Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_47.1787239739220860.0
KLLA0D11000g35935610271e-139
KLLA0D11022g35935610091e-136
Kwal_33.1456636235710021e-135
YOL151W (GRE2)3423546071e-75
Scas_674.113463535966e-74
YDR541C3443615941e-73
Scas_574.93713535916e-73
Scas_550.43433635862e-72
Scas_652.153503545844e-72
Scas_538.73473545811e-71
Scas_601.53453565758e-71
Scas_702.203473545741e-70
Sklu_2327.23463535671e-69
Scas_622.143873805701e-69
Sklu_2244.23523605653e-69
Scas_680.63673585663e-69
Scas_617.13453565611e-68
YGL039W3483635592e-68
CAGL0E05280g3513575593e-68
YGL157W3473625583e-68
CAGL0E05170g3523595541e-67
Scas_630.133493565411e-65
Kwal_56.238633443584486e-52
KLLA0B14641g1671352363e-23
KLLA0B14663g76701352e-10
AFR001W350210910.003
YGL001C (ERG26)349209870.008
Scas_652.19d134459850.015
Scas_652.19d34156800.066
YLL056C29874790.075
Sklu_2306.3349208730.42
Scas_668.8349209730.49
KLLA0C18513g351222701.0
Kwal_26.846272251711.1
CAGL0E04554g24093662.9
Scas_631.4139886673.4
Kwal_14.77529537654.0
Scas_719.5044559654.4
YDR017C (KCS1)105050638.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_47.17872
         (392 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_47.17872                                                         808   0.0  
KLLA0D11000g 938541..939620 similar to sgd|S0005511 Saccharomyce...   400   e-139
KLLA0D11022g 940600..941679 similar to sgd|S0005511 Saccharomyce...   393   e-136
Kwal_33.14566                                                         390   e-135
YOL151W (GRE2) [4674] chr15 (43692..44720) alpha-Acetoxy ketone ...   238   1e-75
Scas_674.11                                                           234   6e-74
YDR541C (YDR541C) [1350] chr4 complement(1519644..1520678) Prote...   233   1e-73
Scas_574.9                                                            232   6e-73
Scas_550.4                                                            230   2e-72
Scas_652.15                                                           229   4e-72
Scas_538.7                                                            228   1e-71
Scas_601.5                                                            226   8e-71
Scas_702.20                                                           225   1e-70
Sklu_2327.2 YGL157W, Contig c2327 8819-9859                           223   1e-69
Scas_622.14                                                           224   1e-69
Sklu_2244.2 YOL151W, Contig c2244 1821-2879 reverse complement        222   3e-69
Scas_680.6                                                            222   3e-69
Scas_617.1                                                            220   1e-68
YGL039W (YGL039W) [1936] chr7 (423965..425011) Protein of unknow...   219   2e-68
CAGL0E05280g complement(511971..513026) similar to tr|Q12068 Sac...   219   3e-68
YGL157W (YGL157W) [1832] chr7 (209009..210052) Protein of unknow...   219   3e-68
CAGL0E05170g complement(504611..505669) similar to tr|Q12068 Sac...   218   1e-67
Scas_630.13                                                           213   1e-65
Kwal_56.23863                                                         177   6e-52
KLLA0B14641g 1287645..1288148 similar to sp|P53183 Saccharomyces...    96   3e-23
KLLA0B14663g 1288500..1288730 similar to sp|Q9UV57 Zygosaccharom...    57   2e-10
AFR001W [3193] [Homologous to ScYGL001C (ERG26) - SH] complement...    40   0.003
YGL001C (ERG26) [1971] chr7 complement(495455..496504) C-3 stero...    38   0.008
Scas_652.19d1                                                          37   0.015
Scas_652.19d                                                           35   0.066
YLL056C (YLL056C) [3367] chr12 complement(27409..28305) Protein ...    35   0.075
Sklu_2306.3 YGL001C, Contig c2306 4537-5586                            33   0.42 
Scas_668.8                                                             33   0.49 
KLLA0C18513g complement(1636434..1637489) highly similar to sp|P...    32   1.0  
Kwal_26.8462                                                           32   1.1  
CAGL0E04554g 439158..439880 no similarity, hypothetical start          30   2.9  
Scas_631.4                                                             30   3.4  
Kwal_14.775                                                            30   4.0  
Scas_719.50                                                            30   4.4  
YDR017C (KCS1) [870] chr4 complement(479111..482263) Inositol (1...    29   8.5  

>Kwal_47.17872
          Length = 397

 Score =  808 bits (2086), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/392 (100%), Positives = 392/392 (100%)

Query: 1   MKNEQPRIGYKGGVSGRLGTLLSLNFLHISTKVYRKMDEKVLVSGCNGFLALHVLDVLLS 60
           MKNEQPRIGYKGGVSGRLGTLLSLNFLHISTKVYRKMDEKVLVSGCNGFLALHVLDVLLS
Sbjct: 1   MKNEQPRIGYKGGVSGRLGTLLSLNFLHISTKVYRKMDEKVLVSGCNGFLALHVLDVLLS 60

Query: 61  EKFHVIGTVRSQEKADLVQKSFKKLYPYAQLDIELVKDITQKGAFDGVFEKHPDIQHVLH 120
           EKFHVIGTVRSQEKADLVQKSFKKLYPYAQLDIELVKDITQKGAFDGVFEKHPDIQHVLH
Sbjct: 61  EKFHVIGTVRSQEKADLVQKSFKKLYPYAQLDIELVKDITQKGAFDGVFEKHPDIQHVLH 120

Query: 121 TASNFSFGHDQSTEETYLVPATKGTRSILESTLKLGKQVKRFVLTSSFASILNADHAGDS 180
           TASNFSFGHDQSTEETYLVPATKGTRSILESTLKLGKQVKRFVLTSSFASILNADHAGDS
Sbjct: 121 TASNFSFGHDQSTEETYLVPATKGTRSILESTLKLGKQVKRFVLTSSFASILNADHAGDS 180

Query: 181 SFIHTEATWNPITWEQAKGNEFSAYVASKKLAETTAWDFLKEHEKEVGFTLTTVCPPYIW 240
           SFIHTEATWNPITWEQAKGNEFSAYVASKKLAETTAWDFLKEHEKEVGFTLTTVCPPYIW
Sbjct: 181 SFIHTEATWNPITWEQAKGNEFSAYVASKKLAETTAWDFLKEHEKEVGFTLTTVCPPYIW 240

Query: 241 GPQVFEWGVQGATLNTSAEIVNKALQTTPEFKGPFDEPNGLACDVRDVALLHMLPLRNEK 300
           GPQVFEWGVQGATLNTSAEIVNKALQTTPEFKGPFDEPNGLACDVRDVALLHMLPLRNEK
Sbjct: 241 GPQVFEWGVQGATLNTSAEIVNKALQTTPEFKGPFDEPNGLACDVRDVALLHMLPLRNEK 300

Query: 301 LAGERLFPVSGSGIKQHNYKNGKFNLQRVLEVLNKQFPELQGKIAKGTIEDNEKALGIVF 360
           LAGERLFPVSGSGIKQHNYKNGKFNLQRVLEVLNKQFPELQGKIAKGTIEDNEKALGIVF
Sbjct: 301 LAGERLFPVSGSGIKQHNYKNGKFNLQRVLEVLNKQFPELQGKIAKGTIEDNEKALGIVF 360

Query: 361 EFNNDKTSELTGIEFKPLEVTVHDAVKQILDY 392
           EFNNDKTSELTGIEFKPLEVTVHDAVKQILDY
Sbjct: 361 EFNNDKTSELTGIEFKPLEVTVHDAVKQILDY 392

>KLLA0D11000g 938541..939620 similar to sgd|S0005511 Saccharomyces
           cerevisiae YOL151w GRE2, start by similarity
          Length = 359

 Score =  400 bits (1027), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 193/356 (54%), Positives = 264/356 (74%), Gaps = 2/356 (0%)

Query: 37  MDEKVLVSGCNGFLALHVLDVLLSEKFHVIGTVRSQEKADLVQKSFKKLYPYAQLDIELV 96
           M  KVL++G +GF+ALHVLD LL+  + V+GTVRS+EKA+ ++K   K +P  +   E+V
Sbjct: 1   MSAKVLLTGASGFIALHVLDQLLAAGYEVVGTVRSEEKAEPIKKELAKEHPNGKYQFEVV 60

Query: 97  KDITQKGAFDGVFEKHPDIQHVLHTASNFSFGHDQSTEETYLVPATKGTRSILESTLKLG 156
            DI    AFD VF+KH D+++VLHTAS FSFG  +S EE YL+PAT GT+S+LES  K G
Sbjct: 61  VDIAAPNAFDAVFQKHTDLKYVLHTASPFSFGLTKSNEENYLIPATHGTKSVLESIQKYG 120

Query: 157 KQVKRFVLTSSFASILNADHAGDSSFIHTEATWNPITWEQAKGNEFSAYVASKKLAETTA 216
           K V+  ++TSS+A+I+  DHAGD +FIH E +WNPITWE+A+ N  +AY+ASKK AE  A
Sbjct: 121 KNVEHVIVTSSYAAIMRLDHAGDPNFIHDETSWNPITWEEARENSVTAYIASKKYAEKLA 180

Query: 217 WDFLKEHEKEVGFTLTTVCPPYIWGPQVFEWGVQGATLNTSAEIVNKALQTTPEFKGPFD 276
           WDF+K++     F LTTV PPY++GPQ F +G+  ++LNTSA+IVN+AL+TTPE++GPF+
Sbjct: 181 WDFVKDNNST--FNLTTVNPPYVFGPQKFTFGLAKSSLNTSADIVNQALKTTPEYEGPFN 238

Query: 277 EPNGLACDVRDVALLHMLPLRNEKLAGERLFPVSGSGIKQHNYKNGKFNLQRVLEVLNKQ 336
           +P GLACDVRDVA LH+LPL  ++  G+RLFPVS +G     Y+ GKFN +++L +LN++
Sbjct: 239 QPAGLACDVRDVAKLHVLPLGKKEFNGQRLFPVSDTGYGIEEYEKGKFNFEKILRILNEK 298

Query: 337 FPELQGKIAKGTIEDNEKALGIVFEFNNDKTSELTGIEFKPLEVTVHDAVKQILDY 392
            PEL+GKI+ G I+DNE  L  +  + N  T++LT + F   E TV+DA KQILDY
Sbjct: 299 LPELKGKISPGGIKDNEAELAKLDYYRNKTTTDLTKLTFYKFEDTVYDATKQILDY 354

>KLLA0D11022g 940600..941679 similar to sgd|S0005511 Saccharomyces
           cerevisiae YOL151w GRE2, start by similarity
          Length = 359

 Score =  393 bits (1009), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 188/356 (52%), Positives = 260/356 (73%), Gaps = 2/356 (0%)

Query: 37  MDEKVLVSGCNGFLALHVLDVLLSEKFHVIGTVRSQEKADLVQKSFKKLYPYAQLDIELV 96
           M  KVL++G +GF+ALHVLD LL+  + V+GTVRS+EKA+ ++K   K +P  +   E+V
Sbjct: 1   MSAKVLLTGASGFIALHVLDQLLAAGYEVVGTVRSEEKAEPIKKELAKEHPNGKYQFEVV 60

Query: 97  KDITQKGAFDGVFEKHPDIQHVLHTASNFSFGHDQSTEETYLVPATKGTRSILESTLKLG 156
            DI    AFD VF+KH D+++VLHTAS FSFG  +S EE YL+PAT GT+S+LES  K G
Sbjct: 61  VDIAAPNAFDAVFQKHTDLKYVLHTASPFSFGLTKSNEENYLIPATHGTKSVLESIQKYG 120

Query: 157 KQVKRFVLTSSFASILNADHAGDSSFIHTEATWNPITWEQAKGNEFSAYVASKKLAETTA 216
           K V+  V+TSSFA+I++   +GD +FI+ E TWNP+ WE A+ +  ++YVASKK AE  A
Sbjct: 121 KNVEHVVVTSSFAAIVHRHRSGDPTFINDETTWNPVIWEDAREDAATSYVASKKYAEKLA 180

Query: 217 WDFLKEHEKEVGFTLTTVCPPYIWGPQVFEWGVQGATLNTSAEIVNKALQTTPEFKGPFD 276
           WDF+K++     F LTTV PPY++GPQ F +G+  A+LNTSA+ VNKAL+TTPE++GPF+
Sbjct: 181 WDFVKDNNST--FNLTTVNPPYVFGPQKFTFGLARASLNTSADFVNKALKTTPEYEGPFN 238

Query: 277 EPNGLACDVRDVALLHMLPLRNEKLAGERLFPVSGSGIKQHNYKNGKFNLQRVLEVLNKQ 336
           +P G+ACDVRDVA LH+LPL  ++  G+RLFPVS +G     Y+ GKFN +++L +LN++
Sbjct: 239 QPAGVACDVRDVAKLHVLPLGKKEFNGQRLFPVSDTGYGIEEYEKGKFNFEKILRILNEK 298

Query: 337 FPELQGKIAKGTIEDNEKALGIVFEFNNDKTSELTGIEFKPLEVTVHDAVKQILDY 392
            PEL+GKI+ G I+DNE  L  +  + N  T++ T + F  LE T++DA KQILDY
Sbjct: 299 LPELKGKISPGGIKDNEAELSKLTYYRNKITTDSTKLTFYKLEDTIYDAAKQILDY 354

>Kwal_33.14566
          Length = 362

 Score =  390 bits (1002), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 177/357 (49%), Positives = 261/357 (73%), Gaps = 1/357 (0%)

Query: 37  MDEKVLVSGCNGFLALHVLDVLLSEKFHVIGTVRSQEKADLVQKSFKKLYPYAQLDIELV 96
           MDEKVLV+G +G++A+H++++L SE++HV+ TV S E A  +  S++  YPYA LD+ +V
Sbjct: 1   MDEKVLVTGASGYIAMHIVNILQSERYHVVATVESAEVARRIATSYEHYYPYAVLDVLVV 60

Query: 97  KDITQKGAFDGVFEKHPDIQHVLHTASNFSFGHDQSTEETYLVPATKGTRSILESTLKLG 156
            D+T   AF+ VF++HPDI+HV+HTA     G+ + T E YLVPAT+GTR++L+S    G
Sbjct: 61  PDVTAPDAFEPVFQQHPDIRHVIHTAPAAPLGNAKDTREAYLVPATEGTRNVLQSIRNHG 120

Query: 157 KQVKRFVLTSSFASILNADHAGDSSFIHTEATWNPITWEQAKGNEFSAYVASKKLAETTA 216
            QV R V+TSSFA++++ DHA D   + +E +WNP+TWE A+ +   AY ASK++AE   
Sbjct: 121 PQVSRVVITSSFAALMDLDHAADPQCVISETSWNPVTWEAAQHSNSKAYAASKRIAEQLV 180

Query: 217 WDFLKEHEKEVGFTLTTVCPPYIWGPQVFEWGVQGATLNTSAEIVNKALQTTPEFKGPFD 276
           WD+ +EH+ +V FTLTTV PPY++GP VF+W ++    NT+A  + +AL+ TP+  GPF 
Sbjct: 181 WDWYREHQHDVRFTLTTVNPPYMFGPHVFDWELERPEWNTTACFIKEALKLTPDSPGPFI 240

Query: 277 EPNGLACDVRDVALLHMLPLRNEKLAGERLFPVSGSGIKQHNYKNGKFNLQRVLEVLNKQ 336
           +P G+ CDVRD AL+H+LPLRN  LAG+RLFPV+G+GIKQH+Y++GKFN QR+L+++N +
Sbjct: 241 KPRGICCDVRDAALIHVLPLRNSDLAGQRLFPVNGTGIKQHSYEDGKFNFQRILDIMNAE 300

Query: 337 FPELQGKIAKGTI-EDNEKALGIVFEFNNDKTSELTGIEFKPLEVTVHDAVKQILDY 392
           FP ++  I +G     N++ L  +  +NND T +LTG+EFKP  +++ DA KQIL +
Sbjct: 301 FPNIRESIPEGNSGAANQENLNQLTRYNNDDTCQLTGMEFKPFALSLRDATKQILQF 357

>YOL151W (GRE2) [4674] chr15 (43692..44720) alpha-Acetoxy ketone
           reductase involved in diamide tolerance and induced by
           osmotic stress, member of a family (Gre2p, Ygl039p,
           Ygl157p, Ydr541p) with similarity to plant
           dihydroflavonol-4-reductases [1029 bp, 342 aa]
          Length = 342

 Score =  238 bits (607), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 141/354 (39%), Positives = 200/354 (56%), Gaps = 20/354 (5%)

Query: 41  VLVSGCNGFLALHVLDVLLSEKFHVIGTVRSQEKADLVQKSFKKLYPYAQLDIELVKDIT 100
           V VSG NGF+A H++D+LL E + VIG+ RSQEKA+ + ++F       +  +E+V DI+
Sbjct: 3   VFVSGANGFIAQHIVDLLLKEDYKVIGSARSQEKAENLTEAFGN---NPKFSMEVVPDIS 59

Query: 101 QKGAFDGVFEKH-PDIQHVLHTASNFSFGHDQSTEETYLVPATKGTRSILESTLKLG-KQ 158
           +  AFD VF+KH  DI+ VLHTAS F F    S E   L+PA  G + IL S  K     
Sbjct: 60  KLDAFDHVFQKHGKDIKIVLHTASPFCFDITDS-ERDLLIPAVNGVKGILHSIKKYAADS 118

Query: 159 VKRFVLTSSFASILNADHAGDSSFIHTEATWNPITWEQAKGNEFSAYVASKKLAETTAWD 218
           V+R VLTSS+A++ +     D S    E +WNP TWE  + +  +AY  SKK AE  AW+
Sbjct: 119 VERVVLTSSYAAVFDMAKENDKSLTFNEESWNPATWESCQSDPVNAYCGSKKFAEKAAWE 178

Query: 219 FLKEHEKEVGFTLTTVCPPYIWGPQVFEWGVQGATLNTSAEIVNKALQTTPEFKGPFDEP 278
           FL+E+   V F LT V P Y++GPQ+F+  V+   LNTS E+VN  +  +PE K P  E 
Sbjct: 179 FLEENRDSVKFELTAVNPVYVFGPQMFDKDVK-KHLNTSCELVNSLMHLSPEDKIP--EL 235

Query: 279 NGLACDVRDVALLHMLPLRNEKLAGERLFPVSGSGIKQHNYKNGKFNLQRVLEVLNKQFP 338
            G   DVRDVA  H++  +  +  G+RL                +F +Q VL++LN+ FP
Sbjct: 236 FGGYIDVRDVAKAHLVAFQKRETIGQRLI-----------VSEARFTMQDVLDILNEDFP 284

Query: 339 ELQGKIAKGTIEDNEKALGIVFEFNNDKTSELTGIEFKPLEVTVHDAVKQILDY 392
            L+G I  G          +    +N K+ +L G +F+ L+ T+ D   QIL +
Sbjct: 285 VLKGNIPVGKPGSGATHNTLGATLDNKKSKKLLGFKFRNLKETIDDTASQILKF 338

>Scas_674.11
          Length = 346

 Score =  234 bits (596), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 142/353 (40%), Positives = 203/353 (57%), Gaps = 20/353 (5%)

Query: 41  VLVSGCNGFLALHVLDVLLSEKFHVIGTVRSQEKADLVQKSFKKLYPYAQLDIELVKDIT 100
           V VSG  GF+ALH+++ LL+  + VIG+ RSQEK     K  +K      L +E+VKDI+
Sbjct: 7   VFVSGATGFIALHIVNDLLNAGYRVIGSARSQEKCG---KLLEKFGNNPSLSMEVVKDIS 63

Query: 101 QKGAFDGVFEKHP-DIQHVLHTASNFSFGHDQSTEETYLVPATKGTRSILESTLKLGKQ- 158
              AFD VF+KH  DI  VLHTAS F F   +  E+  ++PA  GT+SI  +  K G Q 
Sbjct: 64  DLNAFDEVFKKHAKDITIVLHTASPFRFDTTEY-EKDLIIPAVNGTKSIFNAIKKYGAQT 122

Query: 159 VKRFVLTSSFASILNADHAGDSSFIHTEATWNPITWEQAKGNEFSAYVASKKLAETTAWD 218
           V+R V+TSS A+ +   +      I  E+TWN   W     +  +AY ASK  AE  AWD
Sbjct: 123 VERVVVTSSGAAQIQPAYCNRDGLIVDESTWNDCAWANCTTDAVTAYCASKTFAERVAWD 182

Query: 219 FLKEHEKEVGFTLTTVCPPYIWGPQVFEWGVQGATLNTSAEIVNKALQTTPEFKGPFDEP 278
           FL+E++ +V F L+TV P  ++GPQ+F    +  TLNTS+EI+NK + T  + +  +D+ 
Sbjct: 183 FLRENKGQVKFKLSTVMPVNVFGPQMFPEPSK-TTLNTSSEIINKLVHTNKDTE--WDQF 239

Query: 279 NGLACDVRDVALLHMLPLRNEKLAGERLFPVSGSGIKQHNYKNGKFNLQRVLEVLNKQFP 338
           NG   DVRDV+  H+     E+ AGERL           +   G F  Q +L+++N  FP
Sbjct: 240 NGGYIDVRDVSRAHLCAFEKEECAGERL-----------SLFGGMFATQDILDIINDDFP 288

Query: 339 ELQGKIAKGTIEDNEKALGIVFEFNNDKTSELTGIEFKPLEVTVHDAVKQILD 391
           +L+GKI  G     ++     F+ NN++T  L G EF  L  +V D+V+QIL+
Sbjct: 289 QLKGKIPVGRPGTGKELTTKGFQINNERTKILLGFEFIGLRQSVDDSVRQILE 341

>YDR541C (YDR541C) [1350] chr4 complement(1519644..1520678) Protein
           with high similarity to S. cerevisiae Gre2p, which is an
           alpha-acetoxy ketone reductase that is involved in
           diamide tolerance and is induced by osmotic stress [1035
           bp, 344 aa]
          Length = 344

 Score =  233 bits (594), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 143/361 (39%), Positives = 202/361 (55%), Gaps = 30/361 (8%)

Query: 37  MDEKVLVSGCNGFLALHVLDVLLSEKFHVIGTVRSQEKADLVQKSFKKLYPYAQLDIELV 96
           M   VLVSG +GF+ALH+L  LL + + VIGTVRS EK   + + F+       L +E+V
Sbjct: 1   MSNTVLVSGASGFIALHILSQLLKQDYKVIGTVRSHEKEAKLLRQFQH---NPNLTLEIV 57

Query: 97  KDITQKGAFDGVFEKH-PDIQHVLHTASNFSFGHDQSTEETYLVPATKGTRSILESTLKL 155
            DI+   AFD V +K   +I++VLHTAS F +   +  E+  L+PA +GT++IL S  K 
Sbjct: 58  PDISHPNAFDKVLQKRGREIRYVLHTASPFHYDTTEY-EKDLLIPALEGTKNILNSIKKY 116

Query: 156 GKQ-VKRFVLTSSFASILNADHAGDSSFIHTEATWNPITWEQAKGNEFSAYVASKKLAET 214
               V+R V+TSS  +I+      D S + TE +WN  TWE  + +  +AY ASKK AE 
Sbjct: 117 AADTVERVVVTSSCTAIITLAKMDDPSVVFTEESWNEATWESCQIDGINAYFASKKFAEK 176

Query: 215 TAWDFLKEHEKEVGFTLTTVCPPYIWGPQVFEWGVQGATLNTSAEIVNKALQT-----TP 269
            AW+F KE+E  + F LTTV P  ++GPQ+F+  V G  LNTS E++N  + T      P
Sbjct: 177 AAWEFTKENEDHIKFKLTTVNPSLLFGPQLFDEDVHGH-LNTSCEMINGLIHTPVNASVP 235

Query: 270 EFKGPFDEPNGLACDVRDVALLHMLPLRNEKLAGERLFPVSGSGIKQHNYKNGKFNLQRV 329
           +F   F        DVRDVAL H+   + E  AG+RL              NGKF  Q +
Sbjct: 236 DFHSIF-------IDVRDVALAHLYAFQKENTAGKRLV-----------VTNGKFGNQDI 277

Query: 330 LEVLNKQFPELQGKIAKGTIEDNEKALGIVFEFNNDKTSELTGIEFKPLEVTVHDAVKQI 389
           L++LN+ FP+L+G I  G     ++ +      +N  T ++ G EF+ L  +VHD   QI
Sbjct: 278 LDILNEDFPQLRGLIPLGKPGTGDQVIDRGSTTDNSATRKILGFEFRSLHESVHDTAAQI 337

Query: 390 L 390
           L
Sbjct: 338 L 338

>Scas_574.9
          Length = 371

 Score =  232 bits (591), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 141/353 (39%), Positives = 207/353 (58%), Gaps = 20/353 (5%)

Query: 41  VLVSGCNGFLALHVLDVLLSEKFHVIGTVRSQEKADLVQKSFKKLYPYAQLDIELVKDIT 100
           V VSG +GF+ALHV++ LL+  + VIG+ RSQEK D +   FK    +  L + +V DI+
Sbjct: 32  VFVSGASGFIALHVVNDLLNAGYKVIGSARSQEKCDQLLAKFKN---HPSLSMVIVPDIS 88

Query: 101 QKGAFDGVFEKH-PDIQHVLHTASNFSFGHDQSTEETYLVPATKGTRSILESTLKLGKQ- 158
              AFD VF+K+  +I+ VLHTAS F F  +   E+  L+PA  GT+SIL +  +   Q 
Sbjct: 89  DLNAFDDVFKKYGKEIKIVLHTASPFRFDVN-DYEKDLLIPALNGTKSILNAIKQYAAQT 147

Query: 159 VKRFVLTSSFASILNADHAGDSSFIHTEATWNPITWEQAKGNEFSAYVASKKLAETTAWD 218
           V+R V+TSS A+ LN  +  D S    E +WN  TWE  + +  SAY ASK  AE  AWD
Sbjct: 148 VERVVITSSMAAQLNTIYMNDKSITVDETSWNDATWEGCQTDPVSAYCASKGFAEKAAWD 207

Query: 219 FLKEHEKEVGFTLTTVCPPYIWGPQVFEWGVQGATLNTSAEIVNKALQTTPEFKGPFDEP 278
           FLKE++ +V F L+TV P Y++GPQ+F    +   LNTS+EI+N+ +    + +    + 
Sbjct: 208 FLKENKDQVKFKLSTVLPVYVFGPQLFPEPSK-KVLNTSSEIINQIVNADKDTE--LMQM 264

Query: 279 NGLACDVRDVALLHMLPLRNEKLAGERLFPVSGSGIKQHNYKNGKFNLQRVLEVLNKQFP 338
           NG   DVRDVA  H+L  + ++ AGERL           +   G F+ Q  L+++N+ FP
Sbjct: 265 NGGFIDVRDVAKAHLLAFQKDECAGERL-----------SLYGGMFSTQDFLDIINEDFP 313

Query: 339 ELQGKIAKGTIEDNEKALGIVFEFNNDKTSELTGIEFKPLEVTVHDAVKQILD 391
           +L+GKI  G     +  +   ++ NN++T +L G EF      V  +V+QIL+
Sbjct: 314 QLKGKIPVGKPGTGKDVIENSYKINNERTKKLLGFEFINKRDCVDASVQQILE 366

>Scas_550.4
          Length = 343

 Score =  230 bits (586), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 142/363 (39%), Positives = 206/363 (56%), Gaps = 41/363 (11%)

Query: 41  VLVSGCNGFLALHVLDVLLSEKFHVIGTVRSQEKADLVQKSFKKLYPYAQLDIELVKDIT 100
           V +SG  GF+A H+++ LL + F VIG+VRSQ KAD   K  ++      L +E+V+DI+
Sbjct: 3   VFISGATGFVAQHIINQLLEQNFKVIGSVRSQAKAD---KLLRQFNSNKNLSLEVVEDIS 59

Query: 101 QKGAFDGVFEKH-PDIQHVLHTASNFSFGHDQSTEETYLVPATKGTRSILESTLKLG-KQ 158
              AFD VF KH  +I++VLHT+S F F      E+  L+PA  GT+ IL S LK     
Sbjct: 60  NLAAFDEVFSKHGKEIKYVLHTSSPF-FTECDDYEKDLLIPALNGTKGILNSILKYAADN 118

Query: 159 VKRFVLTSSFASILNADHAGDSSFIHTEATWNPITWEQAKGNEFSAYVASKKLAETTAWD 218
           V+R V+TSS A++ +     D S+ + E +WNP ++++A  +   AY  SKK AE  AW+
Sbjct: 119 VERVVITSSIAAMFDFTRDLDPSYFYDENSWNPDSYQEALTDGGHAYNGSKKFAERYAWN 178

Query: 219 FLKEHEKEVGFTLTTVCPPYIWGPQVFEWGVQGATLNTSAEIVNKALQTTPE------FK 272
           F++EH+ E+ F LTTV P Y++GPQ+F+  V  A LNTS E++NK L  +        F 
Sbjct: 179 FVQEHKNEIKFKLTTVNPCYVFGPQLFDENVT-AKLNTSCELINKLLHLSAGDAVDNFFV 237

Query: 273 GPFDEPNGLACDVRDVALLHMLPLRNEKLAGERLFPVSGSGIKQHNYKNGKFNLQRVLEV 332
           G F        DVRDVA  H+L   N+ L  +RL  +S            +FN Q +L++
Sbjct: 238 GNF-------VDVRDVAKAHLLGFENQNLVDKRLLLIS-----------SRFNAQDILDI 279

Query: 333 LNKQFPELQGKIAKGTIEDNEKALGIVFEF-----NNDKTSELTGIEFKPLEVTVHDAVK 387
           +N+ F  L+G++  G         G + ++     +N KT EL G EF PL+ T+ D V 
Sbjct: 280 MNEDFKTLEGQLPAGV-----PHTGALHQWKGAIADNSKTKELLGFEFIPLKKTIDDMVT 334

Query: 388 QIL 390
           QIL
Sbjct: 335 QIL 337

>Scas_652.15
          Length = 350

 Score =  229 bits (584), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 136/354 (38%), Positives = 201/354 (56%), Gaps = 19/354 (5%)

Query: 41  VLVSGCNGFLALHVLDVLLSEKFHVIGTVRSQEKADLVQKSFKKLYPYAQLDIELVKDIT 100
           V VSG +GF+A H++ +LL + + VIG+VRS EKA+ V  +F        L +E+VKD+ 
Sbjct: 8   VFVSGASGFIAQHIISLLLEQNYKVIGSVRSNEKAEHVLSNFNH---NPNLTLEIVKDLA 64

Query: 101 QKGAFDGVFEKHPD-IQHVLHTASNFSFGHDQSTEETYLVPATKGTRSILESTLKLGKQ- 158
              AFD VF+KH D I+ VLH AS   F  D + E+  L+PA  G +S+L + LK   Q 
Sbjct: 65  SLTAFDEVFKKHGDEIKIVLHAASPVVFQVD-NFEKDILIPAVNGVKSMLNAILKYAPQT 123

Query: 159 VKRFVLTSSFASILNADHAGDSSFIHTEATWNPITWEQAKGNEFSAYVASKKLAETTAWD 218
           V+R + TSS  +  N     +      E TWN  TWE  + N  +AY ASK  AE  AW+
Sbjct: 124 VERLIYTSSIVAQFNPCGENEKGMKLDETTWNDATWENCQTNAINAYSASKTFAEKAAWE 183

Query: 219 FLKEHEKEVGFTLTTVCPPYIWGPQVFEWGVQGATLNTSAEIVNKALQTTPEFKGP-FDE 277
           F+K+H  EV F LTT+ P Y+ GPQ+ +  +    LN S+E++N  +    E + P    
Sbjct: 184 FMKKHGNEVKFKLTTILPSYVLGPQL-KIDLSNGKLNLSSELINSIVHAREESQLPTLSS 242

Query: 278 PNGLACDVRDVALLHMLPLRNEKLAGERLFPVSGSGIKQHNYKNGKFNLQRVLEVLNKQF 337
             G   DVRDVA   +L  + ++  G+RL   SG+           F++QR+L V++K F
Sbjct: 243 RLGYFIDVRDVAKAELLAFQKDECIGKRLSLTSGT-----------FSIQRILNVIHKDF 291

Query: 338 PELQGKIAKGTIEDNEKALGIVFEFNNDKTSELTGIEFKPLEVTVHDAVKQILD 391
           PEL GK+  G  +  E++   +F+F+N++T +  G EF   + +V D+ +QILD
Sbjct: 292 PELNGKVPVGAPDLVEESADDIFDFSNEETKKALGFEFIDFKTSVDDSTRQILD 345

>Scas_538.7
          Length = 347

 Score =  228 bits (581), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 142/354 (40%), Positives = 203/354 (57%), Gaps = 24/354 (6%)

Query: 41  VLVSGCNGFLALHVLDVLLSEKFHVIGTVRSQEKAD-LVQKSFKKLYPY-AQLDIELVKD 98
           V VSG  GF+ALHV+D LL E + VIG+ RSQEK D L+QK     + Y   +  E+V D
Sbjct: 7   VFVSGATGFIALHVVDKLLREGYKVIGSARSQEKCDELLQK-----FNYNPSISTEIVPD 61

Query: 99  ITQKGAFDGVFEKHP-DIQHVLHTASNFSFGHDQSTEETYLVPATKGTRSILESTLKLGK 157
           I+   AFD VF+KH  +I+ VLHTAS F F  +   E+  L+PA  GT+S+L +  K G 
Sbjct: 62  ISNLAAFDDVFKKHGHEIKIVLHTASPFRFDVN-DYEKDLLIPAVNGTKSVLNAIKKYGA 120

Query: 158 Q-VKRFVLTSSFASILNADHAGDSSFIHTEATWNPITWEQAKGNEFSAYVASKKLAETTA 216
           Q V+R V+TSS A+ +N   A     + TE +WN  TWE  + +  + Y ASK  AE  A
Sbjct: 121 QSVERVVVTSSVAAQINIKGANRDDLVLTEESWNDATWENCQTDPMAVYCASKTFAERAA 180

Query: 217 WDFLKEHEKEVGFTLTTVCPPYIWGPQVFEWGVQGATLNTSAEIVNKALQTTPEFKGPFD 276
           WDF++E++ +V F L+TV P Y++GPQ+F    +   LNTS+EI+N+ +    + +    
Sbjct: 181 WDFIRENKDQVIFKLSTVLPVYVFGPQLFPEPSK-KELNTSSEIINQIVHADKDTE--LM 237

Query: 277 EPNGLACDVRDVALLHMLPLRNEKLAGERLFPVSGSGIKQHNYKNGKFNLQRVLEVLNKQ 336
           + NG   DVRDVA  H+L  + ++ A +RL           +   G F  Q  L+++N+ 
Sbjct: 238 QLNGGFIDVRDVAKAHLLAFQKDECASQRL-----------SLHGGMFATQDFLDIINED 286

Query: 337 FPELQGKIAKGTIEDNEKALGIVFEFNNDKTSELTGIEFKPLEVTVHDAVKQIL 390
           F +L+GKI  G     +      ++ NNDKT +L G  F  L   V D+V QIL
Sbjct: 287 FSQLRGKIPVGKPGTGKLITSKGYQINNDKTKKLLGFPFIGLRECVDDSVSQIL 340

>Scas_601.5
          Length = 345

 Score =  226 bits (575), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 137/356 (38%), Positives = 196/356 (55%), Gaps = 27/356 (7%)

Query: 41  VLVSGCNGFLALHVLDVLLSEKFHVIGTVRSQEKADLVQKSFKKLYPYAQLDIELVKDIT 100
           V VSG  GF+A +++ +LL + + VIG+VRS+EK   V   F      A L IE+VKD+ 
Sbjct: 8   VFVSGATGFIAKYIIKLLLDQNYKVIGSVRSEEKGQEVLADFDH---NANLSIEIVKDLA 64

Query: 101 QKGAFDGVFEKH-PDIQHVLHTASNFSFGHDQSTEETYLVPATKGTRSILESTLKLGKQ- 158
              AFD VF+KH  DIQ VLHTAS  +F  D   E+  L+PA  G +SIL + L+   Q 
Sbjct: 65  SLTAFDEVFKKHGKDIQIVLHTASPVTFQVDD-VEKDILIPAVNGVKSILNAILQFAPQT 123

Query: 159 VKRFVLTSSFASILNADHAGDSSFIHTEATWNPITWEQAKGNEFSAYVASKKLAETTAWD 218
           V+RFVLTSS A+ +N         I TE +WN  TWE  + +  SAY  SK  AE  AWD
Sbjct: 124 VERFVLTSSLAAQINPLAPDSKDKIITEKSWNDATWEGCQTDSMSAYAGSKTFAEKAAWD 183

Query: 219 FLKEHEKEVGFTLTTVCPPYIWGPQVFEWGVQGATLNTSAEIVNKALQ---TTPEFKGPF 275
           F+KEH  EV   ++ V P +++GPQ+ +       L +S E +N  +      P F    
Sbjct: 184 FMKEHGNEVKMKMSAVLPSFVFGPQL-KMDFSSGHLRSSMEFINSIINGKLPPPMFSA-- 240

Query: 276 DEPNGLACDVRDVALLHMLPLRNEKLAGERLFPVSGSGIKQHNYKNGKFNLQRVLEVLNK 335
               G   DVRDVA   +   + ++  G+RL             ++  + +Q +L+ ++K
Sbjct: 241 ----GAFIDVRDVAKAELAAFQKDECIGKRL-----------ALESDMYTVQDILDYIHK 285

Query: 336 QFPELQGKIAKGTIEDNEKALGIVFEFNNDKTSELTGIEFKPLEVTVHDAVKQILD 391
            FPEL   +  G     ++AL   F+FNND+T ++ G +F PLE T+HD++KQI D
Sbjct: 286 NFPELAKIVQVGKPGSRDEALKNSFKFNNDETKKVLGFQFIPLETTLHDSLKQIDD 341

>Scas_702.20
          Length = 347

 Score =  225 bits (574), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 140/354 (39%), Positives = 194/354 (54%), Gaps = 20/354 (5%)

Query: 41  VLVSGCNGFLALHVLDVLLSEKFHVIGTVRSQEKADLVQKSFKKLYPYAQLDIELVKDIT 100
           V VSG  G++ALHV+D LL E + VIG+VRSQEKAD + K F        L +E+V DI+
Sbjct: 7   VFVSGATGYIALHVVDNLLKEGYSVIGSVRSQEKADHILKEFSN---DCNLTLEIVPDIS 63

Query: 101 QKGAFDGVFEKH-PDIQHVLHTASNFSFGHDQSTEETYLVPATKGTRSILESTLKLGKQ- 158
              AFD VF++H  DI+ V+HTAS   F   +  ++  L+PA  GT+SILES  K     
Sbjct: 64  ALDAFDDVFKRHGKDIKVVIHTASPVVFDP-KDLDKDLLIPAINGTKSILESIKKYAADT 122

Query: 159 VKRFVLTSSFASILNADHAGDSSFIHTEATWNPITWEQAKGNEFSAYVASKKLAETTAWD 218
           V+  V+TSS A+        DS+    E +WN IT E+A     +AY ASK  AE  AW+
Sbjct: 123 VENVVITSSLAAQRKPSETNDSTVTIDENSWNNITMEEAHECVRNAYSASKVFAEKAAWE 182

Query: 219 FLKEHEKEVGFTLTTVCPPYIWGPQVFEWGVQGATLNTSAEIVNKALQTTPEFKGPFDEP 278
           FLK +   V F LTTV P +++GPQ F      +  N + EIV        E      + 
Sbjct: 183 FLKNNADVVKFKLTTVMPGFVFGPQTF-VDRSKSKFNHTIEIVRAIANAKTE--DELYQC 239

Query: 279 NGLACDVRDVALLHMLPLRNEKLAGERLFPVSGSGIKQHNYKNGKFNLQRVLEVLNKQFP 338
           +G   DVRDVA  H+L  + ++ AGERL           +     F  Q +L V+N+ FP
Sbjct: 240 SGTYVDVRDVARAHLLAFQKKECAGERL-----------SLSTSMFCTQSILNVINEDFP 288

Query: 339 ELQGKIAKGTIEDNEKALGIVFEFNNDKTSELTGIEFKPLEVTVHDAVKQILDY 392
           +L+GKI +G      + L  +  FNNDKT +L G +F PL  ++ D V Q+ ++
Sbjct: 289 QLKGKITEGDPASENETLDNMMSFNNDKTKKLLGFDFIPLRKSIDDTVNQLFEF 342

>Sklu_2327.2 YGL157W, Contig c2327 8819-9859
          Length = 346

 Score =  223 bits (567), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 140/353 (39%), Positives = 205/353 (58%), Gaps = 22/353 (6%)

Query: 41  VLVSGCNGFLALHVLDVLLSEKFHVIGTVRSQEKADLVQKSFKKLYPYAQLDIELVKDIT 100
           V VSG +G++ALHV++ LL+  + VIG+ RS +KA  V+K F        L   +V DI 
Sbjct: 7   VFVSGASGYIALHVVNELLNAGYKVIGSTRSDKKAAEVEKKFGN---NPNLKTVIVPDIA 63

Query: 101 QKGAFDGVFEKH-PDIQHVLHTASNFSFGHDQSTEETYLVPATKGTRSILESTLKLGKQ- 158
           + GAFD  FE++  +I+ VLH AS F F   +  E+  L+PA  GT+SILES  K   Q 
Sbjct: 64  EPGAFDHAFEEYGSEIKVVLHVASPFFFDTTE-YEKDLLLPAVNGTKSILESVKKYAPQT 122

Query: 159 VKRFVLTSSFASILNADHAGDSSFIHTEATWNPITWEQAKGNEFSAYVASKKLAETTAWD 218
           V+  V+TSS A+I++     + + + TE  WN  TWE A  +  +AY ASKK AE  AW 
Sbjct: 123 VENVVVTSSLAAIVSPKRMAEPNALVTEKDWNDTTWEGAGADPVTAYCASKKFAEEAAWK 182

Query: 219 FLKEHEKEVGFTLTTVCPPYIWGPQVFEWGVQGATLNTSAEIVNKALQTTPEFKGPFDEP 278
           FL+E++  V F LTTV P Y++GPQ+    V G  LNTS E++N  + + P   G   +P
Sbjct: 183 FLEENKSIVKFRLTTVNPGYVFGPQLSSDSV-GDVLNTSCELINGIVHSKP---GSEIQP 238

Query: 279 -NGLACDVRDVALLHMLPLRNEKLAGERLFPVSGSGIKQHNYKNGKFNLQRVLEVLNKQF 337
            +G   DVRDVA  H+L    E+  G+RL  V G+           F+LQ+V +++N++F
Sbjct: 239 ISGPYIDVRDVAKAHLLAFEKEETFGKRLMLVEGA-----------FSLQQVADIINEEF 287

Query: 338 PELQGKIAKGTIEDNEKALGIVFEFNNDKTSELTGIEFKPLEVTVHDAVKQIL 390
           P+L+G +  G     E+ L    +++  KT  + G + + L+ TV+D V QIL
Sbjct: 288 PQLKGNVTTGEPGTGEELLNKSAKYDPSKTKAILGFKLRNLKETVYDTVDQIL 340

>Scas_622.14
          Length = 387

 Score =  224 bits (570), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 141/380 (37%), Positives = 216/380 (56%), Gaps = 23/380 (6%)

Query: 18  LGTLLSLNFLHI---STKVYRKMDEKVLVSGCNGFLALHVLDVLLSEKFHVIGTVRSQEK 74
           +  +L    LHI   S+ +     E V VSGCNGF+A  +   LL   + VIG+VRSQ++
Sbjct: 23  MCLILHTTILHIYYTSSIIMAANQETVFVSGCNGFVATRITVDLLKAGYKVIGSVRSQDE 82

Query: 75  ADLVQKSFKKLYPYAQLDIELVKDITQKGAFDGVFEKH-PDIQHVLHTASNFSFGHDQST 133
            D     FK   P   L + +V+DI+  G+FD VF+++  +I++VLHTAS F     +  
Sbjct: 83  IDQFIPHFK---PTDALTLVIVEDISVLGSFDEVFKQYGKEIKYVLHTASPFIIDTTEYV 139

Query: 134 EETYLVPATKGTRSILESTLKLG-KQVKRFVLTSSFASILNADHAGDSSFIHTEATWNPI 192
           ++  L+PA  GT++ILE+  K     V+R V+TSSFA+        D+S   TE +WNP 
Sbjct: 140 KD-LLIPAVNGTQAILEAIKKYAADSVERVVITSSFAAQAGPKQWYDNSLTITEESWNPS 198

Query: 193 TWEQAKGNEFSAYVASKKLAETTAWDFLKEHEKEVGFTLTTVCPPYIWGPQVFEWGVQGA 252
           TW+  + +  +AY ASK  AE  AW FLK++E +V F +TT+ P +++GPQ F +  +  
Sbjct: 199 TWDDCQVDGMTAYCASKVFAEKEAWKFLKDNESQVKFKITTINPGFVYGPQTF-FDPKKK 257

Query: 253 TLNTSAEIVNKALQTTPEFKGPFDEPNGLACDVRDVALLHMLPLRNEKLAGERLFPVSGS 312
            +NTS++I+N  + +  E     +E  G   DVRD++  H+L  + ++L G+RL  VS  
Sbjct: 258 IMNTSSQIINHIVHSKKE--TDINEIFGPFVDVRDISKGHILAFQKKELIGKRLSMVS-- 313

Query: 313 GIKQHNYKNGKFNLQRVLEVLNKQFPELQGKIAKGTIEDNEKALGIVFEFNNDKTSELTG 372
                    G F+ Q VL+++N+ FP+L+GKI  G    +   +       ND+T +L G
Sbjct: 314 ---------GMFSSQGVLDIVNEDFPQLKGKIPVGKPGTDATLIAKHCTVINDETKKLLG 364

Query: 373 IEFKPLEVTVHDAVKQILDY 392
            EF  L+  + D VKQIL+Y
Sbjct: 365 FEFIDLKQCIDDTVKQILEY 384

>Sklu_2244.2 YOL151W, Contig c2244 1821-2879 reverse complement
          Length = 352

 Score =  222 bits (565), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 131/360 (36%), Positives = 206/360 (57%), Gaps = 23/360 (6%)

Query: 35  RKMDEKVLVSGCNGFLALHVLDVLL-SEKFHVIGTVRSQEKADLVQKSFKKLYPYAQLDI 93
           R M   V VSG  GF+A +V+D LL +EK+ VIG+ RSQEKAD +   F      + L +
Sbjct: 6   RIMSTTVFVSGATGFIAQYVIDELLKTEKYKVIGSARSQEKADKLLSQFSN----SNLSM 61

Query: 94  ELVKDITQKGAFDGVFEKHP-DIQHVLHTASNFSFGHDQSTEETYLVPATKGTRSILEST 152
           E+V +I +  AFD +F K+  DI+ VLHTAS F F   +  ++  L+PA  GT SIL++ 
Sbjct: 62  EIVPNIAEPDAFDHIFAKYAKDIKVVLHTASPF-FFESKDFDKDLLIPAVNGTSSILKAV 120

Query: 153 LKLGKQ-VKRFVLTSSFASILNADHAGDSSFIHTEATWNPITWEQAKGNEFSAYVASKKL 211
            K     V+R V+TSS+A++   +       +  E +WN ++WE+AK +  +AY ASK  
Sbjct: 121 KKYAANTVERVVITSSYAAVCTFNEDSQKGNVINEESWNTMSWEEAKKDGIAAYCASKAF 180

Query: 212 AETTAWDFLKEHEKEVGFTLTTVCPPYIWGPQVFEWGVQGATLNTSAEIVNKALQTTPEF 271
           AE   W+F +E++ E+ F L+T+ P +++GPQ+F   V  A LNTS E++NK + ++ + 
Sbjct: 181 AERFVWEFFEENKNELKFKLSTINPVFVFGPQLFNESV-AAQLNTSCELINKIVHSSSD- 238

Query: 272 KGPFDEP-NGLACDVRDVALLHMLPLRNEKLAGERLFPVSGSGIKQHNYKNGKFNLQRVL 330
               D+   G   DVRDVA  H+     +   G+RL                +F +Q + 
Sbjct: 239 -SEIDQTLFGGYIDVRDVAKAHICAFEQDDCIGQRLI-----------LAEERFTMQTLA 286

Query: 331 EVLNKQFPELQGKIAKGTIEDNEKALGIVFEFNNDKTSELTGIEFKPLEVTVHDAVKQIL 390
           +++N+ FP+L+ KIA G  + + + L  +   +N K+ +L G +F PL+ +V D V Q+L
Sbjct: 287 DIINQDFPQLRSKIAIGKPKSDVQVLSRIATLDNSKSRKLLGFDFIPLKQSVDDTVSQLL 346

>Scas_680.6
          Length = 367

 Score =  222 bits (566), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 138/358 (38%), Positives = 200/358 (55%), Gaps = 27/358 (7%)

Query: 41  VLVSGCNGFLALHVLDVLLSEKFHVIGTVRSQEKADLVQKSFKKLYPYAQLDIELVKDIT 100
           V VSG +GF+A H++ +LL + + VIG+VRSQEKA  V  +F        L++E+VKD+ 
Sbjct: 25  VFVSGASGFIAQHIIKLLLEQDYKVIGSVRSQEKAKHVLSNFNH---NPNLNLEIVKDLA 81

Query: 101 QKGAFDGVFEKH-PDIQHVLHTASNFSFGHDQSTEETYLVPATKGTRSILESTLKLGKQ- 158
              AFD VF+KH  +I+ VLH AS  +F      E+  L+PA  G +SIL + LK   Q 
Sbjct: 82  DLTAFDEVFQKHGKEIKIVLHPASPVTF-EVNDLEKDVLIPAVNGVKSILNAILKYAPQT 140

Query: 159 VKRFVLTSSFASILNADHAGDSSFIHTEATWNPITWEQAKGNEFSAYVASKKLAETTAWD 218
           V+R V TSS  +  N         +  E +WN  TWE  + +  +AY  SK  AE  AWD
Sbjct: 141 VERVVYTSSAMAQFNPAGKFSKDTLIDENSWNDATWENCQIDAVNAYSGSKAFAERAAWD 200

Query: 219 FLKEHEKEVGFTLTTVCPPYIWGPQVFEWGVQGATLNTSAEIVNKALQTTPEFKGP-FDE 277
           F+KEH  EV F LTTV P Y+ GPQ+ +  V    LN+S+E++N  +  T + + P F+ 
Sbjct: 201 FMKEHGNEVKFKLTTVLPTYVLGPQM-KIDVSKGKLNSSSELINAVVHATSDAELPSFNP 259

Query: 278 PNGLACDVRDVALLHMLPLRNEKLAGERLFPVSGSGIKQHNYKNGKFNLQRVLEVLNKQF 337
             G+  DVRDVA   +L  + +    +RL           +   G + LQ VL++++K F
Sbjct: 260 MMGVFVDVRDVAKAELLAFQKDGCIDKRL-----------SLAAGVYTLQDVLDLVHKDF 308

Query: 338 PELQGKIAKGTIEDNEKALGI----VFEFNNDKTSELTGIEFKPLEVTVHDAVKQILD 391
           PEL GK+  G    N    G+    +F FNND+T ++ G +F   + + HD++ QILD
Sbjct: 309 PELNGKVPAG----NPGVRGVTADELFSFNNDETKKVLGFKFIDFQKSAHDSIAQILD 362

>Scas_617.1
          Length = 345

 Score =  220 bits (561), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 137/356 (38%), Positives = 203/356 (57%), Gaps = 26/356 (7%)

Query: 41  VLVSGCNGFLALHVLDVLLSEKFHVIGTVRSQEKADLVQKSFKKLYPYAQLDIELVKDIT 100
           V VSG +GF+A +++ +LL + + VIG+VRS  KA  V  +F+       L   +++D++
Sbjct: 8   VFVSGASGFIAQNIIKLLLEQNYKVIGSVRSNNKAKQVHSTFEN---NPSLSFVIIEDLS 64

Query: 101 QKGAFDGVFEKH-PDIQHVLHTASNFSFGHDQST--EETYLVPATKGTRSILESTLKLGK 157
           +  AFD VF+K+  DI+ VLHTAS  +F   Q+T  E+  L+PA  G +SIL + LK   
Sbjct: 65  KLTAFDEVFKKYGKDIKIVLHTASPVTF---QATDLEKGILIPAVNGVKSILNAILKYAP 121

Query: 158 Q-VKRFVLTSSFASILNADHAGDSSFIHTEATWNPITWEQAKGNEFSAYVASKKLAETTA 216
           Q V+RFV TSS  + +N       +    E +WN  TWE ++ +  +AY ASK  AE  A
Sbjct: 122 QTVERFVYTSSVLAQVNPTWTDFKNVTINEKSWNDSTWEGSQVDSLTAYSASKAFAERAA 181

Query: 217 WDFLKEHEKEVGFTLTTVCPPYIWGPQVFEWGVQGATLNTSAEIVNKALQTTPEFKGP-F 275
           WDF+KE+  EV F LTTV P +++GP+V      G  LN S EI+   +  T E + P  
Sbjct: 182 WDFMKEYGNEVKFKLTTVLPSFVFGPEV----KIGPKLNLSGEILKTIIHATSEKQLPSV 237

Query: 276 DEPNGLACDVRDVALLHMLPLRNEKLAGERLFPVSGSGIKQHNYKNGKFNLQRVLEVLNK 335
           D    ++ DVRDVA  HML  + E+  G+RL  V              F LQ +L++++ 
Sbjct: 238 DTVLRVSVDVRDVARAHMLAFQKEECIGKRLSLVENV-----------FTLQDILDLIHT 286

Query: 336 QFPELQGKIAKGTIEDNEKALGIVFEFNNDKTSELTGIEFKPLEVTVHDAVKQILD 391
            FP+L G +       NEK    +F FNND++ ++ G +F   + +VHD++KQILD
Sbjct: 287 DFPDLSGNVPVRAPVSNEKMPKELFGFNNDESKKILGFKFYDFKTSVHDSIKQILD 342

>YGL039W (YGL039W) [1936] chr7 (423965..425011) Protein of unknown
           function, member of a family (GRE2, YGL039W, YGL157W,
           YDR541C) having similarity to plant
           dihydroflavonol-4-reductases [1047 bp, 348 aa]
          Length = 348

 Score =  219 bits (559), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 139/363 (38%), Positives = 196/363 (53%), Gaps = 39/363 (10%)

Query: 41  VLVSGCNGFLALHVLDVLLSEKFHVIGTVRSQEKADLVQKSFKKLYPYAQLDIELVKDIT 100
           V VSG  GF+ALHV+D LL   + VIG+ RSQEK D + K FK       L +E+V+DI 
Sbjct: 8   VFVSGATGFIALHVVDDLLKTGYKVIGSGRSQEKNDGLLKKFKS---NPNLSMEIVEDIA 64

Query: 101 QKGAFDGVFEKH-PDIQHVLHTASNFSFGHDQSTEETYLVPATKGTRSILESTLKLGKQ- 158
              AFD VF+KH  +I+ VLH AS   F +    E+  L+PA  GT+SILE+        
Sbjct: 65  APNAFDKVFQKHGKEIKVVLHIASPVHF-NTTDFEKDLLIPAVNGTKSILEAIKNYAADT 123

Query: 159 VKRFVLTSSFASILNADHAGDSSFIHTEATWNPITWEQAKGNEFSAYVASKKLAETTAWD 218
           V++ V+TSS A++ +     D+SF+  E +WN  TWE  + N  SAY  SKK AE TAWD
Sbjct: 124 VEKVVITSSVAALASPGDMKDTSFVVNEESWNKDTWESCQANAVSAYCGSKKFAEKTAWD 183

Query: 219 FLKEHEKEVGFTLTTVCPPYIWGPQVFEWGVQGATLNTSAEIVN----KALQTTPEFKGP 274
           FL+E++  + FTL+T+ P +++GPQ+F   ++    ++SA I N    K       + GP
Sbjct: 184 FLEENQSSIKFTLSTINPGFVFGPQLFADSLRNGINSSSAIIANLVSYKLGDNFYNYSGP 243

Query: 275 FDEPNGLACDVRDVALLHMLPLRNEKLAGERLFPVSGSGIKQHNYKNGKFNLQRVLEVLN 334
           F        DVRDV+  H+L     + AG+RLF                F  Q  L++LN
Sbjct: 244 F-------IDVRDVSKAHLLAFEKPECAGQRLFLCE-----------DMFCSQEALDILN 285

Query: 335 KQFPELQGKIAKGTIEDNEKALGIVF------EFNNDKTSELTGIEFKPLEVTVHDAVKQ 388
           ++FP+L+GKIA G     E   G  F      + +N KT  L G +F      + D   Q
Sbjct: 286 EEFPQLKGKIATG-----EPGSGSTFLTKNCCKCDNRKTKNLLGFQFNKFRDCIVDTASQ 340

Query: 389 ILD 391
           +L+
Sbjct: 341 LLE 343

>CAGL0E05280g complement(511971..513026) similar to tr|Q12068
           Saccharomyces cerevisiae YOL151w GRE2, start by
           similarity
          Length = 351

 Score =  219 bits (559), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 140/357 (39%), Positives = 204/357 (57%), Gaps = 29/357 (8%)

Query: 41  VLVSGCNGFLALHVLDVLLSEKFHVIGTVRSQEKADLVQKSFKKLYPYAQLDIELVKDIT 100
           V VSG +GF+A H++  LL + + VIG+VRS EK D ++ +   ++  A  + E+VKDI 
Sbjct: 10  VFVSGASGFIAQHIIRQLLDQNYKVIGSVRSTEKGDNLKNA---IFKSANFNYEIVKDIA 66

Query: 101 QKGAFDGVFEKH-PDIQHVLHTASNFSFGHDQSTEETYLVPATKGTRSILESTLKLGKQ- 158
              AFD VFEKH  DI+ VLHTAS  +F   +  E+  L+PA  GT+ ILES  K   Q 
Sbjct: 67  DLNAFDPVFEKHGKDIKVVLHTASPLNFTTTEY-EKDLLIPAVNGTKGILESIKKYAAQT 125

Query: 159 VKRFVLTSSFASILNADHAGDSSFIHTEATWNPITWEQAKGNEFSAYVASKKLAETTAWD 218
           V+R V+TSSFAS  +     ++    TE +WN  +WE  + +   AY  SKK AE  AW+
Sbjct: 126 VERVVVTSSFASHTSTVDMCNTKGKITEDSWNQDSWENCQTDAVRAYFGSKKFAEEAAWE 185

Query: 219 FLKEHEKEVGFTLTTVCPPYIWGPQV-FEWGVQGATLNTSAEIVNKALQTTPEFKGPFDE 277
           FL +++  V F L TV P Y++GPQ   E G +   LN S+E++N+ +    +   P   
Sbjct: 186 FLNKNKDAVKFKLATVDPVYVFGPQNHIEPGKK--VLNVSSEVINQLVHLKKDDPLP--- 240

Query: 278 PNGLAC---DVRDVALLHMLPLRNEKLAGERLFPVSGSGIKQHNYKNGKFNLQRVLEVLN 334
              +AC   DVRD+A  H+L  + ++L G+RL              +G F +Q +L+ +N
Sbjct: 241 --QVACGYIDVRDIAKAHILAFQKDELIGQRLL-----------LHSGLFTVQTLLDAIN 287

Query: 335 KQFPELQGKIAKGTIEDNEKALGIVFEFNNDKTSELTGIEFKPLEVTVHDAVKQILD 391
           +QFPEL+GKI  G    N K   ++   +N KT +L G EF+ L+  + D V QIL+
Sbjct: 288 EQFPELRGKIPAGEPGSN-KPEDLLTPIDNTKTKKLLGFEFRDLKTIIQDTVSQILE 343

>YGL157W (YGL157W) [1832] chr7 (209009..210052) Protein of unknown
           function, member of a family (GRE2, YGL039W, YGL157W,
           YDR541C) having similarity to plant
           dihydroflavonol-4-reductases [1044 bp, 347 aa]
          Length = 347

 Score =  219 bits (558), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 136/362 (37%), Positives = 206/362 (56%), Gaps = 31/362 (8%)

Query: 38  DEKVLVSGCNGFLALHVLDVLLSEKFHVIGTVRSQEKADLVQKSFKKLYPYAQLDIELVK 97
           D  V VSG  GF+ALH+++ LL   + VIG+ RSQEK D + K F       +L +E+V+
Sbjct: 4   DTTVFVSGATGFIALHIMNDLLKAGYTVIGSGRSQEKNDGLLKKFNN---NPKLSMEIVE 60

Query: 98  DITQKGAFDGVFEKH-PDIQHVLHTASNFSFGHDQSTEETYLVPATKGTRSILESTLKLG 156
           DI    AFD VF+KH  +I+ VLHTAS F F    + E+  L PA  GT+SILE+  K  
Sbjct: 61  DIAAPNAFDEVFKKHGKEIKIVLHTASPFHF-ETTNFEKDLLTPAVNGTKSILEAIKKYA 119

Query: 157 KQ-VKRFVLTSSFASILNADHAGDSSFIHTEATWNPITWEQAKGNEFSAYVASKKLAETT 215
              V++ ++TSS A+++          + TE +WN  TW+  + N  +AY  SKK AE T
Sbjct: 120 ADTVEKVIVTSSTAALVTPTDMNKGDLVITEESWNKDTWDSCQANAVAAYCGSKKFAEKT 179

Query: 216 AWDFLKEHEKEVGFTLTTVCPPYIWGPQVFEWGVQGATLNTSAEIVNKALQTTPEFKGPF 275
           AW+FLKE++  V FTL+T+ P +++GPQ+F   ++   +NTS+ IV++ + +  +  G F
Sbjct: 180 AWEFLKENKSSVKFTLSTINPGFVFGPQMFADSLKHG-INTSSGIVSELIHS--KVGGEF 236

Query: 276 DEPNGLACDVRDVALLHMLPLRNEKLAGERLFPVSGSGIKQHNYKNGKFNLQRVLEVLNK 335
               G   DVRDV+  H++ +   +  G+RL               G F  Q ++++LN+
Sbjct: 237 YNYCGPFIDVRDVSKAHLVAIEKPECTGQRLV-----------LSEGLFCCQEIVDILNE 285

Query: 336 QFPELQGKIAKGTIEDNEKALGIVF------EFNNDKTSELTGIEFKPLEVTVHDAVKQI 389
           +FP+L+GKIA G     E A G  F      +F+N KT +L G +F  L+  + D   Q+
Sbjct: 286 EFPQLKGKIATG-----EPATGPSFLEKNSCKFDNSKTKKLLGFQFYNLKDCIVDTAAQM 340

Query: 390 LD 391
           L+
Sbjct: 341 LE 342

>CAGL0E05170g complement(504611..505669) similar to tr|Q12068
           Saccharomyces cerevisiae YOL151w GRE2, start by
           similarity
          Length = 352

 Score =  218 bits (554), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 144/359 (40%), Positives = 202/359 (56%), Gaps = 30/359 (8%)

Query: 41  VLVSGCNGFLALHVLDVLLSEKFHVIGTVRSQEKADLVQKSFKKLYPYAQLDIELVKDIT 100
           V VSG  GF+A HV+  LL + + VIG+VRS EK D ++     ++     + E+VKDI+
Sbjct: 10  VFVSGATGFIAQHVVRQLLDQNYKVIGSVRSAEKGDHLKNV---IFKGGDFNYEIVKDIS 66

Query: 101 QKGAFDGVFEKH-PDIQHVLHTASNFSFGHDQSTEETYLVPATKGTRSILESTLKLGKQ- 158
              AFD VFEKH  DI+ VLHTAS F F +    E+  L+PA  GT+ ILES  K   Q 
Sbjct: 67  DPTAFDHVFEKHGKDIKVVLHTASPFHF-NTTDIEKDLLIPAVNGTKGILESIKKYAAQT 125

Query: 159 VKRFVLTSSFA---SILNADHAGDSSFIHTEATWNPITWEQAKGNEFSAYVASKKLAETT 215
           V+R V+TSSFA   S ++  +A DSS   TE +WN  TWE  + +    Y  SKK AE  
Sbjct: 126 VERVVVTSSFAANTSTVDMFYAKDSSKTITEESWNQDTWESCQSDPIRGYCGSKKFAEKA 185

Query: 216 AWDFLKEHEKEVGFTLTTVCPPYIWGPQVF-EWGVQGATLNTSAEIVNKALQTTPEFKGP 274
           AWDF   ++  V F L+ + P Y++GPQ + E G +   LNTS+E++N  +    +   P
Sbjct: 186 AWDFYNANKDSVKFKLSIINPVYVFGPQNYVEPGKK--ILNTSSEVINSLVHLKKD--DP 241

Query: 275 FDEPNGLACDVRDVALLHMLPLRNEKLAGERLFPVSGSGIKQHNYKNGKFNLQRVLEVLN 334
             E  G   DVRDVA  H+L  + ++L  +RL               G F  Q +L+++N
Sbjct: 242 LPEFAGGHIDVRDVAKAHILAFQKDELIEQRLM-----------LHAGLFTTQTLLDIIN 290

Query: 335 KQFPELQGKIAKGT--IEDNEKALGIVFEFNNDKTSELTGIEFKPLEVTVHDAVKQILD 391
           +QFPEL+GKI  G     + + AL  V   +N KT +L G EF  L+  ++D + QIL+
Sbjct: 291 EQFPELKGKIPAGKPGTGNPDDALTPV---DNSKTKKLLGFEFIDLKKDLYDTISQILE 346

>Scas_630.13
          Length = 349

 Score =  213 bits (541), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 130/356 (36%), Positives = 196/356 (55%), Gaps = 25/356 (7%)

Query: 41  VLVSGCNGFLALHVLDVLLSEKFHVIGTVRSQEKADLVQKSFK---KLYPYAQLDIELVK 97
           +LVSG +GF+ALH+++ LL + + VIG+VR+ E+A L+ K F    KL P       +V+
Sbjct: 9   ILVSGADGFIALHIVNDLLQKGYTVIGSVRNPEEAALLMKDFNNNPKLIPV------VVE 62

Query: 98  DITQKGAFDGVFEKH-PDIQHVLHTASNFSFGHDQSTEETYLVPATKGTRSILESTLKLG 156
           DI++  +FD VF+++   I+ VLH AS   F       +  L+PA  GT ++L +  +  
Sbjct: 63  DISKLNSFDHVFQEYGSQIKGVLHVASPVHFESSDVVND-LLIPALNGTTAVLNAIKEYA 121

Query: 157 KQ-VKRFVLTSSFASILNADHAGDSSFIHTEATWNPITWEQAKGNEFSAYVASKKLAETT 215
            Q V++ V+TSSFA  ++     D + + TE +WN  TWE  + +  SAY ASKK AE  
Sbjct: 122 PQSVEKVVITSSFAGFVSPKQMADKNTVVTEDSWNDSTWENCQSDPISAYCASKKFAEKA 181

Query: 216 AWDFLKEHEKEVGFTLTTVCPPYIWGPQVFEWGVQGATLNTSAEIVNKALQTTPEFKGPF 275
           AWDFL++++ EV F L  + P +++GPQ+F  GV+   +N S EI+NK +        PF
Sbjct: 182 AWDFLEKYKSEVKFELAVISPGWVFGPQLFSRGVK-PVMNVSCEIINKIVHARSIDDVPF 240

Query: 276 DEPNGLACDVRDVALLHMLPLRNEKLAGERLFPVSGSGIKQHNYKNGKFNLQRVLEVLNK 335
            E  G   DVRD A  H+  L N+   G RL               G F  Q +L++++ 
Sbjct: 241 -EMMGPYIDVRDTAKAHIFALENDSCNGHRLI-----------LNEGFFTAQEILDIVHN 288

Query: 336 QFPELQGKIAKGTIEDNEKALGIVFEFNNDKTSELTGIEFKPLEVTVHDAVKQILD 391
            FPE+   I  G     +K L   F  +N KT ++ G  F+ L+ TV D V QI++
Sbjct: 289 DFPEVGKDIPMGNPGTGKKLLEERFTADNSKTRKILGFPFRDLKETVDDTVAQIIE 344

>Kwal_56.23863
          Length = 344

 Score =  177 bits (448), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 122/358 (34%), Positives = 185/358 (51%), Gaps = 24/358 (6%)

Query: 37  MDEKVLVSGCNGFLALHVLDVLL-SEKFHVIGTVRSQEKADLVQKSFKKLYPYAQLDIEL 95
           M E VL++G N ++A H+++VLL +  ++VIGTVRS EKA  + ++F       +L  E+
Sbjct: 3   MAETVLITGANNYVAQHIINVLLKNSNYNVIGTVRSNEKAVKLSENFNS----DRLKCEV 58

Query: 96  VKDITQKGAFDGVFEKH-PDIQHVLHTASNFSFGHDQSTEETYLVPATKGTRSILESTLK 154
           V D+  + AFD VF K+   I HV+HTAS  +F       E  + PA +G +S+L S  +
Sbjct: 59  VSDMGSQNAFDEVFSKYYTKITHVIHTASPVNFQATDYYSEV-INPAVEGMKSLLNSIKR 117

Query: 155 LGKQ-VKRFVLTSSFASILNADHAGDSSFIHTEATWNPITWEQAKGNEFSAYVASKKLAE 213
                VKR V+ SS+ +++       +     E +WNP        +   AY ASK LAE
Sbjct: 118 YSSYLVKRVVVLSSYPALIPMADDTKAGLKINEESWNPFETGDPIHSPQEAYAASKTLAE 177

Query: 214 TTAWDFLKEHEKEVGFTLTTVCPPYIWGPQVFEWGVQGATLNTSAEIVNKALQTTPEFKG 273
             AW F++E+   V F LTT+ P +IWGPQVF    +  T   S E   + +++  +   
Sbjct: 178 KAAWKFMEEN-TSVQFELTTIQPAFIWGPQVFFSEAKKRTPG-SCEFFTQIIES--KVDD 233

Query: 274 PFDEPNGL-ACDVRDVALLHMLPLRNEKLAGERLFPVSGSGIKQHNYKNGKFNLQRVLEV 332
             D+       DVRDVA  H+L L+   L G+RL   +G           + N Q + + 
Sbjct: 234 AIDKSVSYPVVDVRDVAQAHLLALKKANLGGKRLILYAG-----------RCNNQILADT 282

Query: 333 LNKQFPELQGKIAKGTIEDNEKALGIVFEFNNDKTSELTGIEFKPLEVTVHDAVKQIL 390
           +N  F EL+G+IA+G     E  +      N+ K+ EL G +F+ +  T+ D   QIL
Sbjct: 283 INAHFDELRGRIARGDQGSGEALITNAATLNDTKSKELLGFQFRSISETIIDTTTQIL 340

>KLLA0B14641g 1287645..1288148 similar to sp|P53183 Saccharomyces
           cerevisiae YGL039w, hypothetical start
          Length = 167

 Score = 95.5 bits (236), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 59/135 (43%), Positives = 83/135 (61%), Gaps = 7/135 (5%)

Query: 41  VLVSGCNGFLALHVLDVLLSEKFHVIGTVRSQEKADLVQKSFKKLYPYAQLDIELVKDIT 100
           VLVSG +G++A H + +LL + + VIGTVR+QEKAD    S  +L+    L +ELV ++ 
Sbjct: 23  VLVSGASGYIAQHTIRILLEKGYKVIGTVRTQEKAD----SVAQLFNSDNLVLELVPELA 78

Query: 101 QKGAFDGVFEKH-PDIQHVLHTASNFSFGHDQSTEETYLVPATKGTRSILESTLKL-GKQ 158
           +  AFD VFEK+   I+HV+HTAS   +       E  L+PA  GTRS+LES  K     
Sbjct: 79  KIDAFDHVFEKYNTQIKHVIHTASPVRYNMTDFENEM-LLPAINGTRSVLESIKKFSADS 137

Query: 159 VKRFVLTSSFASILN 173
           V+  V TSS +++ N
Sbjct: 138 VETVVYTSSISALAN 152

>KLLA0B14663g 1288500..1288730 similar to sp|Q9UV57
           Zygosaccharomyces rouxii Ketoreductase, hypothetical
           start
          Length = 76

 Score = 56.6 bits (135), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 43/70 (61%)

Query: 321 NGKFNLQRVLEVLNKQFPELQGKIAKGTIEDNEKALGIVFEFNNDKTSELTGIEFKPLEV 380
           N +F LQ V + +N+ +PEL+GKI+ G     +  +    +++N KT +L G EF P E 
Sbjct: 2   NKRFALQDVADFINENYPELKGKISVGNPGAGKDIVATTSKYDNSKTRKLLGFEFVPFEQ 61

Query: 381 TVHDAVKQIL 390
           +V D+V QIL
Sbjct: 62  SVTDSVNQIL 71

>AFR001W [3193] [Homologous to ScYGL001C (ERG26) - SH]
           complement(437333..438385) [1053 bp, 350 aa]
          Length = 350

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 50/210 (23%), Positives = 88/210 (41%), Gaps = 35/210 (16%)

Query: 39  EKVLVSGCNGFLALHVLDVLLSEKFHVIGTVRSQEKADLVQKSFKKLYPYAQLDIELVKD 98
           E VL+ G +GFL LH++     E++  +       + D+     + L    ++  +   D
Sbjct: 5   ESVLLVGGSGFLGLHLI-----EQYWNL-----TPRPDIYVFDIRPL--PEKISTQFTFD 52

Query: 99  ITQKGAFDGVFEKHPDIQHVLHTASNFSFGHDQS-----TEETYLVPATKGTRSILESTL 153
            T+   + G      D++H + ++      H  S     ++E Y +   +GT+++L+   
Sbjct: 53  PTKITCYQGDLTSAKDVEHAIKSSGVRVLVHSASPMHGNSQEIYEMVNVEGTKNLLDVAK 112

Query: 154 KLGKQVKRFVLTSSFASILNADHAGDSSFIH-TEATWNPITWEQAKGNEFSAYVASKKLA 212
           K G  +  F+ TSS   I N         IH  + TW PI      G     Y  +K +A
Sbjct: 113 KCG--ITAFIYTSSAGVIFNGQD------IHNADETW-PIPDIPMDG-----YNETKAIA 158

Query: 213 ETTAWDFLKEHEKEVGFTLTTVCPPYIWGP 242
           E      L  ++ + GF    + P  I+GP
Sbjct: 159 EKMV---LTANDPQNGFLTIALRPAGIFGP 185

>YGL001C (ERG26) [1971] chr7 complement(495455..496504) C-3 sterol
           dehydrogenase, C-4 decarboxylase, required for
           ergosterol biosynthesis [1050 bp, 349 aa]
          Length = 349

 Score = 38.1 bits (87), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 57/209 (27%), Positives = 88/209 (42%), Gaps = 33/209 (15%)

Query: 39  EKVLVSGCNGFLALHVL----DVLLSEKFHVIGTVRSQEKADLVQKSFKKLYPYAQLDIE 94
           + VL+ G +GFL LH++    D+      H+   VR     DL +K   K + +   DI+
Sbjct: 5   DSVLIIGGSGFLGLHLIQQFFDINPKPDIHIF-DVR-----DLPEK-LSKQFTFNVDDIK 57

Query: 95  LVK-DITQKGAFDGVFEKHPDIQHVLHTASNFSFGHDQSTEETYLVPATKGTRSILESTL 153
             K D+T     +    +      V+H AS     H Q+  + Y +   KGTR++++   
Sbjct: 58  FHKGDLTSPDDMENAINES-KANVVVHCASPM---HGQN-PDIYDIVNVKGTRNVIDMCK 112

Query: 154 KLGKQVKRFVLTSSFASILNADHAGDSSFIHTEATWNPITWEQAKGNEFSAYVASKKLAE 213
           K G  V   V TSS   I N     ++     + TW PI           AY  +K +AE
Sbjct: 113 KCG--VNILVYTSSAGVIFNGQDVHNA-----DETW-PI-----PEVPMDAYNETKAIAE 159

Query: 214 TTAWDFLKEHEKEVGFTLTTVCPPYIWGP 242
                 LK ++    F    + P  I+GP
Sbjct: 160 DMV---LKANDPSSDFYTVALRPAGIFGP 185

>Scas_652.19d1
          Length = 344

 Score = 37.4 bits (85), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 34/59 (57%)

Query: 38 DEKVLVSGCNGFLALHVLDVLLSEKFHVIGTVRSQEKADLVQKSFKKLYPYAQLDIELV 96
          D+  +V+GCN  +  HV+++L  +  +VIG VR+  K +  +K      P ++ +I ++
Sbjct: 41 DKTAVVTGCNTGIGKHVVELLYQKNCNVIGVVRTDAKGEEAKKEIIANNPKSKGNITII 99

>Scas_652.19d
          Length = 341

 Score = 35.4 bits (80), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 31/56 (55%)

Query: 41 VLVSGCNGFLALHVLDVLLSEKFHVIGTVRSQEKADLVQKSFKKLYPYAQLDIELV 96
           L++G N  +   V+ +L S+  ++I  VRS EK +  +K   + YP ++  I +V
Sbjct: 44 ALITGTNTGIGFEVMKLLYSKNCNIIAVVRSAEKGEAAKKEAIEKYPNSKGSISVV 99

>YLL056C (YLL056C) [3367] chr12 complement(27409..28305) Protein
           possibly involved in cell detoxification or stress
           response [897 bp, 298 aa]
          Length = 298

 Score = 35.0 bits (79), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 38/74 (51%), Gaps = 8/74 (10%)

Query: 40  KVLVSGCNGFLALHVLDVLLSEKFHVIGTVRSQEKADLVQKSFKKLYPYAQLDIELVKD- 98
           KV ++G +GF+   VL  L+S    V+G  RS E A       K + P A++    +KD 
Sbjct: 2   KVFITGASGFIGSAVLSELISSGHEVVGLARSDEAA----AKIKSIDPAAKILRGDLKDL 57

Query: 99  -ITQKGAF--DGVF 109
            I +KGA   DGV 
Sbjct: 58  EILKKGATESDGVI 71

>Sklu_2306.3 YGL001C, Contig c2306 4537-5586
          Length = 349

 Score = 32.7 bits (73), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 55/208 (26%), Positives = 86/208 (41%), Gaps = 35/208 (16%)

Query: 41  VLVSGCNGFLALHVL----DVLLSEKFHVIGTVRSQEKADLVQKSFKKLYPYAQLDIELV 96
           VL+ G +GFL LH++    D+      HV       EK         K + +   +I   
Sbjct: 7   VLLIGGSGFLGLHLVQQFYDLTPKPDIHVFDVRPLPEK-------LSKQFTFNPSEIAFH 59

Query: 97  K-DITQ-KGAFDGVFEKHPDIQHVLHTASNFSFGHDQSTEETYLVPATKGTRSILESTLK 154
           K D+T  +   + +   + D+  V+H+AS     H  S +E Y     +GTR++L+    
Sbjct: 60  KGDLTSPEDVGEAIKSSNADV--VVHSASPI---HGNS-QEVYEKVNVQGTRNLLDVAKN 113

Query: 155 LGKQVKRFVLTSSFASILNADHAGDSSFIHTEATWNPITWEQAKGNEFSAYVASKKLAET 214
            G  VK  V TSS   I N     ++     + TW PI      G     Y  +K +AE 
Sbjct: 114 CG--VKAVVYTSSAGVIFNGQDVHNA-----DETW-PIPEVPMDG-----YNETKAIAEE 160

Query: 215 TAWDFLKEHEKEVGFTLTTVCPPYIWGP 242
                L  ++ +  F    + P  I+GP
Sbjct: 161 MV---LNANDPKSNFLTVALRPAGIFGP 185

>Scas_668.8
          Length = 349

 Score = 32.7 bits (73), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 54/209 (25%), Positives = 90/209 (43%), Gaps = 37/209 (17%)

Query: 41  VLVSGCNGFLALHVLDVLLSEKFHVIGTVRSQEKADL--VQKSFKKLYPYAQLDIEL-VK 97
           VL+ G +GFL LH++     ++F+ +    S    D+  + +     + +   DI++ + 
Sbjct: 7   VLLIGGSGFLGLHLI-----QQFYELSPRPSIHVFDVRPLPEKLSNQFTFKLDDIQVHIG 61

Query: 98  DITQKGAFDGVFE--KHPDIQHVLHTASNFSFGHDQSTEETYLVPATKGTRSILESTLKL 155
           D+T   +F+ V +  K      V+H+AS     H Q+ +E Y +   KGTR++++  +  
Sbjct: 62  DLT---SFEDVQKAIKVSGANVVVHSASPM---HGQN-KEIYDLVNVKGTRNVID--VCK 112

Query: 156 GKQVKRFVLTSSFASILNAD--HAGDSSFIHTEATWNPITWEQAKGNEFSAYVASKKLAE 213
              V   V TSS   I N    H  D  +   E                 AY  +K  AE
Sbjct: 113 NTNVNILVYTSSAGVIFNGQDVHNADERWPIPEV-------------PMDAYNETKFTAE 159

Query: 214 TTAWDFLKEHEKEVGFTLTTVCPPYIWGP 242
                 LK ++ E GF    + P  I+GP
Sbjct: 160 DMV---LKSNDPENGFLTVALRPAGIFGP 185

>KLLA0C18513g complement(1636434..1637489) highly similar to
           sp|P53199 Saccharomyces cerevisiae YGL001c ERG26 C-3
           sterol dehydrogenase (C-4 decarboxylase) singleton,
           start by similarity
          Length = 351

 Score = 31.6 bits (70), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 55/222 (24%), Positives = 86/222 (38%), Gaps = 59/222 (26%)

Query: 39  EKVLVSGCNGFLALHVLDVLLSEKFHVIGTVRSQEKADLVQKSFKKLYPYAQL---DIEL 95
           + VL+ G +GFL LH++                        + F +L P  Q+   D+  
Sbjct: 7   KSVLLIGGSGFLGLHLI------------------------QQFSELKPQPQIHVFDVRP 42

Query: 96  VKD-ITQKGAFD--------GVFEKHPDIQHVLHTASNFSFGHDQS-----TEETYLVPA 141
           + D I+++  FD        G      D++  + T+      H  S     ++E Y    
Sbjct: 43  LPDRISKQFTFDPSTITFHQGDLTSPADVRKAIETSGATIVVHSASPMHGNSQEIYEKVN 102

Query: 142 TKGTRSILESTLKLGKQVKRFVLTSSFASILNADHAGDSSFIH-TEATWNPITWEQAKGN 200
            KGT+++L  T+    +VK  V TSS   I N         IH  + TW PI      G 
Sbjct: 103 VKGTKNLL--TVAKQCRVKAVVYTSSAGVIFNGQD------IHNADETW-PIPEVPMDG- 152

Query: 201 EFSAYVASKKLAETTAWDFLKEHEKEVGFTLTTVCPPYIWGP 242
               Y  +K +AE      L  ++ E  F    + P  I+GP
Sbjct: 153 ----YNETKAIAEEMV---LSANDPENDFLTIALRPAGIFGP 187

>Kwal_26.8462
          Length = 722

 Score = 32.0 bits (71), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 26/51 (50%)

Query: 304 ERLFPVSGSGIKQHNYKNGKFNLQRVLEVLNKQFPELQGKIAKGTIEDNEK 354
           ER  P+    + Q     G F L   LE+L+ Q   + G ++KGT+  NE+
Sbjct: 93  ERACPLQTENLSQEALNLGLFQLTETLELLHTQAKVVLGTLSKGTVFVNER 143

>CAGL0E04554g 439158..439880 no similarity, hypothetical start
          Length = 240

 Score = 30.0 bits (66), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 23/93 (24%), Positives = 37/93 (39%), Gaps = 16/93 (17%)

Query: 34  YRKMDEKVLVSGCNGFLALHVLDVLLSEKFHVIGTVRSQEKADLVQKSFKKLYPYAQLD- 92
           YR  DE +    C+G     +LD   S +   + T+ S +K     KS  K +  ++ D 
Sbjct: 65  YRPRDETLKKPDCDG-----ILDNKNSSQIRTVPTLCSSDKLSRCDKSTMKYHKKSESDE 119

Query: 93  ----------IELVKDITQKGAFDGVFEKHPDI 115
                      E +  I+     D V+E H D+
Sbjct: 120 FEQFTSPDLHFEAIDSISVNNISDNVYESHTDL 152

>Scas_631.4
          Length = 1398

 Score = 30.4 bits (67), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 43/86 (50%), Gaps = 9/86 (10%)

Query: 287  DVALLHMLPLRNEKLA---GERLFPVSGSGIKQHNYKNGKFNLQRVLEVLNKQFPELQGK 343
            + ALL +  L N K A    E+L  +  S  ++   +N  FN      ++  QF  +Q  
Sbjct: 1103 ECALLTLERLHNFKFANNLSEKLTELLESRFEKTQNENELFNFA----IIRAQFARIQLG 1158

Query: 344  IA--KGTIEDNEKALGIVFEFNNDKT 367
            +   K  IE++E + GI+ +F+ND+ 
Sbjct: 1159 LRNFKSAIENSELSQGILADFSNDRV 1184

>Kwal_14.775
          Length = 295

 Score = 29.6 bits (65), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 21/37 (56%)

Query: 40 KVLVSGCNGFLALHVLDVLLSEKFHVIGTVRSQEKAD 76
          KV V+G +GF+   V+  LL     V+   RSQE AD
Sbjct: 2  KVFVTGGSGFIGTGVVSELLHLGHTVVALSRSQESAD 38

>Scas_719.50
          Length = 445

 Score = 29.6 bits (65), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 28/59 (47%), Gaps = 1/59 (1%)

Query: 335 KQFPELQGKIAKGTIEDNEKALGIVFEFNNDKTSEL-TGIEFKPLEVTVHDAVKQILDY 392
            Q P+   ++AK  IE+NEK   +   F N   S L  GI  +PL V     +  I+ Y
Sbjct: 12  SQLPDTSEELAKELIEENEKKSNVYMAFMNMANSILGAGIITQPLAVKNAGILGSIICY 70

>YDR017C (KCS1) [870] chr4 complement(479111..482263) Inositol
            (1,2,3,4,5,6) hexaphosphate kinase, suppressor of
            temperature-sensitive growth and hyperrecombination in
            pkc1-4, involved in endocytosis [3153 bp, 1050 aa]
          Length = 1050

 Score = 28.9 bits (63), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 24/50 (48%), Gaps = 1/50 (2%)

Query: 177  AGDSSFIHTEATWNPITWEQAKGNEFSAYVASKKLAETTAWDFLKEHEKE 226
              D   I  E   N +  E+A  N F++   S K+   + WD+L E +KE
Sbjct: 965  TSDMPLIFDEVEMNDMISEEADSNSFTSATGS-KINFNSKWDWLDEFDKE 1013

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.135    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 12,767,496
Number of extensions: 548531
Number of successful extensions: 1682
Number of sequences better than 10.0: 43
Number of HSP's gapped: 1574
Number of HSP's successfully gapped: 43
Length of query: 392
Length of database: 16,596,109
Length adjustment: 104
Effective length of query: 288
Effective length of database: 12,995,837
Effective search space: 3742801056
Effective search space used: 3742801056
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 62 (28.5 bits)