Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_47.1746249248526250.0
AGR167W51248414280.0
KLLA0A04906g48048613900.0
Sklu_2253.249849413091e-178
Kwal_47.1898249649412931e-175
YGL202W (ARO8)50049412751e-172
CAGL0G01254g50449812751e-172
Scas_712.4849749812731e-172
KLLA0F10021g49749512521e-169
AFR548C49748211781e-158
YHR137W (ARO9)5133965295e-61
Sklu_2392.15304765252e-60
Scas_697.115103935209e-60
KLLA0D11110g5304125183e-59
Kwal_33.145825254085024e-57
CAGL0G06028g5374024817e-54
AGR141C4382811334e-08
Kwal_14.25744432741325e-08
CAGL0J05126g4472841281e-07
Scas_555.74461881272e-07
Scas_711.524453001253e-07
CAGL0I06578g4362721245e-07
YJL060W (BNA3)4442941245e-07
CAGL0L12254g5741251211e-06
KLLA0F01617g4442951201e-06
KLLA0E00935g4451751173e-06
YER152C4431041148e-06
Sklu_2389.74472861112e-05
Scas_681.25681281076e-05
Kwal_56.237915181541051e-04
AGR085W5211541051e-04
Kwal_8.5854461231032e-04
YDR111C5072201022e-04
YLR089C5921281013e-04
AEL170C4582271004e-04
KLLA0F19162g528201950.002
Scas_693.9497124910.005
Sklu_2129.238481673.3
AFR022C51474665.5
YDR150W (NUM1)2748124665.7
KLLA0F17930g166483649.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_47.17462
         (485 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_47.17462                                                        1015   0.0  
AGR167W [4478] [Homologous to ScYGL202W (ARO8) - NSH] complement...   554   0.0  
KLLA0A04906g 437523..438965 similar to sp|P53090 Saccharomyces c...   540   0.0  
Sklu_2253.2 YGL202W, Contig c2253 1349-2845                           508   e-178
Kwal_47.18982                                                         502   e-175
YGL202W (ARO8) [1793] chr7 (116061..117563) Aromatic amino acid ...   495   e-172
CAGL0G01254g 119281..120795 highly similar to sp|P53090 Saccharo...   495   e-172
Scas_712.48                                                           494   e-172
KLLA0F10021g 926569..928062 similar to sp|P53090 Saccharomyces c...   486   e-169
AFR548C [3740] [Homologous to ScYGL202W (ARO8) - SH] (1421841..1...   458   e-158
YHR137W (ARO9) [2424] chr8 (375710..377251) Aromatic amino acid ...   208   5e-61
Sklu_2392.1 YHR137W, Contig c2392 2001-3593                           206   2e-60
Scas_697.11                                                           204   9e-60
KLLA0D11110g 948248..949840 similar to sp|P38840 Saccharomyces c...   204   3e-59
Kwal_33.14582                                                         197   4e-57
CAGL0G06028g complement(579261..580874) similar to sp|P38840 Sac...   189   7e-54
AGR141C [4452] [Homologous to ScYER152C - SH] (1013962..1015278)...    56   4e-08
Kwal_14.2574                                                           55   5e-08
CAGL0J05126g complement(484849..486150) highly similar to sp|P47...    54   1e-07
Scas_555.7                                                             54   2e-07
Scas_711.52                                                            53   3e-07
CAGL0I06578g 637311..638621 similar to sp|P10356 Saccharomyces c...    52   5e-07
YJL060W (BNA3) [2851] chr10 (323302..324636) Protein predicted t...    52   5e-07
CAGL0L12254g complement(1324815..1326539) similar to sp|P52893 S...    51   1e-06
KLLA0F01617g complement(154025..155359) highly similar to sp|P47...    51   1e-06
KLLA0E00935g 101430..102767 similar to sp|P10356 Saccharomyces c...    50   3e-06
YER152C (YER152C) [1581] chr5 complement(472652..473983) Protein...    49   8e-06
Sklu_2389.7 YJL060W, Contig c2389 13116-14459 reverse complement       47   2e-05
Scas_681.2                                                             46   6e-05
Kwal_56.23791                                                          45   1e-04
AGR085W [4395] [Homologous to ScYLR089C - SH; ScYDR111C - SH] co...    45   1e-04
Kwal_8.585                                                             44   2e-04
YDR111C (YDR111C) [960] chr4 complement(678235..679758) Protein ...    44   2e-04
YLR089C (YLR089C) [3504] chr12 complement(318238..320016) Putati...    44   3e-04
AEL170C [2336] [Homologous to ScYJL060W - SH] (318032..319408) [...    43   4e-04
KLLA0F19162g complement(1775240..1776826) similar to sp|P52893 S...    41   0.002
Scas_693.9                                                             40   0.005
Sklu_2129.2 YIL116W, Contig c2129 1164-2318                            30   3.3  
AFR022C [3214] [Homologous to ScYNL169C (PSD1) - SH] (481388..48...    30   5.5  
YDR150W (NUM1) [994] chr4 (755622..763868) Nuclear migration pro...    30   5.7  
KLLA0F17930g 1638931..1643925 similar to sgd|S0002548 Saccharomy...    29   9.6  

>Kwal_47.17462
          Length = 492

 Score = 1015 bits (2625), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 485/485 (100%), Positives = 485/485 (100%)

Query: 1   MTGEAAGKARDFSHLFSEEALRRKPSPIKTTMAYFQDPNIVFLGAGMPPSELFPIKSLSL 60
           MTGEAAGKARDFSHLFSEEALRRKPSPIKTTMAYFQDPNIVFLGAGMPPSELFPIKSLSL
Sbjct: 1   MTGEAAGKARDFSHLFSEEALRRKPSPIKTTMAYFQDPNIVFLGAGMPPSELFPIKSLSL 60

Query: 61  ELPKPPFVDGIGECKQTLQATIMKEQQDLLFEHDVPLARALQYGNSRGQKELVAYLKEHT 120
           ELPKPPFVDGIGECKQTLQATIMKEQQDLLFEHDVPLARALQYGNSRGQKELVAYLKEHT
Sbjct: 61  ELPKPPFVDGIGECKQTLQATIMKEQQDLLFEHDVPLARALQYGNSRGQKELVAYLKEHT 120

Query: 121 SLFHRIPYQDWDIITTTGSTQGWDASLRIFCNKGDTVLLEEYTYSSSVEAADAQGLNCIP 180
           SLFHRIPYQDWDIITTTGSTQGWDASLRIFCNKGDTVLLEEYTYSSSVEAADAQGLNCIP
Sbjct: 121 SLFHRIPYQDWDIITTTGSTQGWDASLRIFCNKGDTVLLEEYTYSSSVEAADAQGLNCIP 180

Query: 181 MPLDGEGIIPEKLEEMLINWSDLYPDIPMPKLLYTIPTGQNPTGCTLSDSRKPYIYHLAQ 240
           MPLDGEGIIPEKLEEMLINWSDLYPDIPMPKLLYTIPTGQNPTGCTLSDSRKPYIYHLAQ
Sbjct: 181 MPLDGEGIIPEKLEEMLINWSDLYPDIPMPKLLYTIPTGQNPTGCTLSDSRKPYIYHLAQ 240

Query: 241 KYDMIIIEDEPYYFLQMDQYEPEERRLEQPASRAMTHAEFIGSLGKSFLELDVEGRVVRL 300
           KYDMIIIEDEPYYFLQMDQYEPEERRLEQPASRAMTHAEFIGSLGKSFLELDVEGRVVRL
Sbjct: 241 KYDMIIIEDEPYYFLQMDQYEPEERRLEQPASRAMTHAEFIGSLGKSFLELDVEGRVVRL 300

Query: 301 DSVSKTFAPGCRMGWLVGSKHLLDNYWNLHEVSIQSTCGFAQSILGGILNRWGQGGYIDW 360
           DSVSKTFAPGCRMGWLVGSKHLLDNYWNLHEVSIQSTCGFAQSILGGILNRWGQGGYIDW
Sbjct: 301 DSVSKTFAPGCRMGWLVGSKHLLDNYWNLHEVSIQSTCGFAQSILGGILNRWGQGGYIDW 360

Query: 361 LIGIRQEYTVKRNTCLDLCRKYLPAQVVNVPAVTAGMFFMIYIDAKKHPGFLTTFNGDYL 420
           LIGIRQEYTVKRNTCLDLCRKYLPAQVVNVPAVTAGMFFMIYIDAKKHPGFLTTFNGDYL
Sbjct: 361 LIGIRQEYTVKRNTCLDLCRKYLPAQVVNVPAVTAGMFFMIYIDAKKHPGFLTTFNGDYL 420

Query: 421 LMEQHIYRKCVSAGVLVTCSSWFKVNDPSPHAHKSGTKQLAFRGTYASVQPEAMANGLEI 480
           LMEQHIYRKCVSAGVLVTCSSWFKVNDPSPHAHKSGTKQLAFRGTYASVQPEAMANGLEI
Sbjct: 421 LMEQHIYRKCVSAGVLVTCSSWFKVNDPSPHAHKSGTKQLAFRGTYASVQPEAMANGLEI 480

Query: 481 LGNVL 485
           LGNVL
Sbjct: 481 LGNVL 485

>AGR167W [4478] [Homologous to ScYGL202W (ARO8) - NSH]
           complement(1059796..1061334) [1539 bp, 512 aa]
          Length = 512

 Score =  554 bits (1428), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/484 (55%), Positives = 340/484 (70%), Gaps = 19/484 (3%)

Query: 8   KARDFSHLFSEEALRRKPSPIKTTMAYFQDPNIVFLGAGMPPSELFPIKSLSLELPKPPF 67
           KA+D  HL S EALRR+PSPIKTTMAYF +  +VFLGAGMPP+ELFPI ++S+E+P P  
Sbjct: 9   KAKDLRHLLSREALRRRPSPIKTTMAYFGEAGMVFLGAGMPPAELFPISAVSVEVPVP-- 66

Query: 68  VDGIGECKQTLQATIMKEQQDLLFEHDVPLARALQYGNSRGQKELVAYLKEHTSLFHRIP 127
               GE  QTL   I K   +  F  DVPL+RALQYGNSRGQ ELV +L++HT  FH++ 
Sbjct: 67  ----GEDGQTLVGRIPKGAGEREFARDVPLSRALQYGNSRGQSELVEFLRQHTEKFHKLR 122

Query: 128 YQDWDIITTTGSTQGWDASLRIFCNKGDTVLLEEYTYSSSVEAADAQGLNCIPMPLDGEG 187
           Y DWD++ T GSTQ WDA++R+FCN+GD+V++E +TYSSSVEAA+AQGL C+ M +D EG
Sbjct: 123 YADWDVLVTAGSTQAWDATMRLFCNEGDSVVMEAFTYSSSVEAAEAQGLYCVGMEVDSEG 182

Query: 188 IIPEKLEEMLINWSDLYPDIPMPKLLYTIPTGQNPTGCTLSDSRKPYIYHLAQKYDMIII 247
           I+PE+L E+L  W   +     P++LYTIPTGQNP G TL D+RK  IY LAQ+YDM+I+
Sbjct: 183 IVPERLAELLAEWDTQHAGHARPRVLYTIPTGQNPMGSTLVDARKAQIYRLAQQYDMLIV 242

Query: 248 EDEPYYFLQMDQYEP------EERRLEQPASRAMTHAEFIGSLGKSFLELDVEGRVVRLD 301
           ED+PYYFLQMD Y+       E     + A RA  HA F  SL +SFL+ D +GRVVRL+
Sbjct: 243 EDDPYYFLQMDAYDAAGPRGIEAYEGARAALRA-DHARFASSLSRSFLDWDTDGRVVRLE 301

Query: 302 SVSKTFAPGCRMGWLVGSKHLLDNYWNLHEVSIQSTCGFAQSILGGILNRWGQGGYIDWL 361
           S SK FAPGCR GW+VG++ LLD YW L EVS+QSTCGFAQ+IL G+LNRWGQ  Y +WL
Sbjct: 302 STSKVFAPGCRTGWIVGARALLDQYWYLQEVSVQSTCGFAQAILSGMLNRWGQDRYTNWL 361

Query: 362 IGIRQEYTVKRNTCLDLCRKYLPAQVVNVPAVTAGMFFMIYIDAKKHPGFLTTFNGDYLL 421
           I +R EYT +R+ CLD C KYLP   V+V    AGMFFM+ +DA  HPGF + F+     
Sbjct: 362 IDLRLEYTARRDHCLDCCHKYLP-DFVHVEPPQAGMFFMLVLDAALHPGFASDFSSSPQR 420

Query: 422 MEQHIYRKCVSAGVLVTCSSWFKVNDPSPHAHKSGTKQLAFRGTYASVQPEAMANGLEIL 481
           +E H+Y   +  GVL+ C SWF VN  SP    S    + FRGTYA+V P +M  G++ +
Sbjct: 421 LETHLYDTFIKNGVLLACGSWFAVNR-SP----SKGTSIYFRGTYAAVDPASMEAGIKCI 475

Query: 482 GNVL 485
              L
Sbjct: 476 AQTL 479

>KLLA0A04906g 437523..438965 similar to sp|P53090 Saccharomyces
           cerevisiae YGL202w ARO8 aromatic amino acid
           aminotransferase I, start by similarity
          Length = 480

 Score =  540 bits (1390), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/486 (54%), Positives = 340/486 (69%), Gaps = 13/486 (2%)

Query: 1   MTGEAAGKARDFSHLFSEEALRRKPSPIKTTMAYFQDPNIVFLGAGMPPSELFPIKSLSL 60
           MT +  G   +  HL S+EA  RK SPIKTTM YF DPNIVFLGAGMP   +FP +S+S 
Sbjct: 1   MTVKDMGCRTNVLHLLSDEAKIRKASPIKTTMKYFSDPNIVFLGAGMPSGNMFPFESISF 60

Query: 61  ELPKPPFVDGIGECKQTLQATIMKEQQDLLFEHDVPLARALQYGNSRGQKELVAYLKEHT 120
           +      V+G G     ++  I +++ DL    DVPL  ALQYGNSRGQ EL+++LKEHT
Sbjct: 61  KSVSLDDVNGTG----AVEGCIHRDKSDLEICQDVPLGVALQYGNSRGQPELISFLKEHT 116

Query: 121 SLFHRIPYQDWDIITTTGSTQGWDASLRIFCNKGDTVLLEEYTYSSSVEAADAQGLNCIP 180
           S+FH I   DWD+ITT GSTQ WDA LR+FCN+G+TVL+EEYTYSSS+EAA AQGLNC+ 
Sbjct: 117 SIFHNISINDWDLITTAGSTQAWDACLRLFCNRGETVLMEEYTYSSSLEAAVAQGLNCVA 176

Query: 181 MPLDGEGIIPEKLEEMLINWSDLYPDIPMPKLLYTIPTGQNPTGCTLSDSRKPYIYHLAQ 240
           M +D +GI  +KL EML +W D+    P PKLLYTIP G NPTGCTL + RKP +  LA 
Sbjct: 177 MKMDKDGIKVDKLSEMLRDW-DVAVQGPFPKLLYTIPNGHNPTGCTLHEERKPELVRLAS 235

Query: 241 KYDMIIIEDEPYYFLQMDQYEPEERRLEQPASRAMTHAE-FIGSLGKSFLELDVEGRVVR 299
           +YD IIIED+PYYFLQM+++   E  +    +      E F+  LG+S LE D  GR++R
Sbjct: 236 QYDFIIIEDDPYYFLQMNEFGAPELNVPGDVNEMQWFKENFVNKLGRSLLEWDDVGRIIR 295

Query: 300 LDSVSKTFAPGCRMGWLVGSKHLLDNYWNLHEVSIQSTCGFAQSILGGILNRWGQGGYID 359
           L+SVSKTFAPGCR+GW +G ++LLD+ WN HEVS+QSTCGFAQ+++ G+  RWGQ GY+ 
Sbjct: 296 LESVSKTFAPGCRLGWAIGPRYLLDHLWNYHEVSMQSTCGFAQTLINGMFQRWGQIGYMK 355

Query: 360 WLIGIRQEYTVKRNTCLDLCRKYLPAQVVNVPAVTAGMFFMIYIDAKKHPGFLTTFNGDY 419
           WL+ +R  Y++KR+ CL  C+KYLP +V ++    +GMFFM+YID  KHP F   F    
Sbjct: 356 WLLRLRNSYSMKRDHCLTQCQKYLPNEVCSINLPISGMFFMVYIDPHKHPKFEREFKSKV 415

Query: 420 LLMEQHIYRKCVSAGVLVTCSSWFKVNDPSPHAHKSGTKQLAFRGTYASVQPEAMANGLE 479
            L+E+H+Y   V  G+L+ CSSWF+V DP+ +      K LAFRG+YASV  E M NG+ 
Sbjct: 416 DLLEEHLYNSFVQNGMLLACSSWFRV-DPNHN------KILAFRGSYASVDAEKMQNGII 468

Query: 480 ILGNVL 485
           +LGNV+
Sbjct: 469 MLGNVI 474

>Sklu_2253.2 YGL202W, Contig c2253 1349-2845
          Length = 498

 Score =  508 bits (1309), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 254/494 (51%), Positives = 334/494 (67%), Gaps = 24/494 (4%)

Query: 8   KARDFSHLFSEEALRRKPSPIKTTMAYFQDPNIVFLGAGMPPSELFPIKSLSLELPKPPF 67
           +++DFSHLFS+E   RKPSP+KT +  FQDPNI+FLG G+P S+ FP   ++ E P PPF
Sbjct: 5   ESKDFSHLFSDETNARKPSPLKTCIHLFQDPNIIFLGGGLPMSDYFPWDKVTAESPLPPF 64

Query: 68  VDGIGE---------CKQTLQATIMKEQQDLLFEHDVPLARALQYGNSRGQKELVAYLKE 118
            +GIG          C  T++   + +  D     D+ LARALQYG S+GQ EL+ ++++
Sbjct: 65  ANGIGAVPSGGDEDTCHLTIRKNEITKAGD---SKDIHLARALQYGFSQGQPELMEFVRK 121

Query: 119 HTSLFHRIPYQDWDIITTTGSTQGWDASLRIFCNKGDTVLLEEYTYSSSVEAADAQGLNC 178
           HTSL H I Y DWD++ T G+T  W+++LR+FCN+GDT+L E Y++SSS+ AA+AQG+N 
Sbjct: 122 HTSLVHDIKYADWDVLATAGNTNAWESTLRVFCNRGDTILAEAYSFSSSLYAAEAQGVNV 181

Query: 179 IPMPLDGEGIIPEKLEEMLINWSDLYPDIPMPKLLYTIPTGQNPTGCTLSDSRKPYIYHL 238
            P+PLD  GIIPEKLE ++ NW+   P+ P PKLLYTIPTGQNPTG +LSD RK  IY +
Sbjct: 182 FPVPLDEFGIIPEKLESIMDNWN---PETPKPKLLYTIPTGQNPTGSSLSDDRKAKIYRI 238

Query: 239 AQKYDMIIIEDEPYYFLQMDQYEPEERRLEQPASRAMTHAEFIGSLGKSFLELDVEGRVV 298
           AQK++ IIIEDEPYYFLQM+ Y  +    E+      +H EFI SL KSF+ LD +GRVV
Sbjct: 239 AQKHNFIIIEDEPYYFLQMEPYVKDASAREKKTYS--SHDEFIQSLAKSFISLDTDGRVV 296

Query: 299 RLDSVSKTFAPGCRMGWLVGSKHLLDNYWNLHEVSIQSTCGFAQSILGGILNRWGQGGYI 358
           RLDS SK  APG R+GW+VGSK +L+ Y  LHE++IQ+  GF QS++ G LNRWGQ GY+
Sbjct: 297 RLDSFSKVLAPGTRLGWIVGSKKILEPYLRLHEMTIQAPSGFTQSLVAGTLNRWGQDGYV 356

Query: 359 DWLIGIRQEYTVKRNTCLDLCRKYLP-AQVVNVPAVTAGMFFMIYIDAKKHPGFLTTFNG 417
           DWLIG+R EYT KR+  +D   KYLP    + +    AGMFF I ID+  HP F TT+  
Sbjct: 357 DWLIGLRHEYTHKRDVAIDALYKYLPKGSFIKINPPIAGMFFTINIDSSAHPEFSTTYQS 416

Query: 418 DYLLMEQHIYRKCVSAGVLVTCSSWFKVND----PSPHAHKSGTK--QLAFRGTYASVQP 471
           +  L+E+ IY K VS GVLV    WFK +     P P   K   K  ++ FRGTYA+V  
Sbjct: 417 NPELVEKAIYEKVVSQGVLVVPGIWFKTDGETQPPQPKESKVVLKPNEIFFRGTYAAVPL 476

Query: 472 EAMANGLEILGNVL 485
           E +  G++ LG+ L
Sbjct: 477 EKLVQGVKRLGDAL 490

>Kwal_47.18982
          Length = 496

 Score =  502 bits (1293), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 249/494 (50%), Positives = 333/494 (67%), Gaps = 22/494 (4%)

Query: 7   GKARDFSHLFSEEALRRKPSPIKTTMAYFQDPNIVFLGAGMPPSELFPIKSLSLELPKPP 66
           G++RDFSHL+SEE   RK SP+KT +  FQDPNIVFLG G+P S+ FP  +L  E P PP
Sbjct: 4   GESRDFSHLYSEETKARKSSPLKTCIHLFQDPNIVFLGGGLPQSKYFPWDNLQAESPLPP 63

Query: 67  FVDGIGE-----CKQTLQATIMKEQ-QDLLFEHDVPLARALQYGNSRGQKELVAYLKEHT 120
           FV+GIGE        T    I K+         D+PL+RALQYG S GQ E +++++EHT
Sbjct: 64  FVNGIGETPSGDASDTCHIAIKKDGVSKAGSSTDIPLSRALQYGFSMGQPEFLSFVREHT 123

Query: 121 SLFHRIPYQDWDIITTTGSTQGWDASLRIFCNKGDTVLLEEYTYSSSVEAADAQGLNCIP 180
            L H++ Y DW+++ TTG+T  W+++LRIFCN+GDT+L E+YT+SSSV AA+AQG+N  P
Sbjct: 124 QLVHKMKYSDWNVLATTGNTGSWESTLRIFCNRGDTILAEQYTFSSSVYAAEAQGINVFP 183

Query: 181 MPLDGEGIIPEKLEEMLINWSDLYPDIPMPKLLYTIPTGQNPTGCTLSDSRKPYIYHLAQ 240
           +PLD +G+IPE+LE +L NW+   PD   PKLLYTIPTGQNPTG +LSD RK  IY +A+
Sbjct: 184 VPLDADGLIPERLEAILDNWN---PDTAKPKLLYTIPTGQNPTGSSLSDDRKVEIYRIAK 240

Query: 241 KYDMIIIEDEPYYFLQMDQYEPEERRLEQPASRAMTHAEFIGSLGKSFLELDVEGRVVRL 300
           K+D++IIEDEPYYFLQMD Y+ +  + ++  +   +  +F+ SL KSF+ LD EGRV+RL
Sbjct: 241 KHDLLIIEDEPYYFLQMDAYQKDVSQRKE--THFASQEDFVNSLAKSFISLDTEGRVLRL 298

Query: 301 DSVSKTFAPGCRMGWLVGSKHLLDNYWNLHEVSIQSTCGFAQSILGGILNRWGQGGYIDW 360
           DS SK   PG R+GW+VGSK +L  Y  LHE++IQ+  GF+Q+I+ G LNRWGQ G++DW
Sbjct: 299 DSFSKVLGPGTRLGWIVGSKKILQKYTQLHEMTIQNPSGFSQAIVAGTLNRWGQDGFLDW 358

Query: 361 LIGIRQEYTVKRNTCLDLCRKYL---PAQVVNVPAVTAGMFFMIYIDAKKHPGFLTTFNG 417
           L+G+R+EY  KR+  +D   KYL   PA  +N P   AGMFF +  DA  HP F T +  
Sbjct: 359 LVGLRREYNEKRDVAIDALYKYLPETPAFTINPP--IAGMFFTVNTDASAHPEFATKYQS 416

Query: 418 DYLLMEQHIYRKCVSAGVLVTCSSWFK----VNDPSPHAHK--SGTKQLAFRGTYASVQP 471
              L+EQ IY K +++GVLV    WFK     N P P   K       + FRGTYA+V  
Sbjct: 417 KPELVEQAIYEKVIASGVLVVPGVWFKATGDTNPPQPAESKLELDPNGIFFRGTYAAVPL 476

Query: 472 EAMANGLEILGNVL 485
           + +  G++  G  L
Sbjct: 477 DKLQEGIQRFGIAL 490

>YGL202W (ARO8) [1793] chr7 (116061..117563) Aromatic amino acid
           aminotransferase I [1503 bp, 500 aa]
          Length = 500

 Score =  495 bits (1275), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 243/494 (49%), Positives = 337/494 (68%), Gaps = 22/494 (4%)

Query: 8   KARDFSHLFSEEALRRKPSPIKTTMAYFQDPNIVFLGAGMPPSELFPIKSLSLELPKPPF 67
           +++DFS+LFS+E   RKPSP+KT +  FQDPNI+FLG G+P  + FP  +LS++ PKPPF
Sbjct: 5   ESKDFSYLFSDETNARKPSPLKTCIHLFQDPNIIFLGGGLPLKDYFPWDNLSVDSPKPPF 64

Query: 68  VDGIG---ECKQTLQATIMKEQQDLLFE--HDVPLARALQYGNSRGQKELVAYLKEHTSL 122
             GIG   + +  ++ T+ K+  D      +D+PL+RALQYG S GQ EL+ ++++HT +
Sbjct: 65  PQGIGAPIDEQNCIKYTVNKDYADKSANPSNDIPLSRALQYGFSAGQPELLNFIRDHTKI 124

Query: 123 FHRIPYQDWDIITTTGSTQGWDASLRIFCNKGDTVLLEEYTYSSSVEAADAQGLNCIPMP 182
            H + Y+DWD++ T G+T  W+++LR+FCN+GD +L+E +++SSS+ +A+AQG+   P+P
Sbjct: 125 IHDLKYKDWDVLATAGNTNAWESTLRVFCNRGDVILVEAHSFSSSLASAEAQGVITFPVP 184

Query: 183 LDGEGIIPEKLEEMLINWSDLYPDIPMPKLLYTIPTGQNPTGCTLSDSRKPYIYHLAQKY 242
           +D +GIIPEKL +++ NW+   P  P PKLLYTIPTGQNPTG +++D RK  IY +AQKY
Sbjct: 185 IDADGIIPEKLAKVMENWT---PGAPKPKLLYTIPTGQNPTGTSIADHRKEAIYKIAQKY 241

Query: 243 DMIIIEDEPYYFLQMDQY--EPEERRLEQPASRAMTHAEFIGSLGKSFLELDVEGRVVRL 300
           D +I+EDEPYYFLQM+ Y  + +ER   Q +S    H EF+ SL  +FL LD EGRV+R+
Sbjct: 242 DFLIVEDEPYYFLQMNPYIKDLKEREKAQ-SSPKQDHDEFLKSLANTFLSLDTEGRVIRM 300

Query: 301 DSVSKTFAPGCRMGWLVGSKHLLDNYWNLHEVSIQSTCGFAQSILGGILNRWGQGGYIDW 360
           DS SK  APG R+GW+ GS  +L  Y +LHE++IQ+  GF Q ++   L+RWGQ GY+DW
Sbjct: 301 DSFSKVLAPGTRLGWITGSSKILKPYLSLHEMTIQAPAGFTQVLVNATLSRWGQKGYLDW 360

Query: 361 LIGIRQEYTVKRNTCLDLCRKYLP---AQVVNVPAVTAGMFFMIYIDAKKHPGFLTTFNG 417
           L+G+R EYT+KR+  +D   KYLP   A V+N P   AGMFF + IDA  HP F T +N 
Sbjct: 361 LLGLRHEYTLKRDCAIDALYKYLPQSDAFVINPP--IAGMFFTVNIDASVHPEFKTKYNS 418

Query: 418 DYLLMEQHIYRKCVSAGVLVTCSSWFK----VNDPSPHAHK--SGTKQLAFRGTYASVQP 471
           D   +EQ +Y K V  GVLV   SWFK       P P   K  S    + FRGTYA+V P
Sbjct: 419 DPYQLEQSLYHKVVERGVLVVPGSWFKSEGETEPPQPAESKEVSNPNIIFFRGTYAAVSP 478

Query: 472 EAMANGLEILGNVL 485
           E +  GL+ LG+ L
Sbjct: 479 EKLTEGLKRLGDTL 492

>CAGL0G01254g 119281..120795 highly similar to sp|P53090
           Saccharomyces cerevisiae YGL202w ARO8, start by
           similarity
          Length = 504

 Score =  495 bits (1275), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 237/498 (47%), Positives = 334/498 (67%), Gaps = 25/498 (5%)

Query: 8   KARDFSHLFSEEALRRKPSPIKTTMAYFQDPNIVFLGAGMPPSELFPIKSLSLELPKPPF 67
           +++DF++ FSEE   RKPSP+KT + YF DPN++FLG G+P S  FP  +L+ + P PPF
Sbjct: 5   ESKDFTYFFSEETKARKPSPLKTCIQYFSDPNMIFLGGGLPMSAYFPWDNLAADTPLPPF 64

Query: 68  VDGIGEC-----KQTLQATIMKEQQDLLFEHDVPLARALQYGNSRGQKELVAYLKEHTSL 122
            +GIG       + T + ++ KE +  + E D+PLAR+LQYG S GQ EL  +LKEHT +
Sbjct: 65  TNGIGATITGSQEDTSKFSVKKESK--VHEGDIPLARSLQYGKSMGQPELTDFLKEHTKM 122

Query: 123 FHRIPYQDWDIITTTGSTQGWDASLRIFCNKGDTVLLEEYTYSSSVEAADAQGLNCIPMP 182
            H + Y DWD++ TTG+T  W+++LR+FCN+GD +L E +++SSS+ +A+AQG+   P+P
Sbjct: 123 IHDMKYSDWDVVATTGNTNAWESTLRVFCNRGDVILAEAHSFSSSLASAEAQGIITFPVP 182

Query: 183 LDGEGIIPEKLEEMLINWSDLYPDIPMPKLLYTIPTGQNPTGCTLSDSRKPYIYHLAQKY 242
           +D  GIIPEKLE +L NW++     P PKLLYTIPTGQNPTG +L+  RK  IY +AQK+
Sbjct: 183 IDAHGIIPEKLEALLDNWTE---GAPKPKLLYTIPTGQNPTGSSLNAERKKEIYRIAQKH 239

Query: 243 DMIIIEDEPYYFLQMDQYEPE-ERRLEQPASRA-MTHAEFIGSLGKSFLELDVEGRVVRL 300
           D +IIEDEPYYFLQ+ +Y  +  +R E     A ++H +F+ SL  +FL +D +GRV+R+
Sbjct: 240 DFLIIEDEPYYFLQVGEYISDLSKRAEVAQKNANISHEDFLKSLALTFLSVDTDGRVIRM 299

Query: 301 DSVSKTFAPGCRMGWLVGSKHLLDNYWNLHEVSIQSTCGFAQSILGGILNRWGQGGYIDW 360
           DS SK  APG R+GW+ GS  LL  Y +LHE++IQS  GF+QS++ G LNRWGQ GYIDW
Sbjct: 300 DSFSKVLAPGTRLGWITGSSKLLQAYLSLHEMTIQSPSGFSQSLVSGTLNRWGQKGYIDW 359

Query: 361 LIGIRQEYTVKRNTCLDLCRKYLPAQ-------VVNVPAVTAGMFFMIYIDAKKHPGFLT 413
           LIG+R EYT KR+ C+D   K++P         +  +    AGMFF + +DA  HP F T
Sbjct: 360 LIGLRHEYTAKRDHCIDSLYKFIPKDNNKEGKPIFTINPPIAGMFFTVDMDASAHPEFAT 419

Query: 414 TFNGDYLLMEQHIYRKCVSAGVLVTCSSWFKVNDPSPHAHKSGTK------QLAFRGTYA 467
           T+  D   +E+ +Y+K + +GVLV    WFK +  +  A  + +K      Q+ FRGTYA
Sbjct: 420 TYESDPTKVEEALYQKVIKSGVLVVPGIWFKADGETTPAQPASSKENPNPNQIFFRGTYA 479

Query: 468 SVQPEAMANGLEILGNVL 485
           +V+P  +  GL+ LG  L
Sbjct: 480 AVEPSKLDEGLKRLGQCL 497

>Scas_712.48
          Length = 497

 Score =  494 bits (1273), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 240/498 (48%), Positives = 331/498 (66%), Gaps = 31/498 (6%)

Query: 8   KARDFSHLFSEEALRRKPSPIKTTMAYFQDPNIVFLGAGMPPSELFPIKSLSLELPKPPF 67
           +++DFSHL+S+E   RKPSP+KT +  FQDPNI+FLG G+P S+ FP  ++S++ P PPF
Sbjct: 5   ESKDFSHLYSDETNARKPSPLKTCIHLFQDPNIIFLGGGLPLSDYFPWDNVSIDSPAPPF 64

Query: 68  VDGIGE----------CKQTLQATIMKEQQDLLFEHDVPLARALQYGNSRGQKELVAYLK 117
             GIG           CK  L+  +       + E D+PLAR+LQYG S+GQ EL+ +++
Sbjct: 65  TKGIGHPISELSNDEVCKVDLKKDVK------VHEGDIPLARSLQYGFSQGQPELLEFIR 118

Query: 118 EHTSLFHRIPYQDWDIITTTGSTQGWDASLRIFCNKGDTVLLEEYTYSSSVEAADAQGLN 177
           EH  L H + Y+DWD++ T G+T  W+++LR+FCN+GD +L E +++SS + AA AQG+ 
Sbjct: 119 EHNKLIHDMQYEDWDVVATAGNTNAWESTLRVFCNRGDVILAEAHSFSSCLAAAQAQGIT 178

Query: 178 CIPMPLDGEGIIPEKLEEMLINWSDLYPDIPMPKLLYTIPTGQNPTGCTLSDSRKPYIYH 237
             P+P+D +GIIP KLE +L NW+   P  P PKLLYTIPTGQNPTG +L+D RKP I+ 
Sbjct: 179 TFPVPIDDKGIIPAKLEAILDNWT---PGAPKPKLLYTIPTGQNPTGTSLADERKPEIFR 235

Query: 238 LAQKYDMIIIEDEPYYFLQMDQYEPE-ERRLEQPASRAMTHAEFIGSLGKSFLELDVEGR 296
           +AQK+D +IIED PYYFLQMD+YE + ++R    A    +H +F+ SL K+FL +D +GR
Sbjct: 236 IAQKHDFLIIEDAPYYFLQMDKYERDLQKRAVTRAQPRESHKDFLASLDKTFLSVDTDGR 295

Query: 297 VVRLDSVSKTFAPGCRMGWLVGSKHLLDNYWNLHEVSIQSTCGFAQSILGGILNRWGQGG 356
           V+RLDS SK  APG R+GW+ GSK +L  + +LHE++IQ+  GF QS++   L+RWGQ G
Sbjct: 296 VIRLDSFSKVLAPGSRLGWITGSKKILKPFVSLHEMTIQAPAGFIQSVVSSTLHRWGQSG 355

Query: 357 YIDWLIGIRQEYTVKRNTCLDLCRKYLP---AQVVNVPAVTAGMFFMIYIDAKKHPGFLT 413
           Y+DWL G+R EYT+KR+  +D   KY+P   A V+N P   AGMFF + IDA  HP F T
Sbjct: 356 YLDWLQGLRHEYTLKRDCAIDALHKYIPENKAFVINPP--IAGMFFTVNIDASTHPEFKT 413

Query: 414 TFNGDYLLMEQHIYRKCVSAGVLVTCSSWFKVND----PSPHAHK--SGTKQLAFRGTYA 467
            ++ D   +E  +Y K +S GVLV    WF        P P A K      ++ FRGTYA
Sbjct: 414 KYDSDPKKVEHALYEKVISRGVLVVPGDWFITEGDTVPPQPAASKERENPNEIFFRGTYA 473

Query: 468 SVQPEAMANGLEILGNVL 485
           +V PE +  GL+ LG  L
Sbjct: 474 AVSPEKLTEGLKRLGETL 491

>KLLA0F10021g 926569..928062 similar to sp|P53090 Saccharomyces
           cerevisiae YGL202w ARO8 aromatic amino acid
           aminotransferase I, start by similarity
          Length = 497

 Score =  486 bits (1252), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 242/495 (48%), Positives = 329/495 (66%), Gaps = 25/495 (5%)

Query: 7   GKARDFSHLFSEEALRRKPSPIKTTMAYFQDPNIVFLGAGMPPSELFPIKSLSLELPKPP 66
           G A+DFSHL+S+E   R PS +K+ + YF DPN++FLG G+P S+ FP  +L++E P PP
Sbjct: 4   GVAKDFSHLYSDETKSRMPSQLKSIIHYFNDPNLIFLGGGLPMSDYFPWDNLTVESPLPP 63

Query: 67  FVDGIG-----ECKQTLQATIMKEQQDLLFEHDVPLARALQYGNSRGQKELVAYLKEHTS 121
           F +GIG     +   T Q  I K  ++     D+PL+R+LQYG S+GQ E+  + KEH S
Sbjct: 64  FSNGIGAKPSGDDADTCQIHITKNLEESQKGVDIPLSRSLQYGYSQGQPEITKFFKEHHS 123

Query: 122 LFHRIPYQDWDIITTTGSTQGWDASLRIFCNKGDTVLLEEYTYSSSVEAADAQGLNCIPM 181
           L H + Y++WD++ T G+T  W++ LRIFCN+GDT+L E++ +SSS+ AA+AQG+N  P+
Sbjct: 124 LIHDMKYENWDVLATIGNTGAWESVLRIFCNRGDTILAEQFAFSSSISAAEAQGVNVFPI 183

Query: 182 PLDGEGIIPEKLEEMLINWSDLYPDIPMPKLLYTIPTGQNPTGCTLSDSRKPYIYHLAQK 241
           PLD  GIIP KLE +L NW++       PKLLYT+PTGQNPTG +LS  RK  IY +AQK
Sbjct: 184 PLDEHGIIPSKLETILDNWTE---GAAKPKLLYTVPTGQNPTGSSLSFDRKEEIYRIAQK 240

Query: 242 YDMIIIEDEPYYFLQMDQYEPEERRLEQPASRAMT----HAEFIGSLGKSFLELDVEGRV 297
           +D IIIEDEPYYFLQM++YE      + PA+R +     H EFI +L KSF+ +D EGRV
Sbjct: 241 HDFIIIEDEPYYFLQMEKYE------KDPANRVVKSYADHKEFIQNLEKSFVSIDTEGRV 294

Query: 298 VRLDSVSKTFAPGCRMGWLVGSKHLLDNYWNLHEVSIQSTCGFAQSILGGILNRWGQGGY 357
           +RLDS+SK  APG R GW+VG+K +L    +L E++IQ+  GF QSI+ G +NRWGQ GY
Sbjct: 295 LRLDSLSKVLAPGTRFGWIVGAKDILARILSLQEMTIQAPAGFTQSIIAGTMNRWGQEGY 354

Query: 358 IDWLIGIRQEYTVKRNTCLDLCRKYLP-AQVVNVPAVTAGMFFMIYIDAKKHPGFLTTFN 416
           +DWLIG+R EYT KR+ C+D   KYLP    + +    AGMFF + IDA KHP F T + 
Sbjct: 355 LDWLIGLRHEYTKKRDCCIDALYKYLPQVDYIKINPPIAGMFFTVNIDASKHPEFATKYG 414

Query: 417 GDYLLMEQHIYRKCVSAGVLVTCSSWFK----VNDPSPHAHKSGTK--QLAFRGTYASVQ 470
            D   +E+ I+ + +++GVLV   +WFK       P P A     K  ++ FRGTYA+V 
Sbjct: 415 SDPEKVEKAIFDRSIASGVLVVPGNWFKSQGQTTPPQPEASFKSEKPNEIFFRGTYAAVP 474

Query: 471 PEAMANGLEILGNVL 485
            + M  GL   G+ L
Sbjct: 475 LDKMTVGLHRFGDGL 489

>AFR548C [3740] [Homologous to ScYGL202W (ARO8) - SH]
           (1421841..1423334) [1494 bp, 497 aa]
          Length = 497

 Score =  458 bits (1178), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 227/482 (47%), Positives = 319/482 (66%), Gaps = 8/482 (1%)

Query: 9   ARDFSHLFSEEALRRKPSPIKTTMAYFQDPNIVFLGAGMPPSELFPIKSLSLELPKPPFV 68
           A+DFS+ FSEE   R PSP+KT + Y+ DP+I+FLG G+P SELFP  S+S     PPF 
Sbjct: 8   AQDFSYKFSEETKARIPSPLKTCLRYYNDPDIIFLGGGLPRSELFPWDSVSASCAAPPFK 67

Query: 69  DGIGECKQTLQATIMKEQQDLLF-EHDVPLARALQYGNSRGQKELVAYLKEHTSLFHRIP 127
            G     Q   A   +    ++    DVPL RALQYG S+GQ EL+ +++EHT   HR+ 
Sbjct: 68  TGTAGGMQLHVAKSGQSANAVVSGARDVPLERALQYGFSQGQPELMDFVREHTRRLHRMQ 127

Query: 128 YQDWDIITTTGSTQGWDASLRIFCNKGDTVLLEEYTYSSSVEAADAQGLNCIPMPLDGEG 187
           Y DWD++ T G+T  W+++LR+FCN+GDT+L EEYT+SSS+ AA+AQG+   P+PLD  G
Sbjct: 128 YADWDVLATVGNTSAWESTLRVFCNRGDTILAEEYTFSSSLVAAEAQGVRAYPVPLDENG 187

Query: 188 IIPEKLEEMLINWSDLYPDIPMPKLLYTIPTGQNPTGCTLSDSRKPYIYHLAQKYDMIII 247
           ++PE+L E+L NW   +  +P PKLLYT+PTGQNPTG  LS+ R+  +Y LAQ++D++I+
Sbjct: 188 MVPERLGELLDNWERWHDGVPRPKLLYTVPTGQNPTGTCLSNDRRQAVYRLAQQHDLLIV 247

Query: 248 EDEPYYFLQMDQYEPEERRLEQPASRAM-THAEFIGSLGKSFLELDVEGRVVRLDSVSKT 306
           EDEPYYFLQ+D YE +  R    A R   +H EF+GSL +SFL LD +GRV+RLDS SK 
Sbjct: 248 EDEPYYFLQLDPYEADAGRR---APRVFASHEEFVGSLVRSFLSLDTDGRVLRLDSFSKV 304

Query: 307 FAPGCRMGWLVGSKHLLDNYWNLHEVSIQSTCGFAQSILGGILNRWGQGGYIDWLIGIRQ 366
            APG R+GW+ G+K LL  Y  L E+++Q+  GF  S++ G L RWGQ  YIDWLI +R+
Sbjct: 305 LAPGTRLGWIAGAKQLLQAYLALLELTVQAPSGFTSSLIAGTLTRWGQEHYIDWLIELRR 364

Query: 367 EYTVKRNTCLDLCRKYLPAQ-VVNVPAVTAGMFFMIYIDAKKHPGFLTTFNGDYLLMEQH 425
           EYT  R+  +D   +Y+PA+  V V    AGMFF ++++A  HP F++ +      +E  
Sbjct: 365 EYTHLRDVVMDALHRYIPAKPWVRVNPTEAGMFFTVHLNAAAHPRFVSEYESQPERVEWA 424

Query: 426 IYRKCVSAGVLVTCSSWFKV--NDPSPHAHKSGTKQLAFRGTYASVQPEAMANGLEILGN 483
           +Y K ++ GVL     WF+    DPS       T  + FRGT+A+V+ + +  G++ LG+
Sbjct: 425 LYEKMIAHGVLAVPGMWFRTGGKDPSRSRQAGDTNNIFFRGTFAAVEEDKLVVGIQRLGS 484

Query: 484 VL 485
           +L
Sbjct: 485 ML 486

>YHR137W (ARO9) [2424] chr8 (375710..377251) Aromatic amino acid
           aminotransferase II [1542 bp, 513 aa]
          Length = 513

 Score =  208 bits (529), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 124/396 (31%), Positives = 208/396 (52%), Gaps = 36/396 (9%)

Query: 39  NIVFLGAGMPPSELFPIKSLSLELPKPPFVDGIGECKQTLQATIMKEQQDLLFEHDVPLA 98
           +++ L  GMP    FPI+S+ L++ K PF D           +      DL    ++P+A
Sbjct: 43  DVIELAGGMPNERFFPIESMDLKISKVPFNDN-----PKWHNSFTTAHLDLGSPSELPIA 97

Query: 99  RALQYGNSRGQKELVAYLKEHTSLFHRIPYQD-----WDIITTTGSTQGWDASLRIFCNK 153
           R+ QY  ++G   L+ ++K+  S  +R  + D     WD+I + GS           C++
Sbjct: 98  RSFQYAETKGLPPLLHFVKDFVSRINRPAFSDETESNWDVILSGGSNDSMFKVFETICDE 157

Query: 154 GDTVLLEEYTYSSSVEAADAQGLNCIPMPLD------GEGIIPEKLEEMLINWSD-LYPD 206
             TV++EE+T++ ++   +A G   IP+ ++       +GI  E L ++L NWS   Y D
Sbjct: 158 STTVMIEEFTFTPAMSNVEATGAKVIPIKMNLTFDRESQGIDVEYLTQLLDNWSTGPYKD 217

Query: 207 IPMPKLLYTIPTGQNPTGCTLSDSRKPYIYHLAQKYDMIIIEDEPYYFLQMDQYEPEERR 266
           +  P++LYTI TGQNPTG ++   ++  IY LAQ++D +I+ED+PY +L    Y P+E  
Sbjct: 218 LNKPRVLYTIATGQNPTGMSVPQWKREKIYQLAQRHDFLIVEDDPYGYLYFPSYNPQE-P 276

Query: 267 LEQP-ASRAMTHAEFIGS-LGKSFLELDVEGRVVRLDSVSKTFAPGCRMGWLVGSKHLLD 324
           LE P  S  +T   ++   L KSFL LD + RV+RL++ SK FAPG R+ ++V +K LL 
Sbjct: 277 LENPYHSSDLTTERYLNDFLMKSFLTLDTDARVIRLETFSKIFAPGLRLSFIVANKFLLQ 336

Query: 325 NYWNLHEVSIQSTCGFAQSILGGILNRWGQG--------------GYIDWLIGIRQEYTV 370
              +L +++ ++  G +Q+I+   +    +               G+I W++ I  +Y  
Sbjct: 337 KILDLADITTRAPSGTSQAIVYSTIKAMAESNLSSSLSMKEAMFEGWIRWIMQIASKYNH 396

Query: 371 KRNTCLDLCRKYLPAQV--VNVPAVTAGMFFMIYID 404
           ++N  L    +    Q     V   +AGMF +I I+
Sbjct: 397 RKNLTLKALYETESYQAGQFTVMEPSAGMFIIIKIN 432

>Sklu_2392.1 YHR137W, Contig c2392 2001-3593
          Length = 530

 Score =  206 bits (525), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 142/476 (29%), Positives = 239/476 (50%), Gaps = 59/476 (12%)

Query: 38  PNIVFLGAGMPPSELFPIKSLSLELPKPPF-------------VDGIGECKQTLQATIMK 84
           P+ + L AGMP   LFP++S+ + +   PF              D + +  +  +A  +K
Sbjct: 43  PSPIELAAGMPNEGLFPVESIHMNVVSKPFQHRSYPTKSRLLHKDTLEDDPEFDEAEFIK 102

Query: 85  EQQD-----LLFEHD------VPLARALQYGNSRGQKELVAYLKEHTSLFHRIPYQDWDI 133
            + D      ++ +D      + +ARA QY  +RG   +V + K+    F+   Y +WD+
Sbjct: 103 SKIDDGSMVNIWRYDPCKPDRLSIARAFQYSETRGLPSVVEFSKKIVKRFNPPAYDNWDV 162

Query: 134 ITTTGSTQGWDASLRIFCNKGDTVLLEEYTYSSSVEAADAQGLNCIPMPLD------GEG 187
           +   GS+          C++G TVL+EE+T+S ++    A G   +P+ ++       +G
Sbjct: 163 LLANGSSDSLFKIFETLCDEGVTVLMEEFTFSPTIFNVTASGGKVVPIKVEITHDPETQG 222

Query: 188 IIPEKLEEMLINWS-DLYPDIPMPKLLYTIPTGQNPTGCTLSDSRKPYIYHLAQKYDMII 246
           I  + L ++L NW    Y  +  P++LYTI TGQNPTG TLS  ++  IY LA+ ++ II
Sbjct: 223 IDVQYLCDLLENWEVGPYKHLSKPRVLYTIATGQNPTGMTLSPEKRKAIYELAETHNFII 282

Query: 247 IEDEPYYFLQMDQYEPEERRLEQPASRAMTHAEFIGS-LGKSFLELDVEGRVVRLDSVSK 305
           +ED+PY +L+   Y+PE+       S  +T   +    LG SF+ +D  G V+RL++ SK
Sbjct: 283 VEDDPYGYLKFPAYDPEDPLKNPYKSGEITPDIYCNQVLGNSFITIDTSGTVLRLETYSK 342

Query: 306 TFAPGCRMGWLVGSKHLLDNYWNLHEVSIQSTCGFAQSILGGILNRWGQ------GGYID 359
            F PG R+ ++VG+K L+D    L EVS ++  G +Q+IL  I  +W Q       G+ +
Sbjct: 343 LFFPGLRLSFIVGNKFLIDTLAELSEVSSRAPSGTSQAILNNITQKWCQDYGDEVDGWTN 402

Query: 360 WLIGIRQEYTVKRNTCLD--LCRKYLPAQVVNVPAVTAGMFFMIYI--------DAKKHP 409
           W++ + +EYT +RN   +  L        + ++   +AGMF  I I        DA+ H 
Sbjct: 403 WIMSVAEEYTHRRNVLFEALLSTDAYKKGLFSLLEPSAGMFVSIEILLDKLVKLDAEDHL 462

Query: 410 GFLTTFNGDYLLMEQHI-----YRKCVSAGVLVTCSSWFKVNDPSPHAHKSGTKQL 460
             +   N  Y L+E+ +     YR  V        S++ +V     +A+ +  +QL
Sbjct: 463 KAMDFLN--YRLIEEGVSTVLGYRLAVCKKFSYDRSNFLRVT----YAYAASDEQL 512

>Scas_697.11
          Length = 510

 Score =  204 bits (520), Expect = 9e-60,   Method: Compositional matrix adjust.
 Identities = 118/393 (30%), Positives = 212/393 (53%), Gaps = 32/393 (8%)

Query: 37  DPNIVFLGAGMPPSELFPIKSLSLELPKPPFVDGIGECKQTLQATIMKEQQDLLFEHDVP 96
           DPN + +  GMP    FPI+S++L++   P  +     ++T+   I KE        ++P
Sbjct: 50  DPNSIQMSGGMPNEGFFPIESINLKISNTPHFEK--SERKTVTTNISKETP-----VELP 102

Query: 97  LARALQYGNSRGQKELVAYLKEHTS-LFHRIPYQD--WDIITTTGSTQGWDASLRIFCNK 153
           L++++QY  +RG   L+ +++     + +  PY+D  W+++   GS+          C++
Sbjct: 103 LSKSMQYSETRGLNPLLDFIRYFIKWIGNSPPYEDSLWEVMLANGSSDSMFKVFETLCDE 162

Query: 154 GDTVLLEEYTYSSSVEAADAQGLNCIPMPLD----GEGIIPEKLEEMLINWSD-LYPDIP 208
            DTVL+EE+T+   +    A G  CIP+ ++     +GI  + L  +L NW +  Y  + 
Sbjct: 163 SDTVLMEEFTFVPVISNVMATGAKCIPIKVNLNYEDQGIDIDYLSNLLNNWKEGPYKHLS 222

Query: 209 MPKLLYTIPTGQNPTGCTLSDSRKPYIYHLAQKYDMIIIEDEPYYFLQMDQYEPEERRLE 268
            PK+LYTI TGQNP G TLS  ++  IY +AQ++D+II+ED+PY +L   +++P+++   
Sbjct: 223 KPKILYTISTGQNPMGMTLSMEKREKIYQIAQQHDLIILEDDPYTYLTFPKFDPQDKFNN 282

Query: 269 QPASRAMTHAEFIGS-LGKSFLELDVEGRVVRLDSVSKTFAPGCRMGWLVGSKHLLDNYW 327
              +   T  E++ +   KSF+ LD +GRV+RL++ SK FAPG R+ +++ +K LL+ + 
Sbjct: 283 PYENPNFTIKEYLQNHFTKSFITLDNDGRVIRLETFSKLFAPGLRLSFIIANKFLLEKFV 342

Query: 328 NLHEVSIQSTCGFAQSILGGILNRWG--------------QGGYIDWLIGIRQEYTVKRN 373
           +  E+S ++  G +Q+I+   +                     ++ W+I I + YT +RN
Sbjct: 343 DFSELSSRAPSGTSQAIVYSTVKALTTTRANNEKPDLEQMSKAWLSWIIQIAKHYTNRRN 402

Query: 374 TCLDLC--RKYLPAQVVNVPAVTAGMFFMIYID 404
             L           ++ +V   +AGMF  + I+
Sbjct: 403 ITLSTLYESNAYKKKLFSVIEPSAGMFINLKIN 435

>KLLA0D11110g 948248..949840 similar to sp|P38840 Saccharomyces
           cerevisiae YHR137w ARO9 aromatic amino acid
           aminotransferase II, start by similarity
          Length = 530

 Score =  204 bits (518), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 125/412 (30%), Positives = 216/412 (52%), Gaps = 44/412 (10%)

Query: 38  PNIVFLGAGMPPSELFPIKSLSLELPKPPF-------------VDGIGECKQTLQATIMK 84
           PN   L AGMP   LFP++S+ + + + PF             V   GE     +A  +K
Sbjct: 43  PNPYVLAAGMPNEGLFPVESVHVNVVERPFQHLEYPFKSEKIHVGAAGEIGVN-EAEYVK 101

Query: 85  EQQDL-----LFEHD------VPLARALQYGNSRGQKELVAYLKEHTSLFHRIPYQDWDI 133
            + D      ++ +D      +P+A+ALQY +++G  +L+ + K+  S  ++  Y +WD+
Sbjct: 102 SRVDDGSMVDIWRYDPSHGDNIPIAQALQYSDTKGFPQLIDFSKKLVSYLNKPAYDNWDV 161

Query: 134 ITTTGSTQGWDASLRIFCNKGDTVLLEEYTYSSSVEAADAQGLNCIPMPLD------GEG 187
           +   GS+           ++  TVL+EE+T++ ++    A G   IP+ +D       +G
Sbjct: 162 MLANGSSDSLSKVFTTLTDEDVTVLMEEFTFTPTISNVTANGGIPIPLKVDITDDASQQG 221

Query: 188 IIPEKLEEMLINWSD-LYPDIPMPKLLYTIPTGQNPTGCTLSDSRKPYIYHLAQKYDMII 246
           I  E ++++L NWS   Y  +  P+LLYTI TGQNPTG T    ++  IY L +K+D+II
Sbjct: 222 INVEYMDQLLENWSTGEYSHLSKPRLLYTIVTGQNPTGMTQCKEKRQKIYDLCEKHDIII 281

Query: 247 IEDEPYYFLQMDQYEPEERRLEQPASRAMTHAEFIGS-LGKSFLELDVEGRVVRLDSVSK 305
           +ED+PY +L+   ++  +    Q     +T  ++    L  S+L +D  GRV+RL++ SK
Sbjct: 282 VEDDPYGYLKFLPFDKSDPLKNQYNDGTITFDKYCKEILAPSYLTIDTSGRVIRLETFSK 341

Query: 306 TFAPGCRMGWLVGSKHLLDNYWNLHEVSIQSTCGFAQSILGGILNRWGQG-------GYI 358
            FAPG R+ ++V +K +LD      ++S++S CG AQ++   I+++W +         ++
Sbjct: 342 VFAPGMRLSFIVANKFILDKLLKYADISVRSPCGLAQAMTINIIDKWAENFNGDKVRAWL 401

Query: 359 DWLIGIRQEYTVKRNTCLDLCRKYLPA---QVVNVPAVTAGMFFMIYIDAKK 407
            W++ +  EYT +RN          PA   ++  +   +AGMF  I I+  K
Sbjct: 402 SWVMKVAGEYTHRRNVLFQALEA-TPAYKEELFELIEPSAGMFISIKINFDK 452

>Kwal_33.14582
          Length = 525

 Score =  197 bits (502), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 124/408 (30%), Positives = 205/408 (50%), Gaps = 42/408 (10%)

Query: 38  PNIVFLGAGMPPSELFPIKSLSLELPKPPF-VDGIGECKQTLQATIMKEQQDL------- 89
           P  + L AG+P    FP++SL L +   PF +         L   + K   +        
Sbjct: 37  PKPIDLSAGLPNEGFFPLESLHLNVVDEPFQLTPCDANSHKLHQGVPKTGSEFDEREFVT 96

Query: 90  ----------LFEHD------VPLARALQYGNSRGQKELVAYLKEHTSLFHRIPYQDWDI 133
                     ++ +D      +PL+RALQY  +RG   L+ + K+  S  +   Y DWD+
Sbjct: 97  RKIDSGSMVDVWRYDPDAPSVIPLSRALQYTATRGMPPLIDFCKDFISYVNPPAYADWDL 156

Query: 134 ITTTGSTQGWDASLRIFCNKGDTVLLEEYTYSSSVEAADAQGLNCIPMPLD------GEG 187
               G++          C++G+ VL+EE+T++ ++    A G   +P+ L+       +G
Sbjct: 157 TLANGTSDSLFKIFETLCDQGEAVLVEEFTFAPTLSNIRAAGGVPVPVKLNISADPQVQG 216

Query: 188 IIPEKLEEMLINW-SDLYPDIPMPKLLYTIPTGQNPTGCTLSDSRKPYIYHLAQKYDMII 246
           I    L E+L NW    Y  +  PKLLYTIPTGQNPTG TLS  ++  IY LA+K+D II
Sbjct: 217 IDIGHLTELLDNWVQGPYAHLSRPKLLYTIPTGQNPTGMTLSREKRQQIYDLAEKHDFII 276

Query: 247 IEDEPYYFLQMDQYEPEERRLEQPASRAMTHAEFIGS-LGKSFLELDVEGRVVRLDSVSK 305
           +ED+PY +L+  QY+P         S   +  E+    L  SF+ +D   RV+R ++ SK
Sbjct: 277 VEDDPYGYLKFPQYDPANPDYNPYESHTYSIDEYCHKVLSPSFITIDKSARVLRCETFSK 336

Query: 306 TFAPGCRMGWLVGSKHLLDNYWNLHEVSIQSTCGFAQSILGGILNRWG------QGGYID 359
            F+PG R+ ++VG+K L+    +  EVS ++  G +Q I+  ++ +W       Q  ++ 
Sbjct: 337 VFSPGLRLSFVVGNKFLISKIIDFAEVSSRAPSGVSQMIVNNVIQKWAKDYRNPQEAWLT 396

Query: 360 WLIGIRQEYTVKRNT---CLDLCRKYLPAQVVNVPAVTAGMFFMIYID 404
           W++ +  +YT +RN     L+    Y    + ++  ++AGMF  + I+
Sbjct: 397 WVMKVAGQYTERRNKLVQALEATDAYRQG-LFSLAQISAGMFLALKIN 443

>CAGL0G06028g complement(579261..580874) similar to sp|P38840
           Saccharomyces cerevisiae YHR137w ARO9 aromatic amino
           acid aminotransferase II, start by similarity
          Length = 537

 Score =  189 bits (481), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 117/402 (29%), Positives = 199/402 (49%), Gaps = 36/402 (8%)

Query: 39  NIVFLGAGMPPSELFPIKSLSLELPKPPFVDGIGECKQTLQATIMKEQQDLLFEHDVPLA 98
           +++ L AGMP  + FPIK++ + +   PF       K         E + L      P+A
Sbjct: 67  DVIELTAGMPNEQFFPIKAMDMTIVNKPFESADDTSKHLHCKMSTYEPKSL------PIA 120

Query: 99  RALQYGNSRGQKELVAYLKEHTSLFHRIPYQ--DWDIITTTGSTQGWDASLRIFCNKGDT 156
           R+ QY    G  ++  + K   +  ++  Y    WD++ ++GS          FC++  T
Sbjct: 121 RSFQYNEVPGLPQIRNFAKYLVNKINKPAYSADQWDVLLSSGSCDSMFKFFECFCDEKST 180

Query: 157 VLLEEYTYSSSVEAADAQGLNCIPMPLD------GEGIIPEKLEEMLINWSD-LYPDIPM 209
           VL+EE+T++  +    A G  CIP+ ++       +GI  + L ++L NWS   Y  +  
Sbjct: 181 VLMEEFTFTPVISHVKATGAECIPLKMNLTKDPSTQGIDVDYLTQLLDNWSSGPYKHLNK 240

Query: 210 PKLLYTIPTGQNPTGCTLSDSRKPYIYHLAQKYDMIIIEDEPYYFLQMDQYEPEERRLEQ 269
           P++LYTI TGQNPTG T+    +  IY LA K++ +I+ED+PY +L    Y+PE+     
Sbjct: 241 PRILYTICTGQNPTGVTIPMENRRKIYELAHKHNFLILEDDPYGYLSFPSYKPEDPLKND 300

Query: 270 PASRAMTHAEFIGS-LGKSFLELDVEGRVVRLDSVSKTFAPGCRMGWLVGSKHLLDNYWN 328
                 T  ++    L  SFL +D + RV+R+++ SK FAPG R+G++V +K+++ N   
Sbjct: 301 YLEDGFTVEKYTNEFLVDSFLTIDTDARVIRMETFSKVFAPGLRLGFIVANKYIISNLLE 360

Query: 329 LHEVSIQSTCGFAQSILGGILNR---WGQG---------------GYIDWLIGIRQEYTV 370
             E++ ++  G +Q++L   L     +  G               G++ W++ +  EYT 
Sbjct: 361 YAEITTRAPSGVSQAVLYNTLETMALYQDGDDKEDPEKKQEALFQGWMHWIMKVAAEYTH 420

Query: 371 KRNTCLDLCRKYLPAQ--VVNVPAVTAGMFFMIYIDAKKHPG 410
           +RN  L    +    +  +  V   +AGMF  + I   K PG
Sbjct: 421 RRNITLKALYETDAYKNGLFTVIEPSAGMFVGVKIKWDKAPG 462

>AGR141C [4452] [Homologous to ScYER152C - SH] (1013962..1015278)
           [1317 bp, 438 aa]
          Length = 438

 Score = 55.8 bits (133), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 73/281 (25%), Positives = 114/281 (40%), Gaps = 44/281 (15%)

Query: 212 LLYTIPTGQNPTGCTLSDSRKPYIYHLAQKYDMIIIEDEPYYFLQMDQYEPEERRLEQPA 271
           ++Y IPT  NP+G T S   +  +  LA++YDM++I D+ Y  L  DQ   +  R    A
Sbjct: 182 VMYLIPTYSNPSGSTYSLETRTRLVELARRYDMLLISDDIYDLLAYDQPSDQLPR----A 237

Query: 272 SRAMTHAEFIGSLGKSFLELDVEGRVVRLDSVSKTFAPGCRMGW-------LVGSKHLLD 324
             ++ H +   +L +   E D  G  V   S SK  APG R G+       LVG   L +
Sbjct: 238 LPSLVHVDR-ATLNE---EQDSWGHTVANASFSKIVAPGLRCGYQESVTSRLVG--QLAN 291

Query: 325 NYWNLHEVSIQSTCGFAQSILGGILNRWGQGGYIDWLIGIRQEYTVKRNTCLDLCRKYLP 384
              N   VS  S       I+G +++    G     L  +R  Y  +        R+YLP
Sbjct: 292 GGAN---VSGGSPAQLNSMIIGTLIS---TGELAHLLQLLRSVYQDRAEVLHRAVREYLP 345

Query: 385 AQVVNVPAVTAGMFFMIYI-DAKKHPGFLTTFNGDYLLMEQHIYRKCVSAGVLVTCSSWF 443
           A   +  A   G F    + +         T   DY              GV++   S F
Sbjct: 346 A-ATDYKAQNGGYFSWCTLPEGYNSEAICRTLQHDY--------------GVVLANGSHF 390

Query: 444 KVNDPSPHAHKSGTKQLAFRGTYASVQPEAMANGLEILGNV 484
           +V+D      + G  + + R + + ++P  +  G+   G V
Sbjct: 391 EVSD-----DELGWGRRSVRLSVSFLEPAEIEEGMRRFGAV 426

>Kwal_14.2574
          Length = 443

 Score = 55.5 bits (132), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 66/274 (24%), Positives = 105/274 (38%), Gaps = 28/274 (10%)

Query: 102 QYGNSRGQKELVAYLKEHTSLFHRIPYQDWDIITTTGSTQGWDASLRIFCNKGDTVLLEE 161
           QY  ++G+  L+  L +  S  +       ++  TTG+ +G  + L    N GD V++ E
Sbjct: 86  QYAPTKGRVSLINSLVKLYSPLYNTQLDASNVQVTTGANEGILSCLVGLLNPGDEVIVFE 145

Query: 162 YTYSSSVEAADAQG--LNCIPM-PLDGEGIIPEKLEEMLINWSDLYPDIPMPKLLYTIPT 218
             +   +      G  +  +PM P     +   K  E  +N+ +L   I        + T
Sbjct: 146 PFFDQYISNIQIPGGKVTYVPMHPPKEMNVRNTKGTEWTVNYDELEAAITPKTKALILNT 205

Query: 219 GQNPTGCTLSDSRKPYIYHLAQKYDMIIIEDEPYYFLQMDQYEPEERRLEQPASRAMTHA 278
             NP G   +      I  +  K++++II DE Y  L    + PE  R+   +       
Sbjct: 206 PHNPVGKVFTREELLRIGEICVKHNVVIISDEVYEHL---YFTPEFTRIATLSPEIGQIT 262

Query: 279 EFIGSLGKSFLELDVEGRVVRLDSVSKTFAPGCRMGWLVGSKHLLDNYWNLHEVSIQ-ST 337
             +GS GKSF                   A G R+GW+V     L  Y ++    I  S+
Sbjct: 263 LTVGSAGKSFA------------------ATGWRIGWVVSLNPELLKYASMAHTRICFSS 304

Query: 338 CGFAQSILGGILNRWGQGGYIDWLIGIRQEYTVK 371
               Q      LN     GY +    +RQEY  K
Sbjct: 305 PSPLQEACANSLNTALDNGYFE---KMRQEYINK 335

>CAGL0J05126g complement(484849..486150) highly similar to sp|P47039
           Saccharomyces cerevisiae YJL060w, hypothetical start
          Length = 447

 Score = 53.9 bits (128), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 67/284 (23%), Positives = 109/284 (38%), Gaps = 34/284 (11%)

Query: 94  DVPLARALQYGNSRGQKELVAYLKEHTSLFHRIPYQDWDIITTTGSTQGWDASLRIFCNK 153
           DVPL    QY  +RG+  L+  L E           + +++ TTG+ +G  + L    N 
Sbjct: 70  DVPLVN--QYSPTRGRPSLIKSLVELYKPVFGDFIDNQNVLVTTGANEGILSCLMGILNA 127

Query: 154 GDTVLLEEYTYSSSVEAADAQG--LNCIPM-PLDGEGIIPEKLEEMLINWSDLYPDIPMP 210
           GD V++ E  +   +   +  G  +  +P+ P           +E  I+W  L       
Sbjct: 128 GDEVIVFEPFFDQYIPNIELCGGVVRYVPIHPPKEMKTRNTTGDEWQIDWDALEKTFNNK 187

Query: 211 KLLYTIPTGQNPTGCTLSDSRKPYIYHLAQKYDMIIIEDEPYYFLQMDQYEPEERRL-EQ 269
                I T  NP G   ++     +  L  +++ ++I DE Y  L   +  P    + E 
Sbjct: 188 TKAVIINTPHNPIGKVFTEQELTKLAQLCVEHNTVVISDEVYEHLYFTESFPRIANINED 247

Query: 270 PASRAMTHAEFIGSLGKSFLELDVEGRVVRLDSVSKTFAPGCRMGWLVGSKHLLDNYWNL 329
            A+  +T    +GS GKSF                   A G R+GW++     L NY + 
Sbjct: 248 IANLTLT----VGSAGKSFA------------------ATGWRIGWIISKNDQLLNYVSK 285

Query: 330 HEVSI--QSTCGFAQSILGGILNRWGQGGYIDWLIGIRQEYTVK 371
               I   S     ++  G I         ID+   +R+EY  K
Sbjct: 286 AHTRICFASPSPLQEACAGSI----EHALKIDYFPKMREEYRKK 325

>Scas_555.7
          Length = 446

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 45/188 (23%), Positives = 81/188 (43%), Gaps = 33/188 (17%)

Query: 212 LLYTIPTGQNPTGCTLSDSRKPYIYHLAQKYDMIIIEDEPYYFLQMDQYEPEERRLEQPA 271
           ++Y +PT  NP+G T S   K  +  LA++YDM+II D+ Y  L  +Q+           
Sbjct: 190 VMYCVPTFSNPSGNTYSLKTKLKLIELARRYDMLIISDDVYDLLDYEQF----------- 238

Query: 272 SRAMTHAEFIGSLGKSFLELDVE---------GRVVRLDSVSKTFAPGCRMGWL--VGSK 320
                  + +  + K F+ LD E         G  +   + SK  APG R G+   + +K
Sbjct: 239 ------LDVLPHVPKRFVHLDRETSTHPENSFGNTLSNATFSKIIAPGLRFGYTESISNK 292

Query: 321 HLLDNYWNLHEVSIQSTCGFAQSILGGILNRWGQGGYIDWLI-GIRQEYTVKRNTCLDLC 379
            +L     L      ++ G    +   I+    + G +D ++  +RQ Y  +     +  
Sbjct: 293 LVL----QLSRGGANTSGGTPSQLNSMIVGTMLKNGLVDKVLHNLRQTYKERSVVMYESI 348

Query: 380 RKYLPAQV 387
           +++LP + 
Sbjct: 349 KRWLPRKT 356

>Scas_711.52
          Length = 445

 Score = 52.8 bits (125), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 72/300 (24%), Positives = 127/300 (42%), Gaps = 47/300 (15%)

Query: 83  MKEQQDLLFEHDVPLARALQYGNSRGQKELV-AYLKEHTSLFHRIPYQDWDIITTTGSTQ 141
           +KE Q  L   D+PL    QY  +RG+  L+ A +K++T ++     Q+ ++  TTG+ +
Sbjct: 74  IKEAQKAL---DIPLVN--QYSPTRGRVSLLNALIKQYTPIYGSELKQE-NVTITTGANE 127

Query: 142 GWDASLRIFCNKGDTVLLEEYTYSSSVEAADAQGLNCIPMPLDGEGIIPEKLEEMLINWS 201
           G  + L    N GD V++ E  +   +   +  G   + +P++     P++L++ +   +
Sbjct: 128 GILSCLMGLLNAGDEVIVFEPFFDQYISNIELMGGKIVYVPINP----PKELDQRVTEGT 183

Query: 202 DLYPDIPMPKLLYT-------IPTGQNPTGCTLSDSRKPYIYHLAQKYDMIIIEDEPYYF 254
           +   D+   K   T       I T  NP G   +      I ++  + ++III DE Y  
Sbjct: 184 EWTVDMEQFKNAITSKTKAVIINTPHNPIGKVFTREELLQIGNICVEKNVIIISDEVYEH 243

Query: 255 LQM-DQYEPEERRLEQPASRAMTHAEFIGSLGKSFLELDVEGRVVRLDSVSKTFAP-GCR 312
           L   D++           +R  T +  IG L             + + S  KTFA  G R
Sbjct: 244 LYFTDEF-----------TRIATLSPEIGQL------------TLTVGSAGKTFAATGWR 280

Query: 313 MGWLVG-SKHLLDNYWNLHEVSIQSTCGFAQSILGGILNRWGQGGYIDWLIGIRQEYTVK 371
           +GW++  +  LL      H     ++    Q      +N   +  Y +    +RQEY  K
Sbjct: 281 IGWVISLNSELLQYVSKAHTRICFASPSPLQEACANSINDALESNYFE---KMRQEYIQK 337

>CAGL0I06578g 637311..638621 similar to sp|P10356 Saccharomyces
           cerevisiae YER152c, hypothetical start
          Length = 436

 Score = 52.4 bits (124), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 65/272 (23%), Positives = 112/272 (41%), Gaps = 56/272 (20%)

Query: 164 YSSSVEAADAQGLNCIPMPLDGEGIIPEKLEEMLINWSDLY------------PDIPMPK 211
           + S + A D +G + I           E+L   L ++ +LY            P+ P  K
Sbjct: 130 FGSKLTAIDEEGEDSINF---------EQLLSKLRHFEELYGNSNGDVSIIQNPNKPTKK 180

Query: 212 L----LYTIPTGQNPTGCTLSDSRKPYIYHLAQKYDMIIIEDEPYYFLQ--MDQYE---P 262
           +    +Y +PT  NP+G + S   +  +  +A++YDM+II D+ Y  L    D +E   P
Sbjct: 181 VYKYVMYCVPTFANPSGKSYSLETRTKLIEIARRYDMLIICDDVYDLLDYSTDVHEWPRP 240

Query: 263 EERRLEQPASRAMTHAEFIGSLGKSFLELDVEGRVVRLDSVSKTFAPGCRMGW--LVGSK 320
           ++R +    + A    EF              G  +   + SK  APG R G+   +  K
Sbjct: 241 QKRLVHIDRATAPDDNEF--------------GNTISNATFSKIIAPGLRFGYHETINDK 286

Query: 321 HLLDNYWNLHEVSIQSTCGFAQSILGGILNRWGQGGYIDWLIG-IRQEYTVKRNTCLDLC 379
                      VS  +       I+G IL    Q G ++ ++G +R+ Y  +     D  
Sbjct: 287 LAAQLSRGGANVSGGTPSQLNSMIVGTIL----QNGSMERILGKLRETYKTRSVAMWDSL 342

Query: 380 RKYLPAQVVNVPAVTAGMFFMIYI----DAKK 407
           +K++P    ++ +   G F  + +    DAKK
Sbjct: 343 QKHMPKD-THISSPKGGYFVWVTLPPGYDAKK 373

>YJL060W (BNA3) [2851] chr10 (323302..324636) Protein predicted to
           be part of the nicotinic acid biosynthetic pathway from
           tryptophan, has similarity to human tyrosine
           transaminase, mutations in which cause tyrosinemia, may
           be localized to mitochondria [1335 bp, 444 aa]
          Length = 444

 Score = 52.4 bits (124), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 66/294 (22%), Positives = 117/294 (39%), Gaps = 35/294 (11%)

Query: 83  MKEQQDLLFEHDVPLARALQYGNSRGQKELVAYLKEHTSLFHRIPYQDWDIITTTGSTQG 142
           +KE Q  L   D+P+    QY  +RG+  L+  L +  S  +    +  ++  TTG+ +G
Sbjct: 73  IKEAQKAL---DIPMVN--QYSPTRGRPSLINSLIKLYSPIYNTELKAENVTVTTGANEG 127

Query: 143 WDASLRIFCNKGDTVLLEEYTYSSSVEAADAQGLNCIPMPLDGEGIIPEKL---EEMLIN 199
             + L    N GD V++ E  +   +   +  G   + +P++    + ++    EE  I+
Sbjct: 128 ILSCLMGLLNAGDEVIVFEPFFDQYIPNIELCGGKVVYVPINPPKELDQRNTRGEEWTID 187

Query: 200 WSDLYPDIPMPKLLYTIPTGQNPTGCTLSDSRKPYIYHLAQKYDMIIIEDEPYYFLQMDQ 259
           +      I        I T  NP G   +      + ++  K++++II DE Y       
Sbjct: 188 FEQFEKAITSKTKAVIINTPHNPIGKVFTREELTTLGNICVKHNVVIISDEVY------- 240

Query: 260 YEPEERRLEQPASRAMTHAEFIGSLGKSFLELDVEGRVVRLDSVSKTFAP-GCRMGWLVG 318
              E        +R  T +  IG L             + + S  K+FA  G R+GW++ 
Sbjct: 241 ---EHLYFTDSFTRIATLSPEIGQL------------TLTVGSAGKSFAATGWRIGWVLS 285

Query: 319 -SKHLLDNYWNLHEVSIQSTCGFAQSILGGILNRWGQGGYIDWLIGIRQEYTVK 371
            +  LL      H     ++    Q      +N   + GY +    +RQEY  K
Sbjct: 286 LNAELLSYAAKAHTRICFASPSPLQEACANSINDALKIGYFE---KMRQEYINK 336

>CAGL0L12254g complement(1324815..1326539) similar to sp|P52893
           Saccharomyces cerevisiae YLR089c, hypothetical start
          Length = 574

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 42/125 (33%), Positives = 59/125 (47%), Gaps = 8/125 (6%)

Query: 132 DIITTTGSTQGWDASLRIFCNKGDT-VLLEEYTYSSSVEAADAQGLNCIPMPLDGE---G 187
           DI  T G++   D  L IFC   +T VL+    Y         Q  + +P  L+ E    
Sbjct: 233 DIFLTAGASSAVDYLLSIFCRGEETGVLIPIPQYPLYTATLALQNSHALPYYLNEETGWS 292

Query: 188 IIPEKLEEMLINWSDLYPDIPMPKLLYTIPTGQNPTGCTLSDSRKPYIYHLAQKYDMIII 247
             PE+LE +++   D   +   P +L  I  G NPTG  LS+     I+ LA KY +I+I
Sbjct: 293 TDPEELESIIL---DSIENNIKPSVLVVINPG-NPTGAVLSEEAIEQIFTLAAKYGIIVI 348

Query: 248 EDEPY 252
            DE Y
Sbjct: 349 ADEVY 353

>KLLA0F01617g complement(154025..155359) highly similar to sp|P47039
           Saccharomyces cerevisiae YJL060w singleton, start by
           similarity
          Length = 444

 Score = 50.8 bits (120), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 73/295 (24%), Positives = 118/295 (40%), Gaps = 56/295 (18%)

Query: 94  DVPLARALQYGNSRGQKELVAYLKEHTSLFHRIPYQDWDIITTTGSTQGWDASLRIFCNK 153
           +VPL    QY  +RG+  L+  L +  S  +     + ++  TTG+ +G  ASL    N 
Sbjct: 81  NVPLNN--QYSPTRGRPSLLKSLTDFYSPIYNETLNESNVTITTGANEGILASLVGLLNP 138

Query: 154 GDTVLLEEYTYSSSVEAADAQGLNCIPMPLDGEGIIPEKLEEML-------INWSDLYPD 206
           GD V++ E  +   +   +  G     +PL    + P++L E +       I++  L   
Sbjct: 139 GDEVIVFEPFFDQYISNIEIPGGKVRYVPL----VAPKELSERVTIGAEWKIDFDILNKT 194

Query: 207 IPMPKLLYTIPTGQNPTGCTLSDSRKPYIYHLAQKYDMIIIEDEPYYFLQM-DQYEPEER 265
           I        + T  NP G   +      +  +  K ++ II DE Y  L   D++     
Sbjct: 195 INERTKCIILNTPHNPIGKVFTREELTQLGDICVKNNIYIISDEVYEHLYFGDEF----- 249

Query: 266 RLEQPASRAMTHAEFIGSLGKSFLELDVEGRVVRLDSVSKTFAP-GCRMGWLVGSKHLLD 324
                 +R  T ++ IG L             + + S  K+FA  G R+GW+V     L 
Sbjct: 250 ------TRIATISKEIGDL------------TLSVGSAGKSFAATGWRIGWVVSRNAELL 291

Query: 325 NYWNLHEVSI--------QSTCGFAQSILGGILNRWGQGGYIDWLIGIRQEYTVK 371
           +Y +     I        Q  C  A SI  G+ N     GY +    +R+EY  K
Sbjct: 292 SYVSKAHTRICFSSPSPFQEAC--AHSIDIGLHN-----GYFE---NMREEYKEK 336

>KLLA0E00935g 101430..102767 similar to sp|P10356 Saccharomyces
           cerevisiae YER152c singleton, start by similarity
          Length = 445

 Score = 49.7 bits (117), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 47/175 (26%), Positives = 76/175 (43%), Gaps = 13/175 (7%)

Query: 212 LLYTIPTGQNPTGCTLSDSRKPYIYHLAQKYDMIIIEDEPYYFLQMDQYEPEERRLEQPA 271
           ++Y +PT  NP G T S   +  +  LA+K+DM+I+ D+ Y  L+ D    E   L  P 
Sbjct: 188 VIYLVPTYSNPGGQTYSLETRVKLIELARKHDMLIVSDDVYDLLRYDDSLDE---LPHPL 244

Query: 272 SRAMTHAEFIGSLGKSFLELDVE-GRVVRLDSVSKTFAPGCRMGWLVGSKHLLDNYWNLH 330
            R +TH + +     S+   D   G  +   + SK  APG R G+       L   + L 
Sbjct: 245 PR-LTHVDRM-----SYKHGDSGYGNTISNATFSKIIAPGLRFGYQETVNENLA--YQLS 296

Query: 331 EVSIQSTCGFAQSILGGILNRWGQGGYIDWLI-GIRQEYTVKRNTCLDLCRKYLP 384
           +     + G    +   I+    Q G    +I  +R+EY ++        + YLP
Sbjct: 297 QGGANVSGGTPSQLNSMIVGTLIQNGKAKEIICSLRKEYQLRAACLYQSVKSYLP 351

>YER152C (YER152C) [1581] chr5 complement(472652..473983) Protein of
           unknown function, has a region of weak similarity to a
           region of kynurenine aminotransferase II (human KATII),
           which catalyzes conversion of L-kynurenine to kynurenic
           acid and may act in glutamatergic neurotransmission and
           neurodegeneration [1332 bp, 443 aa]
          Length = 443

 Score = 48.5 bits (114), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 34/104 (32%), Positives = 47/104 (45%), Gaps = 8/104 (7%)

Query: 212 LLYTIPTGQNPTGCTLSDSRKPYIYHLAQKYDMIIIEDEPYYFLQMDQYEPEERRLEQPA 271
           ++Y IPT  NP+G T S   +  +  +A+KYDM+II D+ Y  L    Y      L  P 
Sbjct: 187 VMYCIPTFANPSGNTYSLETRRRLIDIARKYDMLIITDDVYDIL---DYTTPSDELPSPP 243

Query: 272 SRAMTHAEFIGSLGKSFLELDVEGRVVRLDSVSKTFAPGCRMGW 315
            R +         G+     D  G  V   + SK  APG R G+
Sbjct: 244 LRMVHIDRSTAPSGE-----DSFGNTVSNATFSKLIAPGLRFGY 282

>Sklu_2389.7 YJL060W, Contig c2389 13116-14459 reverse complement
          Length = 447

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 66/286 (23%), Positives = 112/286 (39%), Gaps = 52/286 (18%)

Query: 102 QYGNSRGQKELVAYLKEHTSLFHRIPYQDWDIITTTGSTQGWDASLRIFCNKGDTVLLEE 161
           QY  ++G+  L+  L +  S F++      ++  TTG+ +   + L    N+GD V++ E
Sbjct: 90  QYSPTKGRPSLINELIKLYSPFYKTRLGPSNVQVTTGANEAILSCLVGLLNQGDEVIVFE 149

Query: 162 YTYSSSVEAADAQGLNCIPMPLDGEGIIPEKLE-------EMLINWSDLYPDIPMPKLLY 214
             +   +   +  G     +PL      P++LE       E  +++ +L   I       
Sbjct: 150 PFFDQYISNIEIPGGKVTYVPLHP----PKELENRVTHGTEWTVDYDELRAAITPKTKAL 205

Query: 215 TIPTGQNPTGCTLSDSRKPYIYHLAQKYDMIIIEDEPYYFLQMDQYEPEERRLEQPASRA 274
            + T  NP G   +      I ++  + +++II DE Y          E        +R 
Sbjct: 206 ILNTPHNPIGKVFTREELLEIGNICVENNVVIISDEVY----------EHLYFTSEFTRI 255

Query: 275 MTHAEFIGSLGKSFLELDVEGRVVRLDSVSKTFAP-GCRMGWLVGSKHLLDNYWNLHEVS 333
            T +  IG+L  S            + S  KTFA  G R+GW+V     L  Y ++    
Sbjct: 256 ATLSPEIGNLTLS------------VGSAGKTFAATGWRIGWIVSQNAELLKYASMAHTR 303

Query: 334 I--------QSTCGFAQSILGGILNRWGQGGYIDWLIGIRQEYTVK 371
           I        Q  C  A+SI   + N + +         +RQEY  K
Sbjct: 304 ICFASPSPFQEAC--AKSIEIALQNNYFE--------KMRQEYINK 339

>Scas_681.2
          Length = 568

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 63/128 (49%), Gaps = 14/128 (10%)

Query: 132 DIITTTGSTQGWDASLRIFCNKGDTVLL---EEY-TYSSSVEAADAQGLNCIPMPLD--- 184
           DI  T G++      L I C   +T +L    +Y  Y++S+   ++  L   P  LD   
Sbjct: 227 DIFLTAGASAAVMYLLSILCKGPETGVLIPIPQYPLYTASLALNNSHAL---PYYLDEKS 283

Query: 185 GEGIIPEKLEEMLINWSDLYPDIPMPKLLYTIPTGQNPTGCTLSDSRKPYIYHLAQKYDM 244
           G    P+++EE+++   D       P +L  I  G NPTG  LS+    +I+ +A KY +
Sbjct: 284 GWSTNPKEIEEVVLAAKD---KKIRPSVLVVINPG-NPTGAVLSEKSIEHIFEIAAKYGI 339

Query: 245 IIIEDEPY 252
           ++I DE Y
Sbjct: 340 VVIADEVY 347

>Kwal_56.23791
          Length = 518

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 44/154 (28%), Positives = 63/154 (40%), Gaps = 8/154 (5%)

Query: 103 YGNSRGQKELVAYLKEHTSLFHRIPYQDWDIITTTGSTQGWDASLRIFCN---KGDTVLL 159
           Y NS+G       + E        P    DI  TTG++      L +FCN    G  + +
Sbjct: 148 YSNSQGVAGFRESVAEFIEERDGEPASAQDIFLTTGASGAVSYILSLFCNGPENGALIPI 207

Query: 160 EEY-TYSSSVEAADAQGLNCIPMPLDGEGIIPEKLEEMLINWSDLYPDIPMPKLLYTIPT 218
            +Y  Y++S+   ++  L   P  LD E       E++     D       P  L  I  
Sbjct: 208 PQYPLYTASLALNNSHAL---PYYLDEESGWSMDTEQIEKVVQDSIKKGIRPTCLVVINP 264

Query: 219 GQNPTGCTLSDSRKPYIYHLAQKYDMIIIEDEPY 252
           G NPTG  L+      +  +A KY M+II DE Y
Sbjct: 265 G-NPTGALLNTDTIENVIKVAAKYSMVIIADEVY 297

>AGR085W [4395] [Homologous to ScYLR089C - SH; ScYDR111C - SH]
           complement(887029..888594) [1566 bp, 521 aa]
          Length = 521

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 41/154 (26%), Positives = 65/154 (42%), Gaps = 8/154 (5%)

Query: 103 YGNSRGQKELVAYLKEHTSLFHRIPYQDWDIITTTGSTQGWDASLRIFCNKGDTVLL--- 159
           Y  S+G K     + +       IP    ++  T G++      L  FC   +T +L   
Sbjct: 151 YSASQGVKGYRRTVAQFIERRDGIPANPDNVYLTAGASSAVSCLLSTFCKGPETGVLIPI 210

Query: 160 -EEYTYSSSVEAADAQGLNCIPMPLDGEGIIPEKLEEMLINWSDLYPDIPMPKLLYTIPT 218
            +   Y++++   +A  L       DG    P+++E +++   D       PK L  I  
Sbjct: 211 PQYPLYTATITQNNAVALPYYLNEADGWSTNPDEMERVIL---DSKKRNIAPKCLVVINP 267

Query: 219 GQNPTGCTLSDSRKPYIYHLAQKYDMIIIEDEPY 252
           G NPTG  LS      I  LA KY +++I DE Y
Sbjct: 268 G-NPTGSVLSVKDMEAILTLAAKYGIVVIADEVY 300

>Kwal_8.585
          Length = 446

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 53/123 (43%), Gaps = 6/123 (4%)

Query: 212 LLYTIPTGQNPTGCTLSDSRKPYIYHLAQKYDMIIIEDEPYYFLQMDQYEPEERRLEQPA 271
           ++Y +PT  NP+G T S   +  +  LA++YD++II D+ Y  L       +        
Sbjct: 191 VIYLVPTFSNPSGATYSQECRLKLLDLARRYDILIISDDVYDLLGFHGQRTDS------G 244

Query: 272 SRAMTHAEFIGSLGKSFLELDVEGRVVRLDSVSKTFAPGCRMGWLVGSKHLLDNYWNLHE 331
            R  +H  F      +    +  G  +   + SK  APG R G+   +   L N  +L  
Sbjct: 245 IRKPSHFRFPQLDRITVPAGNTHGNTISNCTFSKIIAPGLRTGYQETANENLANQLSLGG 304

Query: 332 VSI 334
            +I
Sbjct: 305 ANI 307

>YDR111C (YDR111C) [960] chr4 complement(678235..679758) Protein
           with high similarity to S. cerevisiae Ylr089p, which is
           a putative mitochondrial alanine aminotransferase
           involved in energy pathways, contains an
           aminotransferase class I and II domain, which are found
           in some pyridoxal-dependent enzymes [1524 bp, 507 aa]
          Length = 507

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 59/220 (26%), Positives = 90/220 (40%), Gaps = 25/220 (11%)

Query: 127 PYQDWDIITTTGSTQGWDASLRIFCNKGDTVLL----EEYTYSSSVEAADAQGLNCIPMP 182
           P    DI  TTG++    + L + C    T LL    +   Y++S    +AQ    +P  
Sbjct: 161 PATPEDIYLTTGASSAATSLLSLLCKDSQTGLLIPIPQYPLYTASASLFNAQ---VLPYY 217

Query: 183 LDGEGIIPEKLEEMLINWSDLYPDIPMPKLLYTIPTGQNPTGCTLSDSRKPYIYHLAQKY 242
           LD E       +E+     D       P +L  I  G NPTG  LS+     I  +A KY
Sbjct: 218 LDEESNWSTNSDEIEKVVQDALKKQIRPSVLIVINPG-NPTGAVLSEETIARICLIAAKY 276

Query: 243 DMIIIEDEPYYFLQMDQYEPEERRLEQPASRAMTHAEFIGSLGKSFLELDVEGRVVRLDS 302
            + II DE Y   Q + +   +    +   R + H  + G             ++  L S
Sbjct: 277 GITIISDEVY---QENIFNDVKFHSMKKVLRKLQHL-YPGKFDNV--------QLASLHS 324

Query: 303 VSKTFAPGC--RMGWL--VG-SKHLLDNYWNLHEVSIQST 337
           +SK F   C  R G++  +G S+ + D  + L  +SI S 
Sbjct: 325 ISKGFMDECGQRGGYMEIIGFSQEIRDALFKLMSISICSV 364

>YLR089C (YLR089C) [3504] chr12 complement(318238..320016) Putative
           mitochondrial alanine aminotransferase [1779 bp, 592 aa]
          Length = 592

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 62/128 (48%), Gaps = 14/128 (10%)

Query: 132 DIITTTGSTQGWDASLRIFCNKGDTVLL---EEY-TYSSSVEAADAQGLNCIPMPLD--- 184
           DI  T G++   +  L IFC   +T +L    +Y  Y++++   ++Q L   P  LD   
Sbjct: 251 DIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQAL---PYYLDENS 307

Query: 185 GEGIIPEKLEEMLINWSDLYPDIPMPKLLYTIPTGQNPTGCTLSDSRKPYIYHLAQKYDM 244
           G    PE++E ++    +   +   P +L  I  G NPTG  LS      I+ +A KY  
Sbjct: 308 GWSTNPEEIETVV---KEAIQNEIKPTVLVVINPG-NPTGAVLSPESIAQIFEVAAKYGT 363

Query: 245 IIIEDEPY 252
           ++I DE Y
Sbjct: 364 VVIADEVY 371

>AEL170C [2336] [Homologous to ScYJL060W - SH] (318032..319408)
           [1377 bp, 458 aa]
          Length = 458

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 53/227 (23%), Positives = 93/227 (40%), Gaps = 28/227 (12%)

Query: 102 QYGNSRGQKELV-AYLKEHTSLFHRIPYQDWDIITTTGSTQGWDASLRIFCNKGDTVLLE 160
           QY  +RG+  LV A LK +  ++  +  ++  +  TTG+ +G  A L    N GD V++ 
Sbjct: 102 QYAPTRGRPALVEALLKLYRPMYGDLAAENVQV--TTGANEGIFACLAGLVNPGDEVIVF 159

Query: 161 EYTYSSSVEAADAQGLNCIPMPLDGEGIIPEKL---EEMLINWSDLYPDIPMPKLLYTIP 217
           E  +   +   +  G     +P+     + +++    E +I++  L   I        I 
Sbjct: 160 EPFFDQYIPNIELLGGVVRYVPIRPPAELSKRVTEGTEWVIDYDMLRQTINEKTKAVIIN 219

Query: 218 TGQNPTGCTLSDSRKPYIYHLAQKYDMIIIEDEPYYFLQMDQYEPEERRLEQPASRAMTH 277
           +  NP G   +      + ++  +  + II DE Y  L    +  E  R+   +     H
Sbjct: 220 SPHNPIGKVFTREELLKLGNICVEKGIYIISDEVYEHL---YFTDEFTRIATLSEEISQH 276

Query: 278 AEFIGSLGKSFLELDVEGRVVRLDSVSKTFAPGCRMGWLVG-SKHLL 323
              +GS GKSF                   A G R+GW++  +K LL
Sbjct: 277 TLTVGSAGKSFA------------------ATGWRIGWVISRNKELL 305

>KLLA0F19162g complement(1775240..1776826) similar to sp|P52893
           Saccharomyces cerevisiae YLR089c, start by similarity
          Length = 528

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 56/201 (27%), Positives = 90/201 (44%), Gaps = 14/201 (6%)

Query: 58  LSLELPKPPFVDGIGECKQTLQAT-IMKEQQDLLFEHDVPLARALQYGNSRGQKELVA-Y 115
           LSL L  P  ++   E  QTL  T  +K  + LL E    +    Q    +G +E VA +
Sbjct: 115 LSL-LQHPELLEEADEALQTLYKTDSIKRAKRLLSEVGGSVGAYSQSQGVQGIRETVADF 173

Query: 116 LKEHTSLFHRIPYQDWDIITTTGSTQGWDASLRIFC---NKGDTVLLEEY-TYSSSVEAA 171
           + +       I Y + DI  T G++      L I C   N G  + + +Y  Y++S+   
Sbjct: 174 ITKRDD--GEISYPE-DIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALN 230

Query: 172 DAQGLNCIPMPLDGEGIIPEKLEEMLINWSDLYPDIPMPKLLYTIPTGQNPTGCTLSDSR 231
           +++ L             PE++E++++   D       P  L  I  G NPTG  LS+  
Sbjct: 231 NSRPLPYYLREEQNWSTDPEEIEQVVL---DAIQKGIKPTCLVVINPG-NPTGAILSEQS 286

Query: 232 KPYIYHLAQKYDMIIIEDEPY 252
              I+ +A KY +++I DE Y
Sbjct: 287 IQKIFEVAAKYGIVVIADEVY 307

>Scas_693.9
          Length = 497

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 53/124 (42%), Gaps = 6/124 (4%)

Query: 132 DIITTTGSTQGWDASLRIFC---NKGDTVLLEEYTYSSSVEAADAQGLNCIPMPLDGEGI 188
           DI  TTG+T      L + C     G  + + +Y   ++  A +   +  IP  LD E  
Sbjct: 156 DIFLTTGATSAASYLLSVLCRGPQTGVLIPIPQYPLYTATLALNKSTM--IPYYLDEESA 213

Query: 189 IPEKLEEMLINWSDLYPDIPMPKLLYTIPTGQNPTGCTLSDSRKPYIYHLAQKYDMIIIE 248
                 E+     D       P ++  I  G NPTG  LS+     I+ +A KY ++++ 
Sbjct: 214 WSTNTTEIEKLVLDSIKKGIKPSVIVVINPG-NPTGAVLSELAIAKIFQIAAKYGIVVLA 272

Query: 249 DEPY 252
           DE Y
Sbjct: 273 DEVY 276

>Sklu_2129.2 YIL116W, Contig c2129 1164-2318
          Length = 384

 Score = 30.4 bits (67), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 37/81 (45%), Gaps = 4/81 (4%)

Query: 110 KELVA-YLKEHTSLFHRI--PYQDWDIITTTGSTQGWDASLRIFC-NKGDTVLLEEYTYS 165
           K L+A Y  +H+S   +   P    +I    GS +  DA +R+ C    D +++   TY 
Sbjct: 64  KNLMANYRNKHSSFKDQNLPPLTAENICLGVGSDESIDALIRVCCVPSKDKIMIMPPTYG 123

Query: 166 SSVEAADAQGLNCIPMPLDGE 186
                AD   + C+ +PL  E
Sbjct: 124 MYSICADINDVGCVKVPLVAE 144

>AFR022C [3214] [Homologous to ScYNL169C (PSD1) - SH]
           (481388..482932) [1545 bp, 514 aa]
          Length = 514

 Score = 30.0 bits (66), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 34/74 (45%), Gaps = 2/74 (2%)

Query: 87  QDLLFEHDVPLARALQYGNSRGQKELVAYLKEHTSLFHRIPYQDWDIITTTGSTQGWDAS 146
           ++ L  H  P+       +S  Q E         +  + IPY   DII  T  TQG DA 
Sbjct: 243 KEFLGTHSHPMITRSSSSDSLCQNEHDDTKHREFARINNIPYSLQDIIGDTPGTQGEDAH 302

Query: 147 LRI--FCNKGDTVL 158
           +++  + ++GD VL
Sbjct: 303 IQLIQYESEGDKVL 316

>YDR150W (NUM1) [994] chr4 (755622..763868) Nuclear migration
           protein, controls interaction of bud-neck cytoskeleton
           with G2 nucleus [8247 bp, 2748 aa]
          Length = 2748

 Score = 30.0 bits (66), Expect = 5.7,   Method: Composition-based stats.
 Identities = 28/124 (22%), Positives = 51/124 (41%), Gaps = 7/124 (5%)

Query: 155 DTVLLEEYTYSSSV---EAADAQGLNCIPMPLDGEGIIPEKLEEMLINWSDLYPDIPMPK 211
           D  LL +  Y   V   E  D + L      L    +  E+  E+   +S+L  ++  P 
Sbjct: 741 DHHLLSDSAYEDLVKCKENPDVEFLKEKSAKLGHTVVSSEEYSELQRKYSELEKEVEQPS 800

Query: 212 LLYTIPTGQNPTGCTLSDSRKPYIYHLAQKYDMIIIEDEP----YYFLQMDQYEPEERRL 267
           L Y +   +      LSDS    +    +  DM  ++++     +  +  + Y   E++L
Sbjct: 801 LAYLVEHAKATDHHLLSDSAYEELVKCKENPDMEFLKEKSAKLGHTVVSNEAYSELEKKL 860

Query: 268 EQPA 271
           EQP+
Sbjct: 861 EQPS 864

>KLLA0F17930g 1638931..1643925 similar to sgd|S0002548 Saccharomyces
           cerevisiae YDR141c DOP1, start by similarity
          Length = 1664

 Score = 29.3 bits (64), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 38/83 (45%), Gaps = 16/83 (19%)

Query: 318 GSKHLLDNYWNLHEVSIQ-STCGFAQSILGGILNRWGQGGYIDWLIGIRQEYTVKRNTCL 376
           G++HLL     LHE+     TC  A  I+  +++RW  G Y+   I I           +
Sbjct: 363 GAQHLLGG---LHEMLEHPQTCIDAYKIVSALMDRWQIGSYLTPKIFI---------PLI 410

Query: 377 DLCRKYLPAQVVNVPAVTAGMFF 399
           + CR+Y   Q+V     TA  FF
Sbjct: 411 EKCREYSDNQLV---LKTASSFF 430

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.137    0.425 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 16,513,835
Number of extensions: 739564
Number of successful extensions: 1510
Number of sequences better than 10.0: 43
Number of HSP's gapped: 1456
Number of HSP's successfully gapped: 44
Length of query: 485
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 379
Effective length of database: 12,926,601
Effective search space: 4899181779
Effective search space used: 4899181779
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 63 (28.9 bits)