Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_47.1814562461531220.0
Sklu_2174.463261624110.0
ADL114C61461520840.0
YER049W64463120590.0
CAGL0J02816g62561920430.0
KLLA0E04411g60059719220.0
Scas_715.28*63262517910.0
AAR144W63370760.48
YOR126C (IAH1)23857730.58
CAGL0E05060g109989693.5
KLLA0E21340g1457130684.2
YLR219W (MSC3)72840675.7
AER252C145949667.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_47.18145
         (615 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_47.18145                                                        1207   0.0  
Sklu_2174.4 YER049W, Contig c2174 3142-5040 reverse complement        933   0.0  
ADL114C [1627] [Homologous to ScYER049W - SH] (484310..486154) [...   807   0.0  
YER049W (YER049W) [1477] chr5 (251727..253661) Component of NuA3...   797   0.0  
CAGL0J02816g 272944..274821 highly similar to sp|P40032 Saccharo...   791   0.0  
KLLA0E04411g 404611..406413 similar to sp|P40032 Saccharomyces c...   744   0.0  
Scas_715.28*                                                          694   0.0  
AAR144W [331] [Homologous to ScYLR299W (ECM38) - SH] complement(...    34   0.48 
YOR126C (IAH1) [4928] chr15 complement(559961..560677) Isoamyl a...    33   0.58 
CAGL0E05060g complement(493133..496432) similar to sp|P53114 Sac...    31   3.5  
KLLA0E21340g 1896457..1900830 highly similar to sp|P04051 Saccha...    31   4.2  
YLR219W (MSC3) [3619] chr12 (574153..576339) Protein of unknown ...    30   5.7  
AER252C [2754] [Homologous to ScYOR116C (RPO31) - SH] (1101343.....    30   7.6  

>Kwal_47.18145
          Length = 624

 Score = 1207 bits (3122), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 587/615 (95%), Positives = 587/615 (95%)

Query: 1   MKRTSSTHNDEISKKQPTNEVGKIKSLFNSKIWDPKFQDDLKQEIADSKPYNWGTIXXXX 60
           MKRTSSTHNDEISKKQPTNEVGKIKSLFNSKIWDPKFQDDLKQEIADSKPYNWGTI    
Sbjct: 1   MKRTSSTHNDEISKKQPTNEVGKIKSLFNSKIWDPKFQDDLKQEIADSKPYNWGTIRDLV 60

Query: 61  XXXXXXXXXKEVETQIHFTKKETDIYKVNQSGDLANLSGLDWEDLSRLPNLCKLREILYS 120
                    KEVETQIHFTKKETDIYKVNQSGDLANLSGLDWEDLSRLPNLCKLREILYS
Sbjct: 61  DDDLLRAVRKEVETQIHFTKKETDIYKVNQSGDLANLSGLDWEDLSRLPNLCKLREILYS 120

Query: 121 EVYRDVISHVTGAGKLSGSKMDMSINTYTKGCHLLTHDDVIGSRRVSFILYLPDPNTRWK 180
           EVYRDVISHVTGAGKLSGSKMDMSINTYTKGCHLLTHDDVIGSRRVSFILYLPDPNTRWK
Sbjct: 121 EVYRDVISHVTGAGKLSGSKMDMSINTYTKGCHLLTHDDVIGSRRVSFILYLPDPNTRWK 180

Query: 181 EHYGGGLRLFPSIVANVPQSDHSAKLIPQFNQIAFFQVQPGFSFHDVEEVRVNRHRLSIQ 240
           EHYGGGLRLFPSIVANVPQSDHSAKLIPQFNQIAFFQVQPGFSFHDVEEVRVNRHRLSIQ
Sbjct: 181 EHYGGGLRLFPSIVANVPQSDHSAKLIPQFNQIAFFQVQPGFSFHDVEEVRVNRHRLSIQ 240

Query: 241 GWYHIPQEGEKGYIPGEEEEWVKTNTSTLAQLESNVLQDYEFPKGERDILPNHQIKHYEH 300
           GWYHIPQEGEKGYIPGEEEEWVKTNTSTLAQLESNVLQDYEFPKGERDILPNHQIKHYEH
Sbjct: 241 GWYHIPQEGEKGYIPGEEEEWVKTNTSTLAQLESNVLQDYEFPKGERDILPNHQIKHYEH 300

Query: 301 LLEAQPANKEEESSSDELALPDLSFLTDKEMKFLSSFVSAEYLTPEGIAKLQKRFIDNSH 360
           LLEAQPANKEEESSSDELALPDLSFLTDKEMKFLSSFVSAEYLTPEGIAKLQKRFIDNSH
Sbjct: 301 LLEAQPANKEEESSSDELALPDLSFLTDKEMKFLSSFVSAEYLTPEGIAKLQKRFIDNSH 360

Query: 361 LQVDDFLSDERANLLKQLIKRDELDKECPYESVNVEMPWKTAMPPHKWRYLYIDGKSHEN 420
           LQVDDFLSDERANLLKQLIKRDELDKECPYESVNVEMPWKTAMPPHKWRYLYIDGKSHEN
Sbjct: 361 LQVDDFLSDERANLLKQLIKRDELDKECPYESVNVEMPWKTAMPPHKWRYLYIDGKSHEN 420

Query: 421 FTTEQDILDKLNNEERPNYVLLKQSLDKKKYDTETELISVAEFFQSTAFKKYXXXXXXXX 480
           FTTEQDILDKLNNEERPNYVLLKQSLDKKKYDTETELISVAEFFQSTAFKKY        
Sbjct: 421 FTTEQDILDKLNNEERPNYVLLKQSLDKKKYDTETELISVAEFFQSTAFKKYLALLTLLS 480

Query: 481 XXXXXXXIRRFRPGKDFTLATQLNKNDLLGHVEGIVDAVLEGTLCLTPTNGWESGEVGGY 540
                  IRRFRPGKDFTLATQLNKNDLLGHVEGIVDAVLEGTLCLTPTNGWESGEVGGY
Sbjct: 481 PLSEQVLIRRFRPGKDFTLATQLNKNDLLGHVEGIVDAVLEGTLCLTPTNGWESGEVGGY 540

Query: 541 ELYMDNQDESEDMDKDIEDAAVYKTDDAGDAVLINKPPSWNSLNLVLRDESVLQFIKYVS 600
           ELYMDNQDESEDMDKDIEDAAVYKTDDAGDAVLINKPPSWNSLNLVLRDESVLQFIKYVS
Sbjct: 541 ELYMDNQDESEDMDKDIEDAAVYKTDDAGDAVLINKPPSWNSLNLVLRDESVLQFIKYVS 600

Query: 601 WSAKSSRWDITAQWD 615
           WSAKSSRWDITAQWD
Sbjct: 601 WSAKSSRWDITAQWD 615

>Sklu_2174.4 YER049W, Contig c2174 3142-5040 reverse complement
          Length = 632

 Score =  933 bits (2411), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/616 (72%), Positives = 510/616 (82%), Gaps = 1/616 (0%)

Query: 1   MKRTSSTHNDEISKKQPTNEVGKIKSLFNSKIWDPKFQDDLKQEIADSKPYNWGTIXXXX 60
           MKR++ + +     KQ   E  K+K LFNSKIWDP+FQ  L+QEIA+SKPYNWGTI    
Sbjct: 1   MKRSAPSKSVVNPTKQQAGEESKVKPLFNSKIWDPEFQAALRQEIAESKPYNWGTIRDLI 60

Query: 61  XXXXXXXXXKEVETQIHFTKKETDIYKVNQSGDLANLSGLDWEDLSRLPNLCKLREILYS 120
                    KE+ETQIHFT KETDIYKVNQSGDLANLSGLDW DLSRLPNL KLREILYS
Sbjct: 61  NDDLLRAVRKEIETQIHFTNKETDIYKVNQSGDLANLSGLDWNDLSRLPNLFKLREILYS 120

Query: 121 EVYRDVISHVTGAGKLSGSKMDMSINTYTKGCHLLTHDDVIGSRRVSFILYLPDPNTRWK 180
           E+YRDVIS+VTGAGKLSGSK DMSINTYTKGCHLLTHDDVIGSRRVSFILYLPDP+ +WK
Sbjct: 121 EIYRDVISYVTGAGKLSGSKTDMSINTYTKGCHLLTHDDVIGSRRVSFILYLPDPDKQWK 180

Query: 181 EHYGGGLRLFPSIVANVPQSDHSAKLIPQFNQIAFFQVQPGFSFHDVEEVRVNRHRLSIQ 240
           +HYGGGLRLFPSIVANVP SDHSAKL+PQFNQIAFFQVQPGFSFHDVEEVRV++HRLSIQ
Sbjct: 181 DHYGGGLRLFPSIVANVPHSDHSAKLVPQFNQIAFFQVQPGFSFHDVEEVRVDKHRLSIQ 240

Query: 241 GWYHIPQEGEKGYIPGEEEEWVKTNTSTLAQLESNVLQDYEFPKGERDILPNHQIKHYEH 300
           GWYHIPQ GE G+IPGEEEEWVKTNTSTLAQLESNVLQDYEFPK ERDILP HQ+KH+E 
Sbjct: 241 GWYHIPQVGEPGHIPGEEEEWVKTNTSTLAQLESNVLQDYEFPKNERDILPYHQVKHFEK 300

Query: 301 LLEAQPANKEEESSSDEL-ALPDLSFLTDKEMKFLSSFVSAEYLTPEGIAKLQKRFIDNS 359
           +L+    + +       + A+ D   LT++E+ +LS FVS EYLTP GI  LQ RF++NS
Sbjct: 301 VLQDSSPDSDSSKEKSPVSAIVDTKNLTEEELHYLSQFVSEEYLTPTGIQSLQSRFLENS 360

Query: 360 HLQVDDFLSDERANLLKQLIKRDELDKECPYESVNVEMPWKTAMPPHKWRYLYIDGKSHE 419
            LQ+  FL+D ++ LLK+LIK DEL+K+CPYES  V+ PWKTA+PPHKWRYLYIDGKSHE
Sbjct: 361 FLQIGSFLNDSKSKLLKRLIKNDELNKDCPYESDKVDAPWKTAIPPHKWRYLYIDGKSHE 420

Query: 420 NFTTEQDILDKLNNEERPNYVLLKQSLDKKKYDTETELISVAEFFQSTAFKKYXXXXXXX 479
           NF +E DIL KLNNEE PNY  LKQ+LDK+K+DTE EL+ + EFFQST FKKY       
Sbjct: 421 NFRSEADILAKLNNEELPNYTFLKQTLDKEKHDTEYELVQLVEFFQSTIFKKYLALLTSL 480

Query: 480 XXXXXXXXIRRFRPGKDFTLATQLNKNDLLGHVEGIVDAVLEGTLCLTPTNGWESGEVGG 539
                   +RRFRPGKDFTLAT++N+N LL +VEG VDAVLEGTLCLTPTNGW+SGEVGG
Sbjct: 481 CPLSEQILVRRFRPGKDFTLATKINQNKLLSNVEGYVDAVLEGTLCLTPTNGWDSGEVGG 540

Query: 540 YELYMDNQDESEDMDKDIEDAAVYKTDDAGDAVLINKPPSWNSLNLVLRDESVLQFIKYV 599
           YELYM++QD+ E  DKD+EDAAVYK DD+GD+VLIN PPSWNSLNLVLRDESVLQF+KY+
Sbjct: 541 YELYMNDQDDEEMRDKDLEDAAVYKADDSGDSVLINSPPSWNSLNLVLRDESVLQFVKYI 600

Query: 600 SWSAKSSRWDITAQWD 615
           SWSAKSSRWD++ QWD
Sbjct: 601 SWSAKSSRWDVSMQWD 616

>ADL114C [1627] [Homologous to ScYER049W - SH] (484310..486154)
           [1845 bp, 614 aa]
          Length = 614

 Score =  807 bits (2084), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/615 (63%), Positives = 477/615 (77%), Gaps = 16/615 (2%)

Query: 1   MKRTSSTHNDEISKKQPTNEVGKIKSLFNSKIWDPKFQDDLKQEIADSKPYNWGTIXXXX 60
           MKR + +       KQP  E+ K+K+ FNSKIWD  +++ L++E+A +KPYNWGTI    
Sbjct: 1   MKRRAPSQ-PVFESKQPFLEIEKVKASFNSKIWDDSYREQLREEVASNKPYNWGTIHDLV 59

Query: 61  XXXXXXXXXKEVETQIHFTKKETDIYKVNQSGDLANLSGLDWEDLSRLPNLCKLREILYS 120
                    +E+E +IHFT KETDIYKVNQSGDLANLSGLDW+DLSRLP+LC+LR+ILYS
Sbjct: 60  DPDLLRSVRREIEKEIHFTNKETDIYKVNQSGDLANLSGLDWKDLSRLPSLCRLRQILYS 119

Query: 121 EVYRDVISHVTGAGKLSGSKMDMSINTYTKGCHLLTHDDVIGSRRVSFILYLPDPNTRWK 180
           +VYRD I +V GAGKLSG+KMDMSINTYTKGCHLLTHDDVIGSRRVSFILYLPDP+  WK
Sbjct: 120 DVYRDFIGYVAGAGKLSGTKMDMSINTYTKGCHLLTHDDVIGSRRVSFILYLPDPDKTWK 179

Query: 181 EHYGGGLRLFPSIVANVPQSDHSAKLIPQFNQIAFFQVQPGFSFHDVEEVRVNRHRLSIQ 240
           EHYGG LRLFPSI+ NVP SD SAKL+PQFNQ+AFF V PG+SFHDVEEV+V++HRLSIQ
Sbjct: 180 EHYGGALRLFPSIIPNVPTSDFSAKLVPQFNQLAFFHVHPGYSFHDVEEVKVDKHRLSIQ 239

Query: 241 GWYHIPQEGEKGYIPGEEEEWVKTNTSTLAQLESNVLQDYEFPKGERDILPNHQIKHYEH 300
           GWYHIPQEGE+G++PGEEE++V TN STLAQLES +LQDYEF K ER ILP  Q+K  E 
Sbjct: 240 GWYHIPQEGEEGFVPGEEEQYVNTNISTLAQLESILLQDYEFLKSERSILPLQQLKQLEK 299

Query: 301 LLEAQPANKEEESSSDELALPDLSFLTDKEMKFLSSFVSAEYLTPEGIAKLQKRFIDNSH 360
            L          S S++ A     +L   E+ +LS ++S E+L+ EGI  LQ +F +NS+
Sbjct: 300 FL---------GSESEDTAF----YLNADELAYLSMYISEEHLSLEGIKSLQSKFTENSY 346

Query: 361 LQVDDFLSDERANLLKQLIKRDELDKECPYESVNVEMPWKTAMPPHKWRYLYIDGKSHEN 420
           LQ+D FL+++++ LLK+LIK +EL+KECPY++  VE PWKTA+PP+KWR++YIDGKSHE+
Sbjct: 347 LQIDSFLNEQKSALLKKLIKIEELEKECPYKAAEVEKPWKTAIPPYKWRFMYIDGKSHEH 406

Query: 421 FTTEQDILDKLNNEERPNYVLLKQSLDKKKYDTETELISVAEFFQSTAFKKYXXXXXXXX 480
           F +E DI  +L +EE PN+ LLKQ L       E  L+ + EFF+S AFKKY        
Sbjct: 407 FCSEDDIKRRLVHEELPNFTLLKQGL-SDHLSVEPALLELVEFFKSFAFKKYLALLTLLC 465

Query: 481 XXXXXXXIRRFRPGKDFTLATQLNKNDLLGHVEGIVDAVLEGTLCLTPTNGWESGEVGGY 540
                  IRRFRPG DFTLAT++  + LL HVEG VDAVLEG LCLTPT+GWESGE+GGY
Sbjct: 466 PLTEQLLIRRFRPGHDFTLATKIYPSQLLQHVEGFVDAVLEGVLCLTPTDGWESGELGGY 525

Query: 541 ELYMDNQDESEDMDKDIEDAAVYKTDDAGDAVLINKPPSWNSLNLVLRDESVLQFIKYVS 600
           ELYM +QD+ EDM+KD+EDAAVY++DD+G +VLINKP SWNS NLVLRDESVLQF+KYVS
Sbjct: 526 ELYMGDQDD-EDMNKDVEDAAVYRSDDSGSSVLINKPASWNSFNLVLRDESVLQFVKYVS 584

Query: 601 WSAKSSRWDITAQWD 615
           W+AKSSRWDI+  WD
Sbjct: 585 WAAKSSRWDISMNWD 599

>YER049W (YER049W) [1477] chr5 (251727..253661) Component of NuA3
           histone acetyltransferase complex [1935 bp, 644 aa]
          Length = 644

 Score =  797 bits (2059), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/631 (61%), Positives = 480/631 (76%), Gaps = 16/631 (2%)

Query: 1   MKRTSSTHNDEISK--KQPTNEVGKIKSLFNSKIWDPKFQDDLKQEIADSKPYNWGTIXX 58
           MKR ++    E  +  KQ + E  KIK +FN KIWD  FQD LK+EI DS+PYNWGTI  
Sbjct: 1   MKRKTAEVKGEKERNSKQISLEEDKIKGMFNPKIWDKTFQDGLKKEIEDSQPYNWGTIHE 60

Query: 59  XXXXXXXXXXXKEVETQIHFTKKETDIYKVNQSGDLANLSGLDWEDLSRLPNLCKLREIL 118
                      KE+ET+IHFTKKETDIY+VNQSGDLANLSGLDW+DLSRLPNL KLR+IL
Sbjct: 61  LVNDDLLRAVRKEIETEIHFTKKETDIYRVNQSGDLANLSGLDWDDLSRLPNLFKLRQIL 120

Query: 119 YSEVYRDVISHVTGAGKLSGSKMDMSINTYTKGCHLLTHDDVIGSRRVSFILYLPDPNTR 178
           YS+ YRD   +VT AGKLSGSK DMSINTYTKGCHLLTHDDVIGSRR+SFILYLPDP+ +
Sbjct: 121 YSKQYRDFFGYVTKAGKLSGSKTDMSINTYTKGCHLLTHDDVIGSRRISFILYLPDPDRK 180

Query: 179 WKEHYGGGLRLFPSIVANVPQSDHSAKLIPQFNQIAFFQVQPGFSFHDVEEVRVNRHRLS 238
           WK HYGGGLRLFPSI+ NVP SD SAKL+PQFNQIAFF+V PGFSFHDVEEV+V++HRLS
Sbjct: 181 WKSHYGGGLRLFPSILPNVPHSDPSAKLVPQFNQIAFFKVLPGFSFHDVEEVKVDKHRLS 240

Query: 239 IQGWYHIPQEGEKGYIPGEEEEWVKTNTSTLAQLESNVLQDYEFPKGERDILPNHQIKHY 298
           IQGWYHIPQ GE+GYIPGEEE WV+ NTSTLAQ+ESNVL+D+EFPK ER+IL  H++KH+
Sbjct: 241 IQGWYHIPQVGEEGYIPGEEEAWVRNNTSTLAQIESNVLEDFEFPKDERNILSFHEVKHF 300

Query: 299 EHLLEAQPANKEEESSSDEL--ALPDLSFLTDKEMKFLSSFVSAEYLTPEGIAKLQKRFI 356
           E +L+     K + +  + +   + D   L++ E  +LS ++S E+L+ +GI KLQK+F+
Sbjct: 301 EKMLKGDAGAKTDNTPKESMTSVISDSVKLSEAEFTYLSQYISPEHLSSKGIEKLQKQFV 360

Query: 357 DNSHLQVDDFLSDERANLLKQLIKRDELDKECPYESVNVEMPWKTAMPPHKWRYLYIDGK 416
           +NS LQ++ FL+D+++ LLK++IK+ EL++ECPY S +V+ PWKTA+PPHK RYLYIDGK
Sbjct: 361 ENSSLQIESFLNDDKSELLKKVIKQKELEQECPYHSKDVKAPWKTAIPPHKARYLYIDGK 420

Query: 417 SHENFTTEQDILDKLNNEERPNYVLLKQSLD----------KKKYDTETELISVAEFFQS 466
            + NF TE DIL+ LNN + PN+   K ++           +  +D E  LI +A F +S
Sbjct: 421 EYRNFQTEADILEALNNNDLPNFQFTKDAIKIISDASGNSRENNFDAELALIDLAVFHKS 480

Query: 467 TAFKKYXXXXXXXXXXXXXXXIRRFRPGKDFTLATQLNKNDLLGHVEGIVDAVLEGTLCL 526
           T FKKY               IRRFRPG DFTLAT+   N+LL     I+DAVLEGTLCL
Sbjct: 481 TIFKKYLALLTSLCPVSEQILIRRFRPGMDFTLATKCRFNELLKSNPDIIDAVLEGTLCL 540

Query: 527 TPTNGWESGEVGGYELYM--DNQDESEDMDKDIEDAAVYKTDDAGDAVLINKPPSWNSLN 584
           TP+ GWESGE+GGYELYM  D++D  + + +D+EDA+VY+ DD+GD+VLIN PP+WN+ N
Sbjct: 541 TPSAGWESGELGGYELYMMDDDEDNKQYLKEDVEDASVYRADDSGDSVLINDPPAWNTFN 600

Query: 585 LVLRDESVLQFIKYVSWSAKSSRWDITAQWD 615
           LVLRDESVL+F+KYVSWSAKSSRWD+  +WD
Sbjct: 601 LVLRDESVLEFVKYVSWSAKSSRWDVKMKWD 631

>CAGL0J02816g 272944..274821 highly similar to sp|P40032
           Saccharomyces cerevisiae YER049w, start by similarity
          Length = 625

 Score =  791 bits (2043), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/619 (61%), Positives = 473/619 (76%), Gaps = 7/619 (1%)

Query: 1   MKRTSSTHNDEISKKQPTNEVGKIKSLFNSKIWDPKFQDDLKQEIADSKPYNWGTIXXXX 60
           MKR +     E   KQ   E  K+K LFN K+W P+F++ LK +I  S PYNWG I    
Sbjct: 1   MKRKAEAQ--ENGNKQLDLEEDKVKGLFNQKLWTPEFREGLKNQIDSSAPYNWGNISGLV 58

Query: 61  XXXXXXXXXKEVETQIHFTKKETDIYKVNQSGDLANLSGLDWEDLSRLPNLCKLREILYS 120
                    KE+ET+IHFTKKETDIYKVNQSGDLANLSGL+W+DLSRLPN+ KLR+ILYS
Sbjct: 59  NDDLLRAVRKEIETEIHFTKKETDIYKVNQSGDLANLSGLNWDDLSRLPNMYKLRQILYS 118

Query: 121 EVYRDVISHVTGAGKLSGSKMDMSINTYTKGCHLLTHDDVIGSRRVSFILYLPDPNTRWK 180
           +VYRD+I +VTGAGKLSGSKMDMS+NTYTKGCHLLTHDDVIGSRR+SFILYLPDP+ +WK
Sbjct: 119 DVYRDLIGYVTGAGKLSGSKMDMSVNTYTKGCHLLTHDDVIGSRRISFILYLPDPDRKWK 178

Query: 181 EHYGGGLRLFPSIVANVPQSDHSAKLIPQFNQIAFFQVQPGFSFHDVEEVRVNRHRLSIQ 240
             YGGGLRLF SI+ N+P++D  AK +PQFN+IAFF+V PGFSFHDVEEV+V++HRLSIQ
Sbjct: 179 PQYGGGLRLFSSILPNIPETDPCAKFVPQFNEIAFFKVLPGFSFHDVEEVKVDKHRLSIQ 238

Query: 241 GWYHIPQEGEKGYIPGEEEEWVKTNTSTLAQLESNVLQDYEFPKGERDILPNHQIKHYEH 300
           GWYH PQ GE GY PG+EE WVK NTSTL QLE+NVLQD+E+PK ERDILP HQ+KH+E 
Sbjct: 239 GWYHFPQPGEPGYTPGQEEAWVKNNTSTLTQLETNVLQDFEYPKQERDILPYHQVKHFEK 298

Query: 301 LLEAQPANKEEESSSDELALPDLSFLTDKEMKFLSSFVSAEYLTPEGIAKLQKRFIDNSH 360
           +L A    K +E     + + D   L++KE K+LS ++SAE+LT EGI KLQ++F++NS 
Sbjct: 299 VLYAADGKKIDEDEVKSV-VQDTDSLSEKEYKYLSQYISAEHLTKEGIKKLQEQFLENST 357

Query: 361 LQVDDFLSDERANLLKQLIKRDELDKECPYESVNVEMPWKTAMPPHKWRYLYIDGKSHEN 420
           LQ+ DFL++E + LLK++IK +EL+K CPY + +VE PW+TAMP HKWRY+YIDGK+   
Sbjct: 358 LQIKDFLNEEVSELLKKMIKTEELEKACPYMAKDVETPWQTAMPSHKWRYMYIDGKNPRK 417

Query: 421 FTTEQDILDKLNNEERPNYVLLKQSLDK-KKYDTETELISVAEFFQSTAFKKYXXXXXXX 479
                DI++ LNNEE PN+ LL+++L K    D E +LI +A F++ST FKKY       
Sbjct: 418 LLKASDIMEALNNEELPNFELLRETLPKDGSVDVELKLIDLAIFYKSTIFKKYLALLTAL 477

Query: 480 XXXXXXXXIRRFRPGKDFTLATQLNKNDLLGHVEGIVDAVLEGTLCLTPTNGWESGEVGG 539
                   IRRFRPG DFTLATQ   N+ L  VEGI+ ++L G LCLTP++GWESGEVGG
Sbjct: 478 CPLSEQILIRRFRPGNDFTLATQCRLNEFLQDVEGILPSILVGNLCLTPSSGWESGEVGG 537

Query: 540 YELYM---DNQDESEDMDKDIEDAAVYKTDDAGDAVLINKPPSWNSLNLVLRDESVLQFI 596
           YELYM   +N +E E M KD+EDA+VY+TDD GD+VL+N PPSWN+ NLVLRD+SVL+F+
Sbjct: 538 YELYMMDDENTEEEERMHKDVEDASVYRTDDNGDSVLVNNPPSWNTFNLVLRDQSVLEFV 597

Query: 597 KYVSWSAKSSRWDITAQWD 615
           KYVS +AKSSRWD+  +WD
Sbjct: 598 KYVSCAAKSSRWDVKMEWD 616

>KLLA0E04411g 404611..406413 similar to sp|P40032 Saccharomyces
           cerevisiae YER049w singleton, start by similarity
          Length = 600

 Score =  744 bits (1922), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/597 (62%), Positives = 449/597 (75%), Gaps = 27/597 (4%)

Query: 20  EVGKIKSLFNSKIWDPKFQDDLKQEIADSKPYNWGTIXXXXXXXXXXXXXKEVETQIHFT 79
           E  K    FNSKIWD  FQDDL+QEI +++PYNWGTI             +E+ET IHFT
Sbjct: 25  ESSKAVGSFNSKIWDKSFQDDLRQEIKNAQPYNWGTIRDLVDPNLLQEVRREIETSIHFT 84

Query: 80  KKETDIYKVNQSGDLANLSGLDWEDLSRLPNLCKLREILYSEVYRDVISHVTGAGKLSGS 139
           +KETDIYKVNQSGDLANLSGLD  DLS+LP+L KLRE+LYSE YRD I++VT +GKLSGS
Sbjct: 85  QKETDIYKVNQSGDLANLSGLDDADLSKLPSLVKLRELLYSEKYRDFIAYVTQSGKLSGS 144

Query: 140 KMDMSINTYTKGCHLLTHDDVIGSRRVSFILYLPDPNTRWKEHYGGGLRLFPSIVANVPQ 199
           K D+SINTYTKGCHLLTHDDVIGSRRVSFILYLP+P   WKEHYGGGLRLFPSIV NVP 
Sbjct: 145 KTDISINTYTKGCHLLTHDDVIGSRRVSFILYLPEPERVWKEHYGGGLRLFPSIVPNVPF 204

Query: 200 SDHSAKLIPQFNQIAFFQVQPGFSFHDVEEVRVNRHRLSIQGWYHIPQEGEKGYIPGEEE 259
           SDHSAKL+PQFNQIAFF+VQPGFSFHDVEEV+V++HRLSIQGWYHIPQEGE GY PGEEE
Sbjct: 205 SDHSAKLVPQFNQIAFFKVQPGFSFHDVEEVKVDKHRLSIQGWYHIPQEGEPGYTPGEEE 264

Query: 260 EWVKTNTSTLAQLESNVLQDYEFPKGERDILPNHQIKHYEHLLEAQPANKEEESSSDELA 319
           EW+KTN STL+QL ++ LQDYEFPK +R  L      HYE               S +L 
Sbjct: 265 EWIKTNISTLSQLVNSPLQDYEFPKIDRTPL-----SHYE---------------SGKLD 304

Query: 320 LPDLSFLTDKEMKFLSSFVSAEYLTPEGIAKLQKRFIDNSHLQVDDFLSDERANLLKQLI 379
             D   LT+ ++ FLS F++ E+LT E + K+  +F+++S + ++ FL+DE ++LLK+LI
Sbjct: 305 RTD-DLLTEDDITFLSKFLNPEHLTTESMRKISDKFVEDSFINIESFLNDEYSSLLKKLI 363

Query: 380 KRDELDKECPYESVNVEMPWKTAMPPHKWRYLYIDGKSHENFTTEQDILDKLNNEERPNY 439
              E + +CPYESVNV  PWKT++PPHKWRYLYIDGKS+ NF  E+DI   LNN E PN+
Sbjct: 364 MDKEFNYDCPYESVNVRHPWKTSLPPHKWRYLYIDGKSYTNFRNEEDIKKALNNPELPNF 423

Query: 440 -VLLKQSLDKKKYDTETELISVAEFFQSTAFKKYXXXXXXXXXXXXXXXIRRFRPGKDFT 498
             LL    DK++++ E +L  +A F QS +FKK+               IRRFRPGKDFT
Sbjct: 424 HQLLSSFADKEEFNCEAKLCELAIFLQSISFKKWIVQLTKLVILSEQLLIRRFRPGKDFT 483

Query: 499 LATQLNKNDLLGHVEGIVDAVLEGTLCLTPTNGWESGEVGGYELYMDNQDESEDMDKDIE 558
           LAT    N+LL  + G V+A+LE TLCLTP+ GW+SGEVGGYELYM+NQD+ ED      
Sbjct: 484 LATTTEVNELLKTIPGFVEAILECTLCLTPSKGWDSGEVGGYELYMNNQDDDEDD----- 538

Query: 559 DAAVYKTDDAGDAVLINKPPSWNSLNLVLRDESVLQFIKYVSWSAKSSRWDITAQWD 615
           DAA+Y+ DD GD+VLINKP SWNSLNLVLRDE+VLQFIKYVSW+AKSSRWDI+ QWD
Sbjct: 539 DAAIYRADDDGDSVLINKPASWNSLNLVLRDENVLQFIKYVSWAAKSSRWDISLQWD 595

>Scas_715.28*
          Length = 632

 Score =  694 bits (1791), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/625 (53%), Positives = 454/625 (72%), Gaps = 15/625 (2%)

Query: 1   MKRTSSTHNDEISKKQPTNEVGKIKSLFNSKIWDPKFQDDLKQEIADSKPYNWGTIXXXX 60
           MKR+S   +   +K Q T E  K+K+LFN +IW+P +Q +L+ EIA+SKP+NWG+I    
Sbjct: 1   MKRSSGDDSAAQAKMQ-TLEDDKLKALFNPRIWEPDYQKELRDEIANSKPFNWGSIPKLI 59

Query: 61  XXXXXXXXXKEVETQIHFTKKETDIYKVNQSGDLANLSGLDWEDLSRLPNLCKLREILYS 120
                    KE+ET+IHF+KKETDIYKVNQSGDLANLS LDW DLSRLPNL KLR++LYS
Sbjct: 60  DDDLLRAVRKEIETEIHFSKKETDIYKVNQSGDLANLSKLDWNDLSRLPNLFKLRQLLYS 119

Query: 121 EVYRDVISHVTGAGKLSGSKMDMSINTYTKGCHLLTHDDVIGSRRVSFILYLPDPNTRWK 180
           E YRD  +++T +G LSG K DMSINTYTKGCHL+ HDDVIGSRR+SFILYLPDP+ +WK
Sbjct: 120 EKYRDFFAYITQSGHLSGKKTDMSINTYTKGCHLVPHDDVIGSRRISFILYLPDPDRKWK 179

Query: 181 EHYGGGLRLFPSIVANVPQSDHSAKLIPQFNQIAFFQVQPGFSFHDVEEVRVNRHRLSIQ 240
            HYGGGLRL+ +I+ NVP++D  AKL+PQFNQIAFF+V PGFSFHDVEEV+V++HRLSIQ
Sbjct: 180 SHYGGGLRLYDTIMPNVPENDPCAKLVPQFNQIAFFKVNPGFSFHDVEEVKVDKHRLSIQ 239

Query: 241 GWYHIPQEGEKGYIPGEEEEWVKTNTSTLAQLESNVLQDYEFPKGERDILPNHQIKHYEH 300
           GWYHIPQEG+KGYIP EE  ++  N + L +L+S VL+D+EFPK ER++LPN+QIKH+E 
Sbjct: 240 GWYHIPQEGDKGYIPNEEATYIDKNITQLGELDSAVLEDFEFPKEERELLPNYQIKHFEK 299

Query: 301 LLEAQPANKEEESSSDELALP--------DLSFLTDKEMKFLSSFVSAEYLTPEGIAKLQ 352
           +LE   +N  +  SS+ L++P        ++  LT++E+ +LS +V+ E+LT EGI+KLQ
Sbjct: 300 ILER--SNSGDNDSSNVLSIPSGMKVIPSEIPSLTEEEVAYLSEYVALEHLTKEGISKLQ 357

Query: 353 KRFIDNSHLQVDDFLSDERANLLKQLIKRDELDKECPYESVNVEMPWKTAMPPHKWRYLY 412
           + F++NS L ++ FL++E+++LL+  IKR EL+K+CP  S +V  PWKTAMP HK +YLY
Sbjct: 358 ESFLENSFLSIESFLNEEKSSLLENQIKRTELEKDCPLFSKDVAYPWKTAMPSHKCKYLY 417

Query: 413 IDGKSHENFTTEQDILDKLNNEERPNYVLLKQ--SLDKKKYDTETELISVAEFFQSTAFK 470
           IDGK  ++  T   ++  LNN+E  N+ ++K+  ++ K+  DTE  LI ++ FF+S  FK
Sbjct: 418 IDGKKQQDLATADGLITTLNNDENSNFEMVKELVNIGKEDIDTEKSLIELSIFFKSLIFK 477

Query: 471 KYXXXXXXXXXXXXXXXIRRFRPGKDFTLATQLNKNDLLGHVEGIVDAVLEGTLCLTPTN 530
           KY               IRRFRPG DFTLA +   N    ++  ++D VL          
Sbjct: 478 KYLVLLTSLCLITEQVLIRRFRPGNDFTLANKCKMN--TKYLNEVLDNVLRRYFMFDSIK 535

Query: 531 GWESGEVGGYELYMDNQDESEDMDKDIEDAAVYKTDDAGDAVLINKPPSWNSLNLVLRDE 590
           GWE+G+VGGYE+YM +  + +  D+D  +A  YK D+ G+++L+N P SWN+ NLVLRDE
Sbjct: 536 GWETGDVGGYEIYMMDGTKEKAEDEDDVEAERYKNDENGESILLNSPASWNTFNLVLRDE 595

Query: 591 SVLQFIKYVSWSAKSSRWDITAQWD 615
           SVL+F+KY+SW AKSSRWDI  +WD
Sbjct: 596 SVLEFVKYISWEAKSSRWDIKLKWD 620

>AAR144W [331] [Homologous to ScYLR299W (ECM38) - SH]
           complement(600227..602128) [1902 bp, 633 aa]
          Length = 633

 Score = 33.9 bits (76), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 33/70 (47%), Gaps = 3/70 (4%)

Query: 495 KDFTLATQLNKNDLLGHVEGI--VDAVLEGTLCLTPTNGWESG-EVGGYELYMDNQDESE 551
            D  L  ++  +D+L  + G    DA +  +LC+   N + SG   GG+ +Y D QD   
Sbjct: 83  SDLELCNRMTVHDILLGIPGANAADAAVTMSLCIGMINFFNSGIGGGGFAVYTDGQDPER 142

Query: 552 DMDKDIEDAA 561
            +  D  + A
Sbjct: 143 HLAFDFREMA 152

>YOR126C (IAH1) [4928] chr15 complement(559961..560677) Isoamyl
           acetate-hydrolyzing esterase enzyme [717 bp, 238 aa]
          Length = 238

 Score = 32.7 bits (73), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 30/57 (52%)

Query: 416 KSHENFTTEQDILDKLNNEERPNYVLLKQSLDKKKYDTETELISVAEFFQSTAFKKY 472
           +++ENF    D L KL NEE+  +V L ++  ++  D   +L++    F    +K +
Sbjct: 143 RTNENFAIYSDALAKLANEEKVPFVALNKAFQQEGGDAWQQLLTDGLHFSGKGYKIF 199

>CAGL0E05060g complement(493133..496432) similar to sp|P53114
           Saccharomyces cerevisiae YGL151w NUT1 negative
           transcription regulator, start by similarity
          Length = 1099

 Score = 31.2 bits (69), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 40/89 (44%), Gaps = 23/89 (25%)

Query: 342 YLTPEGIAKLQKRFID---NSHLQVDDFLSDERANLLKQLIKRDELDKECPYESVNVEM- 397
           Y+TPE + KL   F+D   NS                 Q+I + E D E  +E+VN+ M 
Sbjct: 574 YVTPEVLTKLYLEFVDKHWNS-----------------QVIGKQETDGESQFENVNISMS 616

Query: 398 -PWKTAMPPHKWRYLYIDGKS-HENFTTE 424
             W   M    ++  +ID  S   ++TT+
Sbjct: 617 FSWAILMLTILYKQYHIDFVSMRADYTTD 645

>KLLA0E21340g 1896457..1900830 highly similar to sp|P04051
           Saccharomyces cerevisiae YOR116c RPO31 DNA-directed RNA
           polymerase III, 160 KD subunit, start by similarity
          Length = 1457

 Score = 30.8 bits (68), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 53/130 (40%), Gaps = 26/130 (20%)

Query: 134 GKLSGSKMDMSINTYTKGCHLLTHDDVIGSRRVSFILYLPDPNTRWKEHYGGGLRLFPSI 193
           G LSG ++D S  T       L+ D+V    RV+ IL  P+  TR+ +H          +
Sbjct: 364 GNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKILTYPEKVTRYNKHK------LQQL 417

Query: 194 VANVPQSDHSAKLIPQFNQIAFFQVQPG--------FSFHDVEE--------VRVNR--- 234
           V N P+    A  + + N+ A   ++ G          + DV E        V  NR   
Sbjct: 418 VINGPKVHPGANYLLKKNEDARRNLRYGDRVKLAKQLQYGDVVERHIEDGDVVLFNRQPS 477

Query: 235 -HRLSIQGWY 243
            HRLSI   Y
Sbjct: 478 LHRLSILSHY 487

>YLR219W (MSC3) [3619] chr12 (574153..576339) Protein of unknown
           function [2187 bp, 728 aa]
          Length = 728

 Score = 30.4 bits (67), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 24/40 (60%)

Query: 355 FIDNSHLQVDDFLSDERANLLKQLIKRDELDKECPYESVN 394
           F +N  LQ DD L ++ ++ +  +I+ +E D E PY  V+
Sbjct: 209 FSENYMLQDDDILEEQASDNIHDIIEENETDNEKPYSPVS 248

>AER252C [2754] [Homologous to ScYOR116C (RPO31) - SH]
           (1101343..1105722) [4380 bp, 1459 aa]
          Length = 1459

 Score = 30.0 bits (66), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 26/49 (53%)

Query: 134 GKLSGSKMDMSINTYTKGCHLLTHDDVIGSRRVSFILYLPDPNTRWKEH 182
           G LSG ++D S  T       L+ D+V    RV+ +L  P+  TR+ +H
Sbjct: 365 GNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNKH 413

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.314    0.133    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 21,668,231
Number of extensions: 1006978
Number of successful extensions: 2689
Number of sequences better than 10.0: 27
Number of HSP's gapped: 2749
Number of HSP's successfully gapped: 27
Length of query: 615
Length of database: 16,596,109
Length adjustment: 108
Effective length of query: 507
Effective length of database: 12,857,365
Effective search space: 6518684055
Effective search space used: 6518684055
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 65 (29.6 bits)