Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_47.174511861849661e-135
Sklu_1768.31851775322e-69
KLLA0A04840g1981704862e-62
Scas_638.81881864296e-54
YGL018C (JAC1)1841814262e-53
AGR164C2001644263e-53
CAGL0A00297g1981763638e-44
KLLA0E04345g42884790.024
Kwal_55.2096542151740.12
ADR015W43646720.18
CAGL0J01936g42546710.24
ADR124C61179710.28
Sklu_2257.642946700.31
CAGL0D01584g30049690.36
Scas_694.213738670.41
YIR004W (DJP1)43246690.44
Scas_709.341446670.87
CAGL0J05478g12625641.00
KLLA0C07260g36848632.2
KLLA0D03773g14150612.6
Scas_692.3437561632.7
CAGL0L12276g45254632.8
CAGL0J01870g94661623.3
AFR639W15654613.3
CAGL0I09526g29645613.9
KLLA0D13464g43351614.1
CAGL0H10406g142081624.2
CAGL0F03729g36152614.7
YLR090W (XDJ1)45957614.7
YMR214W (SCJ1)37761614.7
KLLA0F25190g554142614.8
AFR198W77658615.2
CAGL0L12694g80671615.2
Scas_707.13d32973598.1
Sklu_2256.163663598.2
CAGL0G02959g918106598.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_47.17451
         (184 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_47.17451                                                         376   e-135
Sklu_1768.3 YGL018C, Contig c1768 3648-4205                           209   2e-69
KLLA0A04840g complement(430541..431137) similar to sp|P53193 Sac...   191   2e-62
Scas_638.8                                                            169   6e-54
YGL018C (JAC1) [1955] chr7 complement(459113..459667) J-type cha...   168   2e-53
AGR164C [4475] [Homologous to ScYGL018C (JAC1) - SH] (1053441..1...   168   3e-53
CAGL0A00297g complement(30179..30775) similar to sp|P53193 Sacch...   144   8e-44
KLLA0E04345g complement(400495..401781) similar to sp|P39101 Sac...    35   0.024
Kwal_55.20965                                                          33   0.12 
ADR015W [1756] [Homologous to ScYIR004W (DJP1) - SH] complement(...    32   0.18 
CAGL0J01936g complement(190181..191458) highly similar to sp|P40...    32   0.24 
ADR124C [1865] [Homologous to ScYJL073W (JEM1) - SH] (926131..92...    32   0.28 
Sklu_2257.6 YIR004W, Contig c2257 8880-10169 reverse complement        32   0.31 
CAGL0D01584g 167879..168781 similar to tr|Q12350 Saccharomyces c...    31   0.36 
Scas_694.2                                                             30   0.41 
YIR004W (DJP1) [2669] chr9 (363218..364516) Protein required for...    31   0.44 
Scas_709.3                                                             30   0.87 
CAGL0J05478g 521045..521425 highly similar to sp|P53937 Saccharo...    29   1.00 
KLLA0C07260g complement(632987..634093) similar to sp|P25303 Sac...    29   2.2  
KLLA0D03773g 321716..322141 similar to sp|Q02260 Saccharomyces c...    28   2.6  
Scas_692.34                                                            29   2.7  
CAGL0L12276g 1327171..1328529 similar to tr|Q12014 Saccharomyces...    29   2.8  
CAGL0J01870g 181666..184506 highly similar to sp|P13586 Saccharo...    28   3.3  
AFR639W [3831] [Homologous to ScYJR097W - NSH] complement(160398...    28   3.3  
CAGL0I09526g 911127..912017 weakly similar to sp|P52868 Saccharo...    28   3.9  
KLLA0D13464g complement(1159251..1160552) similar to sp|P40564 S...    28   4.1  
CAGL0H10406g complement(1011563..1015825) similar to tr|Q07527 S...    28   4.2  
CAGL0F03729g complement(362972..364057) similar to sp|P25303 Sac...    28   4.7  
YLR090W (XDJ1) [3505] chr12 (320702..322081) Homolog of E. coli ...    28   4.7  
YMR214W (SCJ1) [4170] chr13 (695349..696482) Homolog of E. coli ...    28   4.7  
KLLA0F25190g 2345059..2346723 no similarity, hypothetical start        28   4.8  
AFR198W [3390] [Homologous to ScYKL134C - SH] complement(797451....    28   5.2  
CAGL0L12694g complement(1362090..1364510) similar to sp|Q03308 S...    28   5.2  
Scas_707.13d                                                           27   8.1  
Sklu_2256.1 YOL019W, Contig c2256 396-2306                             27   8.2  
CAGL0G02959g 272520..275276 similar to sp|P53253 Saccharomyces c...    27   8.8  

>Kwal_47.17451
          Length = 186

 Score =  376 bits (966), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 184/184 (100%), Positives = 184/184 (100%)

Query: 1   MFRLVPRRLYSVRSAYQLFPKTFASGNMRWDVDLRRLRMEYRELQAAEHPDTNSNGDASR 60
           MFRLVPRRLYSVRSAYQLFPKTFASGNMRWDVDLRRLRMEYRELQAAEHPDTNSNGDASR
Sbjct: 1   MFRLVPRRLYSVRSAYQLFPKTFASGNMRWDVDLRRLRMEYRELQAAEHPDTNSNGDASR 60

Query: 61  SSELNHAYQTLRQPLLRAEYILKNQAGIDLRNEQTAQGIAQQNPELLMQVLDVHEQLESM 120
           SSELNHAYQTLRQPLLRAEYILKNQAGIDLRNEQTAQGIAQQNPELLMQVLDVHEQLESM
Sbjct: 61  SSELNHAYQTLRQPLLRAEYILKNQAGIDLRNEQTAQGIAQQNPELLMQVLDVHEQLESM 120

Query: 121 TTEEDVAAVARENQERMREIEQRLGAAFEKQDWDAATQLTVELRYWTSLDRAVKEWEPGQ 180
           TTEEDVAAVARENQERMREIEQRLGAAFEKQDWDAATQLTVELRYWTSLDRAVKEWEPGQ
Sbjct: 121 TTEEDVAAVARENQERMREIEQRLGAAFEKQDWDAATQLTVELRYWTSLDRAVKEWEPGQ 180

Query: 181 RLEM 184
           RLEM
Sbjct: 181 RLEM 184

>Sklu_1768.3 YGL018C, Contig c1768 3648-4205
          Length = 185

 Score =  209 bits (532), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 94/177 (53%), Positives = 128/177 (72%)

Query: 8   RLYSVRSAYQLFPKTFASGNMRWDVDLRRLRMEYRELQAAEHPDTNSNGDASRSSELNHA 67
           R YS ++ YQLFPKTF  G  +W VDLR+LR EYR+LQA  HPD   +     SS LN A
Sbjct: 7   RFYSTKNFYQLFPKTFPKGKPQWTVDLRQLRQEYRKLQAISHPDAQGSTTNDDSSTLNKA 66

Query: 68  YQTLRQPLLRAEYILKNQAGIDLRNEQTAQGIAQQNPELLMQVLDVHEQLESMTTEEDVA 127
           Y TLRQPL R++Y+L+ QA IDL  +Q A  I QQ+PELLM VLD+HEQLES+TTEED+ 
Sbjct: 67  YHTLRQPLTRSQYLLQTQAHIDLSKDQVASEITQQDPELLMTVLDIHEQLESITTEEDLH 126

Query: 128 AVARENQERMREIEQRLGAAFEKQDWDAATQLTVELRYWTSLDRAVKEWEPGQRLEM 184
            +++EN++RM  +++ L   +   D++ A +LT+EL+YW +LD A+KEWEPG+ + +
Sbjct: 127 QISKENKQRMERVQELLDDCYANHDFETAARLTIELKYWVNLDNAIKEWEPGKPVHL 183

>KLLA0A04840g complement(430541..431137) similar to sp|P53193
           Saccharomyces cerevisiae YGL018c JAC1 molecular
           chaperone singleton, start by similarity
          Length = 198

 Score =  191 bits (486), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 89/170 (52%), Positives = 126/170 (74%), Gaps = 1/170 (0%)

Query: 13  RSAYQLFPKTFASGNMRWDVDLRRLRMEYRELQAAEHPDTNSNGDASRSSELNHAYQTLR 72
           ++ +Q FPKTF SG  +W+VDL++LR EYR+LQ+  HPD  ++   + SSELN AY+TL 
Sbjct: 26  KTLFQWFPKTFTSGKPQWEVDLKKLRKEYRQLQSEHHPDVITSTVDNVSSELNRAYKTLS 85

Query: 73  QPLLRAEYILKNQAGIDLRNEQTAQGIAQQNPELLMQVLDVHEQLESMTTEEDVAAVARE 132
           +PL R++YIL +  GIDL  +  AQ +  ++P+LLM VLDVHEQLE + +EED+  + +E
Sbjct: 86  KPLPRSQYIL-SLHGIDLTQDGEAQKVMSKDPQLLMLVLDVHEQLEDINSEEDLKQIEQE 144

Query: 133 NQERMREIEQRLGAAFEKQDWDAATQLTVELRYWTSLDRAVKEWEPGQRL 182
           N++R+ E EQ+L  A E QDW+ A  LTVELRYW++LD A+KEWEPG+ +
Sbjct: 145 NKQRLNECEQKLKKAHESQDWETAAMLTVELRYWSNLDNAIKEWEPGKPI 194

>Scas_638.8
          Length = 188

 Score =  169 bits (429), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 81/186 (43%), Positives = 124/186 (66%), Gaps = 3/186 (1%)

Query: 1   MFRLVPRRLYSVRSAYQLFPKTFASGNMRWDVDLRRLRMEYRELQAAEHPDTNSNGDA-- 58
           M R + ++ Y + + Y+LFP+TF +    W VD  +LR EYR LQA  HPD   N +   
Sbjct: 1   MKRFLTQKRY-LTTFYELFPRTFPTKTPIWSVDQSKLRKEYRALQAQHHPDMAQNSEELD 59

Query: 59  SRSSELNHAYQTLRQPLLRAEYILKNQAGIDLRNEQTAQGIAQQNPELLMQVLDVHEQLE 118
           + SS LN AY  L++PL R++Y++K    +DL  +   + I Q +PE+LM+V+++HEQL 
Sbjct: 60  THSSLLNKAYHVLKEPLTRSQYLIKLLDNVDLTQDSVKEKITQSDPEILMKVIEIHEQLM 119

Query: 119 SMTTEEDVAAVARENQERMREIEQRLGAAFEKQDWDAATQLTVELRYWTSLDRAVKEWEP 178
            + TEEDV  + REN ERM  IE +L  AF+K+D++ A +LTVEL+YW+++  A+KEW P
Sbjct: 120 DIDTEEDVKKIRRENTERMATIEGQLENAFKKKDFETAIKLTVELKYWSNVAYAIKEWAP 179

Query: 179 GQRLEM 184
           G+ +++
Sbjct: 180 GKEIQI 185

>YGL018C (JAC1) [1955] chr7 complement(459113..459667) J-type
           chaperone protein, may be involved in assembly of
           mitochondrial iron-sulfur proteins [555 bp, 184 aa]
          Length = 184

 Score =  168 bits (426), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 84/181 (46%), Positives = 121/181 (66%), Gaps = 3/181 (1%)

Query: 4   LVPRRLYSVRSAYQLFPKTFASGNMRWDVDLRRLRMEYRELQAAEHPDTNSNGDASRSSE 63
           LV RR  S  + Y+LFPKTF      W +D  RLR EYR+LQA  HPD    G + +SS 
Sbjct: 5   LVQRRFTS--TFYELFPKTFPKKLPIWTIDQSRLRKEYRQLQAQHHPDMAQQG-SEQSST 61

Query: 64  LNHAYQTLRQPLLRAEYILKNQAGIDLRNEQTAQGIAQQNPELLMQVLDVHEQLESMTTE 123
           LN AY TL+ PL R++Y+LK    IDL  EQT+  +   +P+LL++VLD+H++L  M  E
Sbjct: 62  LNQAYHTLKDPLRRSQYMLKLLRNIDLTQEQTSNEVTTSDPQLLLKVLDIHDELSQMDDE 121

Query: 124 EDVAAVARENQERMREIEQRLGAAFEKQDWDAATQLTVELRYWTSLDRAVKEWEPGQRLE 183
             V  + ++N+ER+++IE +LG  +  +D+ AA +LTVEL+YW +L +A K+W PG++LE
Sbjct: 122 AGVKLLEKQNKERIQDIEAQLGQCYNDKDYAAAVKLTVELKYWYNLAKAFKDWAPGKQLE 181

Query: 184 M 184
           M
Sbjct: 182 M 182

>AGR164C [4475] [Homologous to ScYGL018C (JAC1) - SH]
           (1053441..1054043) [603 bp, 200 aa]
          Length = 200

 Score =  168 bits (426), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 85/164 (51%), Positives = 112/164 (68%), Gaps = 2/164 (1%)

Query: 16  YQLFPKTFASGNMRWDVDLRRLRMEYRELQAAEHPDTNSNGDASRSSELNHAYQTLRQPL 75
           ++ FP TF SG  +WDVD+RRLR EYR+LQ   HPD     D + +  LN AY TL +PL
Sbjct: 32  FRAFPATFPSGEPQWDVDVRRLRREYRQLQGQHHPDVAGGTDEA-AQRLNRAYGTLVRPL 90

Query: 76  LRAEYILKNQAGIDLRNEQTAQGIAQQNPELLMQVLDVHEQLESMTTEEDVAAVARENQE 135
            RA+++L  Q G+D+  + TAQ I Q++P LLM+VLDVHEQLE + +E DV  +  EN+ 
Sbjct: 91  ARAQFLLARQ-GVDVTADATAQEIMQRDPGLLMRVLDVHEQLEELESEADVRRLREENRA 149

Query: 136 RMREIEQRLGAAFEKQDWDAATQLTVELRYWTSLDRAVKEWEPG 179
           RM  +E  LG AF  + WD A QL VELRYW +++ AV+EWEPG
Sbjct: 150 RMAGVEAELGRAFAARAWDRAAQLAVELRYWDNVESAVREWEPG 193

>CAGL0A00297g complement(30179..30775) similar to sp|P53193
           Saccharomyces cerevisiae YGL018c JAC1 molecular
           chaperone, hypothetical start
          Length = 198

 Score =  144 bits (363), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 69/176 (39%), Positives = 110/176 (62%), Gaps = 3/176 (1%)

Query: 12  VRSAYQLFPKTFASGNMRWDVDLRRLRMEYRELQAAEHPDT---NSNGDASRSSELNHAY 68
           + S Y+LFP TF     RWDVDL +LR EYR+LQA  HPD        D+ +SS LN AY
Sbjct: 21  IVSYYELFPGTFPDSQPRWDVDLGKLRKEYRKLQAEVHPDKIQKEQEADSEQSSLLNKAY 80

Query: 69  QTLRQPLLRAEYILKNQAGIDLRNEQTAQGIAQQNPELLMQVLDVHEQLESMTTEEDVAA 128
             L+ PL R++++++    +DL  +  A+   Q +PELLM V+DVHEQL    + ++V  
Sbjct: 81  HALKDPLTRSQHMIQILKDVDLTVDSVAREYTQMDPELLMDVMDVHEQLLDANSRDEVRE 140

Query: 129 VARENQERMREIEQRLGAAFEKQDWDAATQLTVELRYWTSLDRAVKEWEPGQRLEM 184
           + + N++R+ +IE  L   ++ ++++ A  LT  L+YW ++  AVK+W PG+ +++
Sbjct: 141 IEKVNKQRIEKIEAELKECYDNKEYERAINLTARLKYWKNVASAVKDWAPGKPIDL 196

>KLLA0E04345g complement(400495..401781) similar to sp|P39101
           Saccharomyces cerevisiae YER048c CAJ1 dnaJ homolog,
           start by similarity
          Length = 428

 Score = 35.0 bits (79), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 41/84 (48%), Gaps = 9/84 (10%)

Query: 31  DVDLRRLRMEYRELQAAEHPDTNSNGDASRSS--ELNHAYQTLRQPLLRAEYILKNQAGI 88
           D   + ++  YR+L    HPD N +   +++   EL  AYQ L    LR +Y   +Q G+
Sbjct: 16  DASPQEIKKSYRKLAIKTHPDKNPDDPQAQTKFQELAKAYQVLIDDDLRKKY---DQFGL 72

Query: 89  DLRNEQTAQGIAQQNP-ELLMQVL 111
           D  N +       Q+P E+LM V 
Sbjct: 73  DETNGEIPM---DQDPYEMLMTVF 93

>Kwal_55.20965
          Length = 421

 Score = 33.1 bits (74), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 28/51 (54%), Gaps = 5/51 (9%)

Query: 32 VDLRRLRMEYRELQAAEHPDTNSNGDAS--RSSELNHAYQTLRQPLLRAEY 80
          +D+++    YR+    EHPD N N   +  R   ++ AYQ L +  LRA+Y
Sbjct: 21 IDIKK---AYRKKSVQEHPDKNPNDPTATERFQAISQAYQVLSKEDLRAKY 68

>ADR015W [1756] [Homologous to ScYIR004W (DJP1) - SH]
          complement(732201..733511) [1311 bp, 436 aa]
          Length = 436

 Score = 32.3 bits (72), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 24/46 (52%), Gaps = 2/46 (4%)

Query: 37 LRMEYRELQAAEHPDTNSNGDAS--RSSELNHAYQTLRQPLLRAEY 80
          ++  YR+    EHPD N N   +  R   ++ AYQ L    LRA+Y
Sbjct: 22 IKKAYRKKSVQEHPDKNPNDPKATERFQAISEAYQVLSSDELRAKY 67

>CAGL0J01936g complement(190181..191458) highly similar to
          sp|P40564 Saccharomyces cerevisiae YIR004w DJP1, start
          by similarity
          Length = 425

 Score = 32.0 bits (71), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 24/46 (52%), Gaps = 2/46 (4%)

Query: 37 LRMEYRELQAAEHPDTNSNGDAS--RSSELNHAYQTLRQPLLRAEY 80
          ++  YR+    EHPD N N   +  R   ++ AYQ L    LRA+Y
Sbjct: 22 IKKAYRKKSIQEHPDKNPNDPTATERFQAISEAYQVLSSEELRAKY 67

>ADR124C [1865] [Homologous to ScYJL073W (JEM1) - SH]
           (926131..927966) [1836 bp, 611 aa]
          Length = 611

 Score = 32.0 bits (71), Expect = 0.28,   Method: Composition-based stats.
 Identities = 25/79 (31%), Positives = 32/79 (40%), Gaps = 11/79 (13%)

Query: 31  DVDLRRLRMEYRELQAAEHPDTNSN-GDASRS------SELNHAYQTLRQPLLRAEYILK 83
           D + + +R  Y  L    HPD   N  DA R+      S +N AY+ L     R EY + 
Sbjct: 519 DANAKDIRRAYLHLTKKYHPDKQGNMSDAERAKVEEKMSSINEAYEVLSDESKRKEYDML 578

Query: 84  NQAGIDLRNEQTAQGIAQQ 102
              G      Q A G  QQ
Sbjct: 579 RSGG----GSQHAGGNGQQ 593

>Sklu_2257.6 YIR004W, Contig c2257 8880-10169 reverse complement
          Length = 429

 Score = 31.6 bits (70), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 24/46 (52%), Gaps = 2/46 (4%)

Query: 37 LRMEYRELQAAEHPDTNSNGDAS--RSSELNHAYQTLRQPLLRAEY 80
          ++  YR+    EHPD N N  ++  R   ++ AYQ L    LR +Y
Sbjct: 22 IKKAYRKKSVQEHPDKNPNDPSATERFQSISQAYQVLSNEELRTKY 67

>CAGL0D01584g 167879..168781 similar to tr|Q12350 Saccharomyces
          cerevisiae YPR061c, hypothetical start
          Length = 300

 Score = 31.2 bits (69), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 27/49 (55%), Gaps = 5/49 (10%)

Query: 14 SAYQLFPKTFASGNMRWDVDLRRLRMEYRELQAAEHPDTNSNGDASRSS 62
          + Y++F   F  G     VDL++L+MEY +     HPD +S+    +SS
Sbjct: 56 TPYEIFG--FGVGT---HVDLKKLKMEYHKYVKMYHPDLSSHIQIRKSS 99

>Scas_694.2
          Length = 137

 Score = 30.4 bits (67), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 23/38 (60%), Gaps = 4/38 (10%)

Query: 109 QVLDVHEQLESMTTEEDVAAVARENQERMREIEQRLGA 146
           QVL++  +L +MT E D  A+ REN      +++R+G 
Sbjct: 54  QVLNITSELSTMTIEGDARAIVRENI----ALKKRIGC 87

>YIR004W (DJP1) [2669] chr9 (363218..364516) Protein required for
          peroxisomal biogenesis, has similarity to E. coli DnaJ
          and other DnaJ-like proteins [1299 bp, 432 aa]
          Length = 432

 Score = 31.2 bits (69), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 24/46 (52%), Gaps = 2/46 (4%)

Query: 37 LRMEYRELQAAEHPDTNSNGDAS--RSSELNHAYQTLRQPLLRAEY 80
          ++  YR+    EHPD N N   +  R   ++ AYQ L    LRA+Y
Sbjct: 22 IKKAYRKKSIQEHPDKNPNDPTATERFQAISEAYQVLGDDDLRAKY 67

>Scas_709.3
          Length = 414

 Score = 30.4 bits (67), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 23/46 (50%), Gaps = 2/46 (4%)

Query: 37 LRMEYRELQAAEHPDTNSNGDAS--RSSELNHAYQTLRQPLLRAEY 80
          ++  YR+    EHPD N N   +  R   ++ AYQ L    LR +Y
Sbjct: 22 IKKAYRKKSIQEHPDKNPNDPTATERFQAISEAYQVLSDDTLRLKY 67

>CAGL0J05478g 521045..521425 highly similar to sp|P53937
           Saccharomyces cerevisiae YNL081c, start by similarity
          Length = 126

 Score = 29.3 bits (64), Expect = 1.00,   Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 17/25 (68%)

Query: 109 QVLDVHEQLESMTTEEDVAAVAREN 133
           Q+L++  +L +MT E D  A+ REN
Sbjct: 54  QILNITSELSNMTIEGDARAIVREN 78

>KLLA0C07260g complement(632987..634093) similar to sp|P25303
          Saccharomyces cerevisiae YMR214w SCJ1 homolog of E.
          coli DnaJ, functions in the endoplasmic reticulum by
          interaction with KAR2P, start by similarity
          Length = 368

 Score = 28.9 bits (63), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 21/48 (43%), Gaps = 2/48 (4%)

Query: 35 RRLRMEYRELQAAEHPDTNSNGDASRSS--ELNHAYQTLRQPLLRAEY 80
          + ++  YR+L    HPD N   D +     E+  AY  L  P  R  Y
Sbjct: 34 KEIKSAYRQLSKKYHPDKNPGNDEAHHHFIEVGEAYDVLSDPEKRQIY 81

>KLLA0D03773g 321716..322141 similar to sp|Q02260 Saccharomyces
           cerevisiae YGR074w SMD1 snRNA-associated protein
           singleton, start by similarity
          Length = 141

 Score = 28.1 bits (61), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 30/50 (60%), Gaps = 2/50 (4%)

Query: 82  LKNQ-AGIDLRNEQTAQGIAQQ-NPELLMQVLDVHEQLESMTTEEDVAAV 129
           LKN+   I+L+N  T  GI +  +P++ + + DV   L + T+E  +AAV
Sbjct: 10  LKNERVSIELKNGTTVWGIVRSVSPQMNVSLTDVRLTLPTKTSEATLAAV 59

>Scas_692.34
          Length = 375

 Score = 28.9 bits (63), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 29/61 (47%), Gaps = 5/61 (8%)

Query: 31 DVDLRRLRMEYRELQAAEHPDTN-SNGDAS-RSSELNHAYQTLRQPLLRAEYILKNQAGI 88
          D   + ++  YR+L    HPD N  N DA  +  E+  AY+ L  P  R  +   +Q G 
Sbjct: 31 DATDKEIKSAYRQLSKKFHPDKNPGNEDAHQKFIEVGEAYEVLSDPQKRQTF---DQFGA 87

Query: 89 D 89
          D
Sbjct: 88 D 88

>CAGL0L12276g 1327171..1328529 similar to tr|Q12014 Saccharomyces
          cerevisiae YLR090w, hypothetical start
          Length = 452

 Score = 28.9 bits (63), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 24/54 (44%), Gaps = 10/54 (18%)

Query: 37 LRMEYRELQAAEHPD---TNSNGDASRSS-------ELNHAYQTLRQPLLRAEY 80
          ++  YR+L    HPD    N  G+ S          E+  AYQ L    LRAEY
Sbjct: 18 IKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVLSDASLRAEY 71

>CAGL0J01870g 181666..184506 highly similar to sp|P13586
           Saccharomyces cerevisiae YGL167c PMR1, hypothetical
           start
          Length = 946

 Score = 28.5 bits (62), Expect = 3.3,   Method: Composition-based stats.
 Identities = 18/61 (29%), Positives = 30/61 (49%), Gaps = 2/61 (3%)

Query: 92  NEQTAQGIAQQNPELLMQVLDVHEQLESMTTEEDVAAVARENQERMREIEQRLGAAFEKQ 151
           +E+  + + + NP L    L V E +E++ T+ D    + E   + REI  R    FE+ 
Sbjct: 32  DEEAYELLNRPNPSLKFCTLSVGETVENLETDVDNGLSSEEEVVKRREIHGR--NDFEED 89

Query: 152 D 152
           D
Sbjct: 90  D 90

>AFR639W [3831] [Homologous to ScYJR097W - NSH]
          complement(1603985..1604455) [471 bp, 156 aa]
          Length = 156

 Score = 28.1 bits (61), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 14/54 (25%), Positives = 22/54 (40%)

Query: 27 NMRWDVDLRRLRMEYRELQAAEHPDTNSNGDASRSSELNHAYQTLRQPLLRAEY 80
           +  D +   +R  YR+     HPD     D    + +  AY+ L  P  R+ Y
Sbjct: 10 GIAVDAEPLEVRQAYRQRLLEAHPDKQGGVDKGAVTRIQQAYRVLSDPTQRSAY 63

>CAGL0I09526g 911127..912017 weakly similar to sp|P52868
          Saccharomyces cerevisiae YGL128c, hypothetical start
          Length = 296

 Score = 28.1 bits (61), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 22/45 (48%), Gaps = 1/45 (2%)

Query: 37 LRMEYRELQAAEHPDTNSNGD-ASRSSELNHAYQTLRQPLLRAEY 80
          L+ +YR+L    HPD N   +   R   LN A   L  P  +AEY
Sbjct: 38 LKKQYRKLSLRYHPDKNPGPEYIDRFHLLNLAITVLADPAKKAEY 82

>KLLA0D13464g complement(1159251..1160552) similar to sp|P40564
          Saccharomyces cerevisiae YIR004w DJP1 DnaJ-like protein
          involved specifically in peroxisomal protein import,
          start by similarity
          Length = 433

 Score = 28.1 bits (61), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 26/51 (50%), Gaps = 5/51 (9%)

Query: 32 VDLRRLRMEYRELQAAEHPDTNSNGDAS--RSSELNHAYQTLRQPLLRAEY 80
          +D+++    YR+    EHPD N +   +  R   ++ AYQ L    LR +Y
Sbjct: 20 IDIKKA---YRKKSVKEHPDKNPDDPTATERFQAISEAYQVLSSEELRMKY 67

>CAGL0H10406g complement(1011563..1015825) similar to tr|Q07527
           Saccharomyces cerevisiae YDL112w TRM3, hypothetical
           start
          Length = 1420

 Score = 28.5 bits (62), Expect = 4.2,   Method: Composition-based stats.
 Identities = 20/81 (24%), Positives = 35/81 (43%), Gaps = 6/81 (7%)

Query: 99  IAQQNPELLMQVLDVHEQLESMTTEEDVAAVARENQERMREIE-----QRLGAAFEKQDW 153
           I Q N   L+ V+D HEQL     E     V  +    ++EI+     + +G     +D 
Sbjct: 24  IEQDNFSALVGVIDAHEQLSGSHVEALFEKVVSKVDNEVQEIDLQNAHRDVGCEHLSEDM 83

Query: 154 DAATQLTVEL-RYWTSLDRAV 173
           D   ++ V +   W  ++R +
Sbjct: 84  DIFAKIVVSVPDLWVKIERKI 104

>CAGL0F03729g complement(362972..364057) similar to sp|P25303
          Saccharomyces cerevisiae YMR214w SCJ1, hypothetical
          start
          Length = 361

 Score = 28.1 bits (61), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 22/52 (42%), Gaps = 2/52 (3%)

Query: 31 DVDLRRLRMEYRELQAAEHPDTNSNGDASRSS--ELNHAYQTLRQPLLRAEY 80
          D   + ++  YR+L    HPD N   + +     E+  AY  L  P  R  Y
Sbjct: 30 DASDKEIKSAYRQLSKKYHPDKNPGDEEAHHKFIEVGEAYDILGDPEKRKTY 81

>YLR090W (XDJ1) [3505] chr12 (320702..322081) Homolog of E. coli
          DnaJ [1380 bp, 459 aa]
          Length = 459

 Score = 28.1 bits (61), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 15/57 (26%), Positives = 27/57 (47%), Gaps = 5/57 (8%)

Query: 31 DVDLRRLRMEYRELQAAEHPDTNSNGDAS-----RSSELNHAYQTLRQPLLRAEYIL 82
          D  ++ ++  YR+L    HPD   + D+      +  E+  AY+ L  P  ++ Y L
Sbjct: 19 DATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKKSHYDL 75

>YMR214W (SCJ1) [4170] chr13 (695349..696482) Homolog of E. coli
          DnaJ, functions in the endoplasmic reticulum by
          interaction with Kar2p [1134 bp, 377 aa]
          Length = 377

 Score = 28.1 bits (61), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 27/61 (44%), Gaps = 5/61 (8%)

Query: 31 DVDLRRLRMEYRELQAAEHPDTNSNGDASRSS--ELNHAYQTLRQPLLRAEYILKNQAGI 88
          D   + ++  YR+L    HPD N+  + +     E+  AY  L  P  +  Y   +Q G 
Sbjct: 33 DATEKEIKSAYRQLSKKYHPDKNAGSEEAHQKFIEVGEAYDVLSDPEKKKIY---DQFGA 89

Query: 89 D 89
          D
Sbjct: 90 D 90

>KLLA0F25190g 2345059..2346723 no similarity, hypothetical start
          Length = 554

 Score = 28.1 bits (61), Expect = 4.8,   Method: Composition-based stats.
 Identities = 24/142 (16%), Positives = 65/142 (45%), Gaps = 17/142 (11%)

Query: 49  HPDTNSNGDASRSSELN-HAYQTLRQPLLRAEY--------------ILKNQAGIDLRNE 93
           H  TNSNG A  +   N H+       L  A                ++K+   ++    
Sbjct: 372 HGKTNSNGTAEATKNSNPHSNNESMSALYNASLENDPCSKLPNFGVILIKSPTNVEQLWS 431

Query: 94  QTAQGIAQQNPELLMQVLDVHEQLESMTTEEDVAAVARENQERMREIEQRLGAAFEKQDW 153
           +  +  +  N + L++++ + +Q +    + D+A + ++ +  ++E+E++ G+++   D 
Sbjct: 432 EYTKLPSDSNMKALLKLM-LQQQNKDTIKKSDIA-LMKQRKTTIQELERKCGSSWRNSDK 489

Query: 154 DAATQLTVELRYWTSLDRAVKE 175
           + + Q+    + W  +++ +K+
Sbjct: 490 NFSRQINRRKKIWGCIEQGLKD 511

>AFR198W [3390] [Homologous to ScYKL134C - SH]
           complement(797451..799781) [2331 bp, 776 aa]
          Length = 776

 Score = 28.1 bits (61), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 32/58 (55%), Gaps = 6/58 (10%)

Query: 89  DLRNEQTAQGIAQ------QNPELLMQVLDVHEQLESMTTEEDVAAVARENQERMREI 140
           +LR + + +G+ +      Q  ++L +V+D+ E L +   +E   A A+E  E+M EI
Sbjct: 117 NLREDSSQEGLVRYIIRLDQLSDILCRVIDLCEFLRAAHPDEQFVAAAQECHEQMFEI 174

>CAGL0L12694g complement(1362090..1364510) similar to sp|Q03308
           Saccharomyces cerevisiae YPL045w vacuolar sorting
           protein, start by similarity
          Length = 806

 Score = 28.1 bits (61), Expect = 5.2,   Method: Composition-based stats.
 Identities = 18/71 (25%), Positives = 36/71 (50%), Gaps = 8/71 (11%)

Query: 109 QVLDVHEQLESMTT--EEDVAAVARE--NQERMREIEQRLGAAFEKQDWDAATQLTVELR 164
           Q+L+++  +   T   ++D++ + RE    + M EI  +LG  FE++  +      +EL+
Sbjct: 617 QILELYNTIPHKTEHLKQDISLIQREVKRNQYMTEINNKLGTNFEREPLNDVLAKLIELK 676

Query: 165 YWTSLDRAVKE 175
                DR  K+
Sbjct: 677 Q----DRVAKD 683

>Scas_707.13d
          Length = 329

 Score = 27.3 bits (59), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 16/73 (21%), Positives = 39/73 (53%), Gaps = 3/73 (4%)

Query: 105 ELLMQVLDVHEQLESMTTE--EDVAAVARENQERMREIEQRLGAAFEKQDWDAATQLTVE 162
           +L+M VL++ + LE    +  +D   + +      R +E+ LG+++  +D + + Q+   
Sbjct: 216 DLMMCVLNIKKDLEYNNNQSVQDFELILKRTTSIQR-LEKLLGSSWRNKDKNFSRQINRR 274

Query: 163 LRYWTSLDRAVKE 175
            + W S++  +K+
Sbjct: 275 KKIWNSIEEGLKD 287

>Sklu_2256.1 YOL019W, Contig c2256 396-2306
          Length = 636

 Score = 27.3 bits (59), Expect = 8.2,   Method: Composition-based stats.
 Identities = 16/63 (25%), Positives = 32/63 (50%), Gaps = 1/63 (1%)

Query: 43  ELQAAEHPDTNSNGDASRSSELNHAYQTLRQP-LLRAEYILKNQAGIDLRNEQTAQGIAQ 101
           E+  + +PD   +G ++ ++  NHA   ++QP  +   Y+   +  +  +N   A  IA+
Sbjct: 569 EILLSNNPDFMISGSSTINTAQNHANLPIQQPNTVPTHYVPSYKKRLPRQNMPPASSIAR 628

Query: 102 QNP 104
            NP
Sbjct: 629 DNP 631

>CAGL0G02959g 272520..275276 similar to sp|P53253 Saccharomyces
           cerevisiae YGR089w, hypothetical start
          Length = 918

 Score = 27.3 bits (59), Expect = 8.8,   Method: Composition-based stats.
 Identities = 30/106 (28%), Positives = 48/106 (45%), Gaps = 12/106 (11%)

Query: 48  EHPDTNSNGDASRSSELNHAYQTLRQPLLRAEYILKNQAGIDLRNEQTAQGIAQQNPELL 107
           E+  TN   +AS+   L  A Q     +L  E  LK         + + + I  +   L+
Sbjct: 751 ENNATNEEKNASKVESLKIALQQSNSTILAWEEELK---------QLSEKQIEVEEKYLI 801

Query: 108 MQVLDVHEQLESMTTEEDVAAVAR---ENQERMREIEQRLGAAFEK 150
            + L + +QLE    EE + A+ +   EN ER++E  Q+L    EK
Sbjct: 802 QKDLHLRKQLEFSKEEEKLKALVKVKKENVERLQEEVQQLTGKLEK 847

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.129    0.369 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 5,432,518
Number of extensions: 202521
Number of successful extensions: 986
Number of sequences better than 10.0: 74
Number of HSP's gapped: 974
Number of HSP's successfully gapped: 74
Length of query: 184
Length of database: 16,596,109
Length adjustment: 95
Effective length of query: 89
Effective length of database: 13,307,399
Effective search space: 1184358511
Effective search space used: 1184358511
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 58 (26.9 bits)