF+
Sbjct: 283 AQLEYYEQSAKLMKEFI 299

>YIL041W (YIL041W) [2626] chr9 (276524..277504) Cytoplasmic protein
           with possible role in cell-cycle regulation [981 bp, 326
           aa]
          Length = 326

 Score =  346 bits (887), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 180/318 (56%), Positives = 231/318 (72%), Gaps = 25/318 (7%)

Query: 1   MSFNSFADSVNRKFQEISSQVSQRAQEAQLDKKFKDLSTAVSQKTQDFTTQLPSLAQSTQ 60
           MSFN+FA S+++K QEIS                    T+VS+KTQ+    LPSLAQSTQ
Sbjct: 1   MSFNAFASSLSKKLQEIS--------------------TSVSEKTQE----LPSLAQSTQ 36

Query: 61  RLMQEKLGQVTDISQLPQDYVELENKIDRMKLVYENFLKVTQVYENESYDYPNNVRDSVN 120
           R++QE+LGQVTDISQLP++Y ELE+K+D +KL+Y +FL VT +YEN SYDYP  + +SVN
Sbjct: 37  RMVQERLGQVTDISQLPREYTELEDKVDTIKLIYNHFLGVTAIYENGSYDYPKYINESVN 96

Query: 121 EFSSIVGTKLHELSRATSTNEAQSVLISPGPHKDPKTLNYALSKVALTSSEYLNKSPGAE 180
           EFS  V +KL EL+ ATS +EAQ++L++PGP K+PKTLNYALSKVAL SSE LNK    E
Sbjct: 97  EFSRSVASKLTELTHATSASEAQNILVAPGPIKEPKTLNYALSKVALNSSECLNKMFPTE 156

Query: 181 DSEVSSSLLKYSDVQAKIAQARLHQDTLIQTKFXXXXXXXXXXXXXXXQKARKNVENKRL 240
           +  ++S+LL++SDVQAKIAQAR+ QDTLIQTKF                K RK+V + RL
Sbjct: 157 EQPLASALLQFSDVQAKIAQARIQQDTLIQTKFNKNLRERLSFEIGKADKCRKDVHSMRL 216

Query: 241 QYDIARANLA-NARPEKEASLRVQMESLEDEFAQATDDAVVIMQKVAESSELLKDLRELV 299
           +YD+AR NLA N +PEKEASLRVQME+LED+FAQ T+DA V +Q+V   +   +DL+EL 
Sbjct: 217 RYDVARTNLANNKKPEKEASLRVQMETLEDQFAQVTEDATVCLQEVISHANFSEDLKELA 276

Query: 300 AAQAEYYKQSAELLSEFL 317
            AQAEY++ SA L+ EFL
Sbjct: 277 KAQAEYFETSAGLMKEFL 294

>KLLA0E04433g complement(406764..407672) similar to sp|P40531
           Saccharomyces cerevisiae YIL041w singleton, start by
           similarity
          Length = 302

 Score =  337 bits (864), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 176/313 (56%), Positives = 231/313 (73%), Gaps = 18/313 (5%)

Query: 6   FADSVNRKFQEISSQVSQRAQEAQLDKKFKDLSTAVSQKTQDFTTQLPSLAQSTQRLMQE 65
           + DS ++K QE+S+ VSQ+AQEAQLD+KFKDL T            LP LA STQR++QE
Sbjct: 4   YFDSFSKKVQELSTSVSQKAQEAQLDQKFKDLKT-----------NLPLLANSTQRMLQE 52

Query: 66  KLGQVTDISQLPQDYVELENKIDRMKLVYENFLKVTQVYENESYDYPNNVRDSVNEFSSI 125
           KLGQVTDISQLP +YV+LE++++ +KL+YENFLKVT++YENESYDYP+NV++SV+EFS +
Sbjct: 53  KLGQVTDISQLPDEYVQLEHRVETIKLIYENFLKVTKIYENESYDYPSNVKESVDEFSKL 112

Query: 126 VGTKLHELSRATSTNEAQSVLISPGPHKDPKTLNYALSKVALTSSEYLNKSPGAEDSEVS 185
           VG KLH+LS+ T+  +AQ+VL+S    K+PKTLNYALSKVALTSSE++      ED  ++
Sbjct: 113 VGGKLHDLSKVTNREQAQNVLLSSPQMKEPKTLNYALSKVALTSSEHV------EDESLA 166

Query: 186 SSLLKYSDVQAKIAQARLHQDTLIQTKFXXXXXXXXXXXXXXXQKARKNVENKRLQYDIA 245
           + L KYSD Q KIAQ RL QDT+IQTKF                KARK VE KRLQYD+ 
Sbjct: 167 NFLAKYSDSQTKIAQLRLQQDTMIQTKFNKAIKEKLEQDIETSTKARKLVEQKRLQYDVV 226

Query: 246 RAN-LANARPEKEASLRVQMESLEDEFAQATDDAVVIMQKVAESSELLKDLRELVAAQAE 304
           R+N L N +PEK+A+L+V+  + E+EFA+ATDDA++ M KV E ++   +L ELVAAQ  
Sbjct: 227 RSNRLKNTKPEKQAALQVEESTHEEEFAKATDDAIIAMSKVVELADFSANLHELVAAQLA 286

Query: 305 YYKQSAELLSEFL 317
           Y+K SAE+L E +
Sbjct: 287 YHKSSAEILEELV 299

>Scas_704.45
          Length = 329

 Score =  300 bits (769), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 162/317 (51%), Positives = 219/317 (69%), Gaps = 22/317 (6%)

Query: 2   SFNSFADSVNRKFQEISSQVSQRAQEAQLDKKFKDLSTAVSQKTQDFTTQLPSLAQSTQR 61
           SFNSF +S ++   E+SS                     VSQKTQ+ +T LP+LAQSTQR
Sbjct: 3   SFNSFTNSFSKTLSELSS--------------------TVSQKTQELSTNLPNLAQSTQR 42

Query: 62  LMQEKLGQVTDISQLPQDYVELENKIDRMKLVYENFLKVTQVYENESYDYPNNVRDSVNE 121
           ++QE+LGQVTDISQLP++Y+ELE K+D +K +Y+NFL V+ VYE +SYDYP   ++S+ E
Sbjct: 43  MVQERLGQVTDISQLPEEYLELEMKLDSIKQIYDNFLAVSSVYEQQSYDYPYVAKESLIE 102

Query: 122 FSSIVGTKLHELSRATSTNEAQSVLISPGPH-KDPKTLNYALSKVALTSSEYLNKSPGAE 180
           FS    +K+ ELS A+S +EAQ++L +     K+PKTLN+ALSKVAL SSE+LN+    E
Sbjct: 103 FSKTAASKVEELSHASSAHEAQNILTTSSTQIKEPKTLNFALSKVALKSSEHLNQFNDNE 162

Query: 181 DSEVS-SSLLKYSDVQAKIAQARLHQDTLIQTKFXXXXXXXXXXXXXXXQKARKNVENKR 239
             + S S+LL +S++QAKIAQARL QD LI+ KF                K RK V++KR
Sbjct: 163 AFKSSASALLNFSNIQAKIAQARLQQDLLIKQKFNDALRHDLATNIAKATKVRKEVQSKR 222

Query: 240 LQYDIARANLANARPEKEASLRVQMESLEDEFAQATDDAVVIMQKVAESSELLKDLRELV 299
           LQYDIAR NL NA+PEKEASLRVQME+LED+FAQAT+ A ++MQ V ++S+++  + EL 
Sbjct: 223 LQYDIARTNLMNAKPEKEASLRVQMETLEDDFAQATEHATIVMQDVIDNSDIVSRVNELA 282

Query: 300 AAQAEYYKQSAELLSEF 316
            AQ  Y++ S+ L+ EF
Sbjct: 283 RAQLAYFELSSSLMKEF 299

>Kwal_55.21227
          Length = 376

 Score = 75.9 bits (185), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 83/338 (24%), Positives = 140/338 (41%), Gaps = 65/338 (19%)

Query: 37  LSTAVSQKTQDFTTQLPSLAQSTQRLMQEKLGQVTDISQLPQDYVELENKIDRMKLVYEN 96
           LSTA++    D    + SL ++ +  +QE LG + DIS+LP  Y  LE K D ++     
Sbjct: 28  LSTAIANIQLDDPQAILSL-KARKHYLQETLGTIEDISKLPPQYQLLEKKCDSLEKACRR 86

Query: 97  FLKVTQVYENESYDYPNNVRDSVNEFSSIVGTKLHELSRATSTNEAQSVLISPGPHKDPK 156
            L VT+ +E E YDYP N+ +S++++ S     L  L  ++  ++      +      P+
Sbjct: 87  MLVVTKTFEVEGYDYPPNLSESLSDWWSSNKEGLFGLMSSSKKDKGAESAAAAKSALMPR 146

Query: 157 TLNYALSKVALTSSEYLNKSPGAEDSEVSSS------------LLK----YSDVQAKIAQ 200
           +   A++K A  S + L      +D E  +S            L+K    +S+ Q KI Q
Sbjct: 147 SFAQAIAKAAKDSGDVL---AALKDQEQQASADEEDEDEDITPLIKMFSAWSECQYKIDQ 203

Query: 201 ARLHQDTLIQTKFXXXXXXXXXXXXXXXQKARKNVENKRLQYDIARAN-----------L 249
            +   D L+  +F                  R+ VE+ RL++D  R             +
Sbjct: 204 GKAEMDALMAKEFNQKLNALIEEKFKNASVLRRKVEDSRLKFDTMRYEVKLTEQQSKQAM 263

Query: 250 ANARPE-KEASLRVQ---------------------------------MESLEDEFAQAT 275
            N + + KE+ L  +                                 +E LEDEF   T
Sbjct: 264 ENEKAQFKESDLSSKEEGADANETSNEVGKSVTKTKEEQATNDAAQELLEKLEDEFVSNT 323

Query: 276 DDAVVIMQKVAESSELLKDLRELVAAQAEYYKQSAELL 313
            +AV  M ++ +S+ELL  ++     Q  Y++Q  + L
Sbjct: 324 TEAVETMGEITDSAELLNLVKLFHNFQLVYHRQCVQDL 361

>AFR309C [3501] [Homologous to ScYPR148C - SH] (1000084..1001178)
           [1095 bp, 364 aa]
          Length = 364

 Score = 73.2 bits (178), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 80/352 (22%), Positives = 143/352 (40%), Gaps = 57/352 (16%)

Query: 2   SFNSFADSVNRKFQEISSQVSQRAQEAQLDKKFKDLSTAVSQKTQDFTTQLPSLAQSTQR 61
           + N+ A    +K  E    ++   Q  ++D    D  T +S KT+             +R
Sbjct: 16  TLNNAAQKTQQKLSETQEHLTHAIQNIKID----DPKTILSLKTR-------------KR 58

Query: 62  LMQEKLGQVTDISQLPQDYVELENKIDRMKLVYENFLKVTQVYENESYDYPNNVRDSVNE 121
            +QE LG   DISQLP  Y  LE K D ++ V +  L V++ +E E YDYP N  +S+++
Sbjct: 59  QLQETLGSAKDISQLPPQYGFLERKCDAIEQVCKKILVVSKTFEVEGYDYPPNPTESISD 118

Query: 122 F--SSIVGTKLHELSRATSTNEAQSVLISPGPHKDPKTLNYALSKVALTSSEYLNKSPGA 179
           +  +S   T+  +  +  +  + +          DP +  +AL + A  S   + +    
Sbjct: 119 WWNTSTKETRFLKFGKGGTDKQKEDKQKQAAGSSDPPSFAHALHRAAKGSQGIIQELKEQ 178

Query: 180 EDSEVSS---------SLLK----YSDVQAKIAQARLHQDTLIQTKFXXXXXXXXXXXXX 226
            + E            SL+K    ++D Q  +  A+   D  +  +F             
Sbjct: 179 AEEEQEQEVEIDEDVESLIKMFGTWADAQYNMDIAKREMDQFMVKEFNEKLKHLLEVEFK 238

Query: 227 XXQKARKNVENKRLQYDIAR-----ANLANARPEKEA--------------------SLR 261
                R+ VE  RL +D  +      + A A+ + EA                    +  
Sbjct: 239 KGHTLRRKVEESRLTFDTLKYEQHERDAALAKKQDEAKQAEGATPSTGVTQSSTADLAFY 298

Query: 262 VQMESLEDEFAQATDDAVVIMQKVAESSELLKDLRELVAAQAEYYKQSAELL 313
            Q+E  EDEF   T +AV  M  +A++++L+  ++     Q  Y+++  + L
Sbjct: 299 AQLEDAEDEFVSNTAEAVEFMTSIADATKLISLVKLFQNFQLVYHRKCVQEL 350

>KLLA0E04543g 412009..413178 similar to sgd|S0006352 Saccharomyces
           cerevisiae YPR148c, start by similarity
          Length = 389

 Score = 68.6 bits (166), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 94/399 (23%), Positives = 152/399 (38%), Gaps = 107/399 (26%)

Query: 1   MSFNSFADSVNRKFQEISSQVSQRAQEAQLDKKFKDLSTAVSQKTQDFTTQLPSLAQSTQ 60
           +S N+  DS++   Q    Q S   ++  LD               D  T+L  L +  Q
Sbjct: 5   LSLNNITDSISNAAQRTQEQFSSAIEKIHLD---------------DPETRLSILKRRHQ 49

Query: 61  RLMQEKLGQVTDISQLPQDYVELENKIDRMKLVYENFLKVTQVYENESYDYPNNVRDSVN 120
             +QE LG V DISQLP  Y  LE K D ++ + +  L VT+ +E E YDYP N+ +S N
Sbjct: 50  --LQETLGTVHDISQLPIQYKFLEQKSDALEKICKRLLLVTKTFEVEGYDYPPNLTESFN 107

Query: 121 EFSSIVGTKLHELSRATSTNEAQSVLISPGPHKD------PKTLNYALSKVALTSSEYLN 174
           ++ S     +   S+  +        +SP   +       P++   ALSK A T S  + 
Sbjct: 108 DWWSGNKDSIFSFSKKKAE-------VSPEVKETAENGLLPRSFAQALSKAA-TDSALIL 159

Query: 175 KSPGAEDSEVS------------------------------------SSLLK----YSDV 194
           K   AE++  +                                     +L+K    ++  
Sbjct: 160 KQLKAEETRTNQEESQEGADQKPAEETKAEPELEAEADEDEDEDEDVDNLIKAFESWTKC 219

Query: 195 QAKIAQARLHQDTLIQTKFXXXXXXXXXXXXXXXQKARKNVENKRLQYDIARANLANARP 254
           Q  I Q++   D+L+  +F                + R  V++ RL +D  R  +     
Sbjct: 220 QLSIDQSKAEMDSLMVKEFNAKLSKLIETDFKKGHELRAKVQDARLNFDTLRHEIKLKLQ 279

Query: 255 EK-------EASLRVQMES-----------------------------LEDEFAQATDDA 278
           EK       EA  +V  E+                             LED+F  AT + 
Sbjct: 280 EKEVVASSEEAEKKVATETPETPEKKTNEEPVDMAKTEEDPDSKLFERLEDQFVSATSET 339

Query: 279 VVIMQKVAESSELLKDLRELVAAQAEYYKQSAELLSEFL 317
           V  + ++ +SSE++  ++     Q  +YKQ  + L E L
Sbjct: 340 VEFLGELTDSSEIISLVKLFHNFQLIHYKQCVKSLEEDL 378

>Scas_676.18
          Length = 444

 Score = 62.4 bits (150), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 58/105 (55%), Gaps = 10/105 (9%)

Query: 30  LDKKFKDLSTAVSQKTQDFTTQLPSLA---------QSTQRLMQEKLGQVTDISQLPQDY 80
           LDK    L+TA +QKT D  +   + A         +S +RL QE +G V DIS LP+ Y
Sbjct: 7   LDKITNSLATA-AQKTSDTLSNAITTATDPATKLSLRSQKRLFQESIGTVHDISTLPEQY 65

Query: 81  VELENKIDRMKLVYENFLKVTQVYENESYDYPNNVRDSVNEFSSI 125
             LE + D ++      L V++ +E E YDYP N+ +S +++ S+
Sbjct: 66  TTLEARTDALEKCLRRILIVSKTFEMEGYDYPPNLSESFSDWWSL 110

 Score = 32.7 bits (73), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 29/48 (60%)

Query: 264 MESLEDEFAQATDDAVVIMQKVAESSELLKDLRELVAAQAEYYKQSAE 311
           +E LED F  +T  AV +M+++ +SSE++  ++     Q  YY+Q  +
Sbjct: 383 LEQLEDTFVSSTASAVEMMEEITDSSEIIGLVKLFQNFQLVYYRQCVQ 430

>CAGL0L08492g 929051..930208 similar to tr|Q06523 Saccharomyces
           cerevisiae YPR148c, start by similarity
          Length = 385

 Score = 62.0 bits (149), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 59/237 (24%), Positives = 103/237 (43%), Gaps = 24/237 (10%)

Query: 37  LSTAVSQKTQDFTTQL--PSLAQSTQ---RLMQEKLGQVTDISQLPQDYVELENKIDRMK 91
           ++ ++S+ TQ    Q   P    S +   R +QE +G   DIS+LP  YV LE K D ++
Sbjct: 9   ITQSISEGTQSLVQQFNDPKTKLSIKAKTRFLQEAIGNERDISKLPPQYVVLEKKCDSIE 68

Query: 92  LVYENFLKVTQVYENESYDYPNNVRDS------------VNEFSSIVGTKLHELSRATST 139
            V +  L VT+ YE E YDYP N+ +S            ++E +  V  K   + +A  T
Sbjct: 69  KVLKRILIVTKTYEIEGYDYPPNISESLSSWWQTKEWFNISELTKNVIPKHGNVEKA-GT 127

Query: 140 NEAQSVLISPGPHKDPKTLNYALSKVALTSSEYLN--KSPGAEDSEVSSSLLK----YSD 193
             ++++      H+ P +   A+++    S       ++   ++ E    L+K    +SD
Sbjct: 128 EASKTLTDKEVSHEGPPSFASAIARAGKDSQLIFESIETKDEDEKEDIDELVKIFKIWSD 187

Query: 194 VQAKIAQARLHQDTLIQTKFXXXXXXXXXXXXXXXQKARKNVENKRLQYDIARANLA 250
              +I+ ++   D ++  +F                  R  VE  RL +D  R  +A
Sbjct: 188 CFYEISDSKTEMDQMMIKEFNVKLEDYLQKNFQKIHTLRAKVEESRLNFDTMRYEVA 244

 Score = 36.6 bits (83), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 32/54 (59%)

Query: 264 MESLEDEFAQATDDAVVIMQKVAESSELLKDLRELVAAQAEYYKQSAELLSEFL 317
           +E LEDEF   T +AV +M +V+E+SELL  ++     Q  Y++   + L + L
Sbjct: 324 LEQLEDEFVSNTTEAVEVMTEVSENSELLSLIKLFQTFQLSYHQHCVKSLEQSL 377

>YPR148C (YPR148C) [5564] chr16 complement(826827..828134) Protein
           of unknown function [1308 bp, 435 aa]
          Length = 435

 Score = 61.2 bits (147), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 46/69 (66%)

Query: 57  QSTQRLMQEKLGQVTDISQLPQDYVELENKIDRMKLVYENFLKVTQVYENESYDYPNNVR 116
           +S  R +QE LG V+DIS+LP  Y  LE K D ++ V +  L V++ +E E YDYP N+ 
Sbjct: 49  KSRTRFVQESLGTVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLT 108

Query: 117 DSVNEFSSI 125
           +S++++ S+
Sbjct: 109 ESISDWWSL 117

 Score = 33.5 bits (75), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 36/67 (53%), Gaps = 1/67 (1%)

Query: 246 RANLANARPEKEASLRVQM-ESLEDEFAQATDDAVVIMQKVAESSELLKDLRELVAAQAE 304
           ++N  N  P  E S   ++ E LEDEF   T  AV  M+++ +SSE+L  ++     Q  
Sbjct: 355 KSNKVNDEPPIEESEDNKLLEKLEDEFVSNTTAAVETMEEITDSSEILGLIKLFQNFQLV 414

Query: 305 YYKQSAE 311
           Y++Q  +
Sbjct: 415 YFRQCVQ 421

>Kwal_56.22618
          Length = 740

 Score = 33.9 bits (76), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 32/61 (52%), Gaps = 7/61 (11%)

Query: 69  QVTDISQLPQDYVELENKIDRMKL-----VYENFLKVTQVYENESYDYPNNVRDSVNEFS 123
           Q   I Q P+DYV LE++ D +++      Y NFL   ++    S+D   N   ++ EFS
Sbjct: 293 QYKSIYQTPKDYVALEDQFDSLEVNKNSKTYLNFLNTIELLNGSSHDLSKN--HTLVEFS 350

Query: 124 S 124
           S
Sbjct: 351 S 351

>CAGL0K08844g 886583..888109 similar to sp|P23180 Saccharomyces
           cerevisiae YHL021c, start by similarity
          Length = 508

 Score = 30.4 bits (67), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 32/57 (56%)

Query: 91  KLVYENFLKVTQVYENESYDYPNNVRDSVNEFSSIVGTKLHELSRATSTNEAQSVLI 147
           +LV+ +FL+  Q +E   YD+ N +R ++ E ++++      L   T+ N  QS L+
Sbjct: 425 RLVFRDFLRGLQQFEKMVYDHENQLRINLPENTAVIYNNRRILHTRTNHNTRQSDLV 481

>Kwal_26.7204
          Length = 1117

 Score = 29.3 bits (64), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 43/87 (49%), Gaps = 1/87 (1%)

Query: 9   SVNRKFQEISSQVSQRAQEAQLDKKFKD-LSTAVSQKTQDFTTQLPSLAQSTQRLMQEKL 67
           ++  K  E++ Q   R Q  QL +  +D L  A  +  +D T ++  L    Q  +QE++
Sbjct: 725 TLRNKASELNQQRKARTQTEQLIRTLEDKLEMAERESRRDVTVKIKQLQGQIQEHVQEQI 784

Query: 68  GQVTDISQLPQDYVELENKIDRMKLVY 94
             +++I +      +L+NKI+   + Y
Sbjct: 785 KGISEIVKYISKLQKLQNKINMANIEY 811

>Scas_684.37
          Length = 470

 Score = 28.9 bits (63), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 23/43 (53%)

Query: 248 NLANARPEKEASLRVQMESLEDEFAQATDDAVVIMQKVAESSE 290
           ++A  RP+   +LR  +E+LEDE     DD  V+  K  E  E
Sbjct: 157 DIAGFRPDMNPALREVLEALEDEAYVVNDDVEVVKTKKVEKIE 199

>CAGL0D02376g complement(244241..246328) similar to tr|Q12309
           Saccharomyces cerevisiae YLR117c CLF1, start by
           similarity
          Length = 695

 Score = 28.9 bits (63), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 19/23 (82%), Gaps = 3/23 (13%)

Query: 80  YVELENKI---DRMKLVYENFLK 99
           Y++LE K+   DR++++YENFLK
Sbjct: 439 YIDLETKLREFDRVRILYENFLK 461

>Sklu_2369.2 YIL068C, Contig c2369 801-3188
          Length = 795

 Score = 28.9 bits (63), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 73/144 (50%), Gaps = 31/144 (21%)

Query: 13  KFQEISSQVSQRAQ--EAQLDKK----FKDLSTAVSQKTQDFTTQLPSLAQSTQRLMQEK 66
           + +EI  Q+++     E QLDK+    FKD   AVS      + +L +L+Q + R ++EK
Sbjct: 21  RIKEIKEQLAKEKSTVEYQLDKESAKHFKD---AVS------SFELMNLSQKSVRSLREK 71

Query: 67  LGQVTDISQLPQDYVELENK--IDRMKLVYENFLKVTQVYENES--YDYPNNVRDSVNEF 122
           + +V  +S+        ENK  IDR +++  N  K+ ++ E  +  YD   N  +  +  
Sbjct: 72  IAKVDTLSK--------ENKSSIDRYEII-NNATKMHELMEKTTNVYDKIVNFNELFDNI 122

Query: 123 SSIVGTKLHELSRATSTNEAQSVL 146
            +++ T   ELSR T  +   S+L
Sbjct: 123 DTLLDT---ELSRDTLESGCPSLL 143

>ACR068W [1115] [Homologous to ScYHR023W (MYO1) - SH]
           complement(480141..485558) [5418 bp, 1805 aa]
          Length = 1805

 Score = 28.5 bits (62), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 40/148 (27%), Positives = 63/148 (42%), Gaps = 18/148 (12%)

Query: 57  QSTQRLMQEKLGQVTDISQLPQDYVE-LENKIDRMKLVYENFLKVTQVYENESYDYPNNV 115
           ++T++++Q  L  +T   +L    +E  E KI +   + E+F     V  N S  +   +
Sbjct: 165 ENTKKILQ-YLASITSDEKLAHTNLESFERKILQANPILESFGNAQTVRNNNSSRFGKFI 223

Query: 116 RDSVNEFSSIVGTKLH----ELSRATSTNEAQS------VLISPGPHKDPKTLNYALSKV 165
           +   +EF  I G  +     E SR    N  +        L+S  P    KTL   L   
Sbjct: 224 KIEFDEFGKINGAHIEWYLLEKSRIIQQNIRERNYHVFYQLLSGMPAGKLKTLE--LVSN 281

Query: 166 ALTSSEYLNKS----PGAEDSEVSSSLL 189
           ++T   YL  S    PG +D+   SSLL
Sbjct: 282 SITDYAYLRDSNPSIPGVDDAHDFSSLL 309

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.309    0.123    0.314 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,704,219
Number of extensions: 331989
Number of successful extensions: 1727
Number of sequences better than 10.0: 118
Number of HSP's gapped: 1693
Number of HSP's successfully gapped: 130
Length of query: 319
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 217
Effective length of database: 13,065,073
Effective search space: 2835120841
Effective search space used: 2835120841
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 61 (28.1 bits)