Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_33.155171101105794e-79
Sklu_1420.51071123313e-41
Scas_647.16*1361103292e-40
ACL125C1061102983e-36
YJR022W (LSM8)1091092462e-28
CAGL0M07854g1051032184e-24
KLLA0E16511g961071053e-07
Scas_687.3216743750.013
AER432C15847740.019
AFL212C15264720.036
YFL017W-A (SMX2)7773690.039
CAGL0C02497g16542720.041
Sklu_2070.115864720.043
YCR020C-A (MAK31)8841690.056
KLLA0E15224g17964700.066
CAGL0L05544g15864700.073
Sklu_1435.216739670.20
Scas_590.5*12772650.25
Kwal_33.1410416064650.29
Scas_536.817564660.30
Kwal_34.161688839630.31
YJL124C (LSM1)17264650.38
KLLA0D09284g11074630.44
Kwal_47.1905121049640.57
KLLA0B05203g8342600.78
KLLA0D07678g7159581.2
Scas_719.598475582.0
YLR438C-A (LSM3)8942572.3
Kwal_56.232897959572.5
ADR373W96240592.6
CAGL0F04961g11060572.8
AER125C8342562.9
YOR108W (LEU9)60433593.3
Sklu_2241.28367563.3
KLLA0E20889g18351574.0
YER029C (SMB1)19642574.5
Scas_589.453038567.5
Scas_697.20*11839548.6
Kwal_27.1272753669559.1
KLLA0E10791g85341559.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_33.15517
         (110 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_33.15517                                                         227   4e-79
Sklu_1420.5 YJR022W, Contig c1420 3327-3650 reverse complement        132   3e-41
Scas_647.16*                                                          131   2e-40
ACL125C [924] [Homologous to ScYJR022W (LSM8) - SH] (128649..128...   119   3e-36
YJR022W (LSM8) [2923] chr10 (469698..470027) U6 snRNA-associated...    99   2e-28
CAGL0M07854g 785153..785470 similar to sp|P47093 Saccharomyces c...    89   4e-24
KLLA0E16511g complement(1467758..1468048) weakly similar to sp|P...    45   3e-07
Scas_687.32                                                            33   0.013
AER432C [2932] [Homologous to ScYER029C (SMB1) - SH] (1465361..1...    33   0.019
AFL212C [2983] [Homologous to ScYJL124C (LSM1) - SH] (38970..394...    32   0.036
YFL017W-A (SMX2) [1665] chr6 (103693..103926) Spliceosomal snRNA...    31   0.039
CAGL0C02497g 249146..249643 highly similar to sp|P40018 Saccharo...    32   0.041
Sklu_2070.1 YJL124C, Contig c2070 348-824 reverse complement           32   0.043
YCR020C-A (MAK31) [554] chr3 complement(154827..155093) Subunit ...    31   0.056
KLLA0E15224g 1349357..1349896 similar to sp|P47017 Saccharomyces...    32   0.066
CAGL0L05544g 604073..604549 highly similar to sp|P47017 Saccharo...    32   0.073
Sklu_1435.2 YER029C, Contig c1435 1741-2244 reverse complement         30   0.20 
Scas_590.5*                                                            30   0.25 
Kwal_33.14104                                                          30   0.29 
Scas_536.8                                                             30   0.30 
Kwal_34.16168                                                          29   0.31 
YJL124C (LSM1) [2795] chr10 complement(187046..187564) Protein o...    30   0.38 
KLLA0D09284g 782856..783188 similar to sp|Q06217 Saccharomyces c...    29   0.44 
Kwal_47.19051                                                          29   0.57 
KLLA0B05203g 469929..470180 similar to sp|P57743 Saccharomyces c...    28   0.78 
KLLA0D07678g 660221..660436 similar to sp|P40204 Saccharomyces c...    27   1.2  
Scas_719.59                                                            27   2.0  
YLR438C-A (LSM3) [3813] chr12 complement(1013905..1014174) U6 sn...    27   2.3  
Kwal_56.23289                                                          27   2.5  
ADR373W [2114] [Homologous to ScYAL035W (FUN12) - SH] complement...    27   2.6  
CAGL0F04961g join(506566..506570,506700..507027) highly similar ...    27   2.8  
AER125C [2629] [Homologous to ScYLR438C-A (LSM3) - SH] (877996.....    26   2.9  
YOR108W (LEU9) [4911] chr15 (523027..524841) Alpha-isopropylmala...    27   3.3  
Sklu_2241.2 YLR438C-A, Contig c2241 833-1084                           26   3.3  
KLLA0E20889g 1856387..1856938 gi|15072878|emb|CAC48005.1 Kluyver...    27   4.0  
YER029C (SMB1) [1454] chr5 complement(212586..213176) Spliceosom...    27   4.5  
Scas_589.4                                                             26   7.5  
Scas_697.20*                                                           25   8.6  
Kwal_27.12727                                                          26   9.1  
KLLA0E10791g 951335..953896 weakly similar to sp|P48237 Saccharo...    26   9.9  

>Kwal_33.15517
          Length = 110

 Score =  227 bits (579), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 110/110 (100%), Positives = 110/110 (100%)

Query: 1   MSPLLKDFLNKRIVIITTEGQCVTATLEGFDKSTNLLLSNVRERVSGDVVASSYLMRGNQ 60
           MSPLLKDFLNKRIVIITTEGQCVTATLEGFDKSTNLLLSNVRERVSGDVVASSYLMRGNQ
Sbjct: 1   MSPLLKDFLNKRIVIITTEGQCVTATLEGFDKSTNLLLSNVRERVSGDVVASSYLMRGNQ 60

Query: 61  VVCCGLLEEAEGLGPDLTSDTVYTELKDTKNYVRDEHLIWQSVWAMKAGK 110
           VVCCGLLEEAEGLGPDLTSDTVYTELKDTKNYVRDEHLIWQSVWAMKAGK
Sbjct: 61  VVCCGLLEEAEGLGPDLTSDTVYTELKDTKNYVRDEHLIWQSVWAMKAGK 110

>Sklu_1420.5 YJR022W, Contig c1420 3327-3650 reverse complement
          Length = 107

 Score =  132 bits (331), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 84/112 (75%), Gaps = 7/112 (6%)

Query: 1   MSPLLKDFLNKRIVIITTEGQCVTATLEGFDKSTNLLLSNVRERVSGDVVASSYLMRGNQ 60
           MSPLLKDFLN+RIV +TTEGQC+ A L+GFDK+TNLLLS+  ER +G  V+ +Y++RG++
Sbjct: 1   MSPLLKDFLNQRIVAVTTEGQCLVAMLQGFDKNTNLLLSDDHERFAGKAVSPAYILRGSE 60

Query: 61  VVCCGLLEEA--EGLGPDLTSDTVYTELKDTKNYVRDEHLIWQSVWAMKAGK 110
           VV CGLLEE+  E  G     D V + L+DTKN V +EHLIW+ VW  K+ +
Sbjct: 61  VVFCGLLEESAEEKFG-----DNVPSPLRDTKNRVPNEHLIWRKVWEAKSQR 107

>Scas_647.16*
          Length = 136

 Score =  131 bits (329), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 82/110 (74%), Gaps = 3/110 (2%)

Query: 1   MSPLLKDFLNKRIVIITTEGQCVTATLEGFDKSTNLLLSNVRERVSGDVVASSYLMRGNQ 60
           MSPLLK++LNK++VIIT EGQC TA LEGFDK+TNL+LSNVR+R + +++ S  L+RG++
Sbjct: 25  MSPLLKEYLNKKVVIITVEGQCFTANLEGFDKNTNLMLSNVRDRFNHELITSVQLLRGSE 84

Query: 61  VVCCGLLEEAEGLGPDLTSDTV---YTELKDTKNYVRDEHLIWQSVWAMK 107
           VV CGLLEE E    D+    V     +LKDTKN + +EHLIW+ VW  K
Sbjct: 85  VVVCGLLEEIEEGKKDVEDSGVIIPMVKLKDTKNRILNEHLIWEQVWKQK 134

>ACL125C [924] [Homologous to ScYJR022W (LSM8) - SH]
           (128649..128969) [321 bp, 106 aa]
          Length = 106

 Score =  119 bits (298), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 80/110 (72%), Gaps = 5/110 (4%)

Query: 1   MSPLLKDFLNKRIVIITTEGQCVTATLEGFDKSTNLLLSNVRERVSGDVVASSYLMRGNQ 60
           MSPLLK++L +R+V++TT+G C+ ATLEGFDK+ NLLLS+VR+R +G+ +A+++L++G+Q
Sbjct: 1   MSPLLKEYLGRRVVVVTTDGGCLVATLEGFDKTANLLLSDVRQRATGEGLAAAFLLQGSQ 60

Query: 61  VVCCGLLEEAEGLGPDLTSDTVYTELKDTKNYVRDEHLIWQSVWAMKAGK 110
           +VCCG L   EG GP+   +     L+DT+N V  EH IW   W  +  +
Sbjct: 61  IVCCGPL---EGGGPE--QEPQAAALRDTRNVVAREHDIWARAWQARQAR 105

>YJR022W (LSM8) [2923] chr10 (469698..470027) U6 snRNA-associated
           protein of the Sm-like group [330 bp, 109 aa]
          Length = 109

 Score = 99.4 bits (246), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 72/109 (66%), Gaps = 4/109 (3%)

Query: 1   MSPLLKDFLNKRIVIITTEGQCVTATLEGFDKSTNLLLSNVRERVSGDVVASSYLMRGNQ 60
           MS  LKD+LNKR+VII  +G+C+ A+L GFDK+TNL ++NV  R+S + +  + L+RG++
Sbjct: 1   MSATLKDYLNKRVVIIKVDGECLIASLNGFDKNTNLFITNVFNRISKEFICKAQLLRGSE 60

Query: 61  VVCCGLL--EEAEGLGPDLTSDTVYTELKDTKNYVRDEHLIWQSVWAMK 107
           +   GL+  E  + L P    +     LKDTKN + +EH+IW+ V+  K
Sbjct: 61  IALVGLIDAENDDSLAP--IDEKKVPMLKDTKNKIENEHVIWEKVYESK 107

>CAGL0M07854g 785153..785470 similar to sp|P47093 Saccharomyces
           cerevisiae YJR022w pre-mRNA splicing factor,
           hypothetical start
          Length = 105

 Score = 88.6 bits (218), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 47/103 (45%), Positives = 68/103 (66%), Gaps = 12/103 (11%)

Query: 1   MSPLLKDFLNKRIVIITTEGQCVTATLEGFDKSTNLLLSNVRERVSGDVVASSYLMRGNQ 60
           MSPLLK +LNK IV++TT G+ +   L+G+DK TNL++        GD +    L+RG++
Sbjct: 1   MSPLLKQYLNKDIVVVTTAGEVMHVVLDGYDKYTNLVVK------EGDKIR---LLRGSE 51

Query: 61  VVCCGLLEEAEGLGPDLTSDTVYTELKDTKNYVRDEHLIWQSV 103
           +V CGLLE+A+ L        VY   KDTKN ++DE+LIW++V
Sbjct: 52  IVVCGLLEDAKALEGLPMDSHVY---KDTKNVIKDEYLIWEAV 91

>KLLA0E16511g complement(1467758..1468048) weakly similar to
           sp|P47093 Saccharomyces cerevisiae YJR022w LSM8 splicing
           factor singleton, start by similarity
          Length = 96

 Score = 45.1 bits (105), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 54/107 (50%), Gaps = 15/107 (14%)

Query: 1   MSPLLKDFLNKRIVIITTEGQCVTATLEGFDKSTNLLLSNVRERVSGDVVASSYLMRGNQ 60
           MS LLKD+L+K+++++  +G      ++GFD + N++L            +   ++R ++
Sbjct: 1   MSALLKDYLDKKVMLVNVDGDTYYGEMKGFDHAGNMILLK---------DSKICIIRSSE 51

Query: 61  VVCCGLLEEAEGLGPDLTSDTVYTELKDTKNYV--RDEHLIWQSVWA 105
           VV CGL+++     P+        +    KN +  ++E  IW   WA
Sbjct: 52  VVLCGLIDDI----PEEKELAKLQKFPACKNKLPFKEEIDIWSERWA 94

>Scas_687.32
          Length = 167

 Score = 33.5 bits (75), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 26/43 (60%), Gaps = 1/43 (2%)

Query: 5  LKDFLNKRIVIITTEGQCVTATLEGFDKSTNLLLSN-VRERVS 46
          L D L+ ++ +IT +G+     L  FDK  NL+LS+ + ERV 
Sbjct: 11 LNDLLHYKLRVITQDGRVYVGELMAFDKHMNLILSDCIEERVP 53

>AER432C [2932] [Homologous to ScYER029C (SMB1) - SH]
          (1465361..1465837) [477 bp, 158 aa]
          Length = 158

 Score = 33.1 bits (74), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 29/47 (61%), Gaps = 1/47 (2%)

Query: 5  LKDFLNKRIVIITTEGQCVTATLEGFDKSTNLLLSN-VRERVSGDVV 50
          LKD ++ ++ +++ +G+    TL  FD   NL+L++ V ER+S   V
Sbjct: 11 LKDLIDYKLRVLSQDGRVYVGTLLAFDAHMNLVLADCVEERLSDHHV 57

>AFL212C [2983] [Homologous to ScYJL124C (LSM1) - SH]
          (38970..39428) [459 bp, 152 aa]
          Length = 152

 Score = 32.3 bits (72), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 16/64 (25%), Positives = 33/64 (51%), Gaps = 7/64 (10%)

Query: 9  LNKRIVIITTEGQCVTATLEGFDKSTNLLLSNVRERV-------SGDVVASSYLMRGNQV 61
          ++++I ++  +G+ +   L  FD+  NL+L +  ER+        G+     +++RG  V
Sbjct: 30 VDRKIFVLLRDGRMLFGVLRTFDQYANLILQHCVERIYIPEEGQYGECERGVFMVRGENV 89

Query: 62 VCCG 65
          V  G
Sbjct: 90 VMLG 93

>YFL017W-A (SMX2) [1665] chr6 (103693..103926) Spliceosomal
          snRNA-associated Sm core protein, also likely
          associated with telomerase TLC1 RNA [234 bp, 77 aa]
          Length = 77

 Score = 31.2 bits (69), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 18/73 (24%), Positives = 41/73 (56%), Gaps = 7/73 (9%)

Query: 2  SPLLKDFLNKRIVIITTEGQCVTATLEGFDKSTNLLLSNVRERVSGDVVASSY------L 55
          +P LK +++K+I++     + V   L G+D   N++L +  E ++G+  A+++      +
Sbjct: 4  TPELKKYMDKKILLNINGSRKVAGILRGYDIFLNVVLDDAME-INGEDPANNHQLGLQTV 62

Query: 56 MRGNQVVCCGLLE 68
          +RGN ++    L+
Sbjct: 63 IRGNSIISLEALD 75

>CAGL0C02497g 249146..249643 highly similar to sp|P40018
          Saccharomyces cerevisiae YER029c SMB1, start by
          similarity
          Length = 165

 Score = 32.3 bits (72), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 26/42 (61%), Gaps = 1/42 (2%)

Query: 5  LKDFLNKRIVIITTEGQCVTATLEGFDKSTNLLLSN-VRERV 45
          L D +N ++ +IT +G+     L  FDK  N++LS+ V ERV
Sbjct: 12 LADLINYKLRVITQDGRVYIGILLAFDKHMNVVLSDCVEERV 53

>Sklu_2070.1 YJL124C, Contig c2070 348-824 reverse complement
          Length = 158

 Score = 32.3 bits (72), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 16/64 (25%), Positives = 33/64 (51%), Gaps = 7/64 (10%)

Query: 9  LNKRIVIITTEGQCVTATLEGFDKSTNLLLSNVRERV-------SGDVVASSYLMRGNQV 61
          ++++I ++  +G+ +   L  FD+  NL+L +  ER+        G+     +++RG  V
Sbjct: 36 VDRKIFVLLRDGRMLFGVLRTFDQYANLILQHCVERIYITDENKYGECDRGVFMVRGENV 95

Query: 62 VCCG 65
          V  G
Sbjct: 96 VMLG 99

>YCR020C-A (MAK31) [554] chr3 complement(154827..155093) Subunit
          of Mak3p-Mak10p-Mak31p N-terminal acetyltransferase,
          required for structural stability of L-A
          double-stranded RNA- (dsRNA-) containing particles, has
          similarity to snRNA-associated proteins of the Sm
          family [267 bp, 88 aa]
          Length = 88

 Score = 31.2 bits (69), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 23/41 (56%)

Query: 5  LKDFLNKRIVIITTEGQCVTATLEGFDKSTNLLLSNVRERV 45
          L DF+   +++  TE + +  +L   D   NLLL +V ER+
Sbjct: 6  LSDFIGNTLIVSLTEDRILVGSLVAVDAQMNLLLDHVEERM 46

>KLLA0E15224g 1349357..1349896 similar to sp|P47017 Saccharomyces
           cerevisiae YJL124c LSM1 Sm-like (Lsm) protein singleton,
           start by similarity
          Length = 179

 Score = 31.6 bits (70), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 16/64 (25%), Positives = 32/64 (50%), Gaps = 7/64 (10%)

Query: 9   LNKRIVIITTEGQCVTATLEGFDKSTNLLLSNVRERV-------SGDVVASSYLMRGNQV 61
           ++++I ++  +G+     L  FD+  NL+L +  ER+        G+     +++RG  V
Sbjct: 57  VDRKIFVLLRDGRMFFGVLRTFDQYANLILQHTVERIYIEGENKYGECDRGVFMIRGENV 116

Query: 62  VCCG 65
           V  G
Sbjct: 117 VMLG 120

>CAGL0L05544g 604073..604549 highly similar to sp|P47017
          Saccharomyces cerevisiae YJL124c LSM1, start by
          similarity
          Length = 158

 Score = 31.6 bits (70), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 16/64 (25%), Positives = 33/64 (51%), Gaps = 7/64 (10%)

Query: 9  LNKRIVIITTEGQCVTATLEGFDKSTNLLLSNVRERV----SGDVVASS---YLMRGNQV 61
          ++++I ++  +G+     L  FD+  NL+L +  ER+    +G+        +++RG  V
Sbjct: 36 VDRKIFVLLRDGKLFFGVLRTFDQYANLILQDCVERIYVQENGEYAEEDRGIFMIRGENV 95

Query: 62 VCCG 65
          V  G
Sbjct: 96 VMLG 99

>Sklu_1435.2 YER029C, Contig c1435 1741-2244 reverse complement
          Length = 167

 Score = 30.4 bits (67), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 22/39 (56%)

Query: 5  LKDFLNKRIVIITTEGQCVTATLEGFDKSTNLLLSNVRE 43
          L D +N R+  IT +G+     L  FDK  NL+L++  E
Sbjct: 11 LADLINYRLRAITQDGRVYIGELLAFDKHMNLVLADCTE 49

>Scas_590.5*
          Length = 127

 Score = 29.6 bits (65), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 17/72 (23%), Positives = 35/72 (48%), Gaps = 11/72 (15%)

Query: 4   LLKDFLNKRIVIITT--EGQCVTATLEGFDKSTNLLLSNVRE---------RVSGDVVAS 52
           L+ D +N ++ +I +      + A ++ FD+  N++L NV+E          V+ +   S
Sbjct: 50  LITDSMNSKVPVIISLRNNHKIIARVKAFDRHCNMVLENVKELWTEKKGKSTVNRERFIS 109

Query: 53  SYLMRGNQVVCC 64
              +RG+ V+  
Sbjct: 110 KLFLRGDSVIVI 121

>Kwal_33.14104
          Length = 160

 Score = 29.6 bits (65), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 15/64 (23%), Positives = 32/64 (50%), Gaps = 7/64 (10%)

Query: 9   LNKRIVIITTEGQCVTATLEGFDKSTNLLLSNVRERV-------SGDVVASSYLMRGNQV 61
           ++++I ++  +G+ +   L  FD+  NL+L +  ER+         +     +++RG  V
Sbjct: 38  VDRKIFVLLRDGRMLFGILRTFDQYANLILQHCVERIYITDENKYAECSRGVFMVRGENV 97

Query: 62  VCCG 65
           V  G
Sbjct: 98  VMLG 101

>Scas_536.8
          Length = 175

 Score = 30.0 bits (66), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 16/64 (25%), Positives = 34/64 (53%), Gaps = 7/64 (10%)

Query: 9   LNKRIVIITTEGQCVTATLEGFDKSTNLLLSNVRERV---SGDVVASS----YLMRGNQV 61
           ++++I ++  +G+ +   L  FD+  NL+L +  ER+     +  A +    +++RG  V
Sbjct: 53  VDRKIFVLLRDGKLLFGILRTFDQYANLILQHCVERIYLTEENKYAENELGIFMIRGENV 112

Query: 62  VCCG 65
           V  G
Sbjct: 113 VMLG 116

>Kwal_34.16168
          Length = 88

 Score = 28.9 bits (63), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 21/39 (53%)

Query: 5  LKDFLNKRIVIITTEGQCVTATLEGFDKSTNLLLSNVRE 43
          + D++   I +  T+G+ +  T+   D   NLLL NV E
Sbjct: 6  IPDYIGSSIYVTVTKGRLLAGTMVATDSQLNLLLDNVEE 44

>YJL124C (LSM1) [2795] chr10 complement(187046..187564) Protein of
           the Sm class of RNA-binding proteins involved in control
           of mRNA decay, involved in sensitivity to UV irradiation
           [519 bp, 172 aa]
          Length = 172

 Score = 29.6 bits (65), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 15/64 (23%), Positives = 32/64 (50%), Gaps = 7/64 (10%)

Query: 9   LNKRIVIITTEGQCVTATLEGFDKSTNLLLSNVRERV-------SGDVVASSYLMRGNQV 61
           ++++I ++  +G+ +   L  FD+  NL+L +  ER+         +     +++RG  V
Sbjct: 50  VDRKIFVLLRDGRMLFGVLRTFDQYANLILQDCVERIYFSEENKYAEEDRGIFMIRGENV 109

Query: 62  VCCG 65
           V  G
Sbjct: 110 VMLG 113

>KLLA0D09284g 782856..783188 similar to sp|Q06217 Saccharomyces
           cerevisiae YLR275w SMD2 U1 snRNP protein of the Sm class
           singleton, start by similarity
          Length = 110

 Score = 28.9 bits (63), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 36/74 (48%), Gaps = 10/74 (13%)

Query: 1   MSPLLKDFLNKRIVIIT-TEGQCVTATLEGFDKSTNLLLSNVRE---------RVSGDVV 50
           MS + +  L +  VII+      + A ++ FDK  N++L NV+E         +V+ +  
Sbjct: 34  MSLIRESMLQRTPVIISLRNNHKLIARVKSFDKHCNMVLENVKEIWTENVNGKKVNRERF 93

Query: 51  ASSYLMRGNQVVCC 64
            +   +RG+ V+  
Sbjct: 94  VAKLFLRGDSVIIV 107

>Kwal_47.19051
          Length = 210

 Score = 29.3 bits (64), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 24/49 (48%), Gaps = 1/49 (2%)

Query: 5   LKDFLNKRIVIITTEGQCVTATLEGFDKSTNLLLSN-VRERVSGDVVAS 52
           L D L+ RI  +T +G+     L  FD   NL+L+  V  R+    + S
Sbjct: 56  LADLLHFRIRAVTNDGKAFVGELMAFDAHMNLVLAECVEHRIPATQMES 104

>KLLA0B05203g 469929..470180 similar to sp|P57743 Saccharomyces
          cerevisiae YLR438ca SMX4 Sm-like (Lsm) protein
          singleton, start by similarity
          Length = 83

 Score = 27.7 bits (60), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 13/42 (30%), Positives = 26/42 (61%)

Query: 4  LLKDFLNKRIVIITTEGQCVTATLEGFDKSTNLLLSNVRERV 45
          LLK  L++R+ +   + + +  TL+ FD   N++LS+ +E +
Sbjct: 8  LLKLNLDERVYVKLRDARELVGTLQAFDSHCNIVLSDSKETI 49

>KLLA0D07678g 660221..660436 similar to sp|P40204 Saccharomyces
          cerevisiae YFL017wa SNP2 snRNP G protein (the homologue
          of the human Sm-G) singleton, start by similarity
          Length = 71

 Score = 26.9 bits (58), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 15/59 (25%), Positives = 33/59 (55%), Gaps = 2/59 (3%)

Query: 6  KDFLNKRIVIITTEGQCVTATLEGFDKSTNLLLSN-VRERVSGDV-VASSYLMRGNQVV 62
          K +++K++++     + +   L G+D   NL+L N ++    G+V +    ++RGN +V
Sbjct: 5  KQYMDKKLILQLNGNRKIIGILRGYDAFLNLVLDNPIQIFEEGEVQMGPQTVVRGNSIV 63

>Scas_719.59
          Length = 84

 Score = 26.9 bits (58), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 37/75 (49%), Gaps = 9/75 (12%)

Query: 4  LLKDFLNKRIVIITTEGQCVTATLEGFDKSTNLLLSNVRERV----SGDVVASS-----Y 54
          LLK  L++++ +     + +T TL+ FD   N++LS+  E +     GD+ ++       
Sbjct: 9  LLKLNLDEKVYVKLRGARSLTGTLQAFDSHCNIVLSDAVETIYELEDGDLKSTERQSEMI 68

Query: 55 LMRGNQVVCCGLLEE 69
           +RG+ V      EE
Sbjct: 69 FVRGDTVTLITTPEE 83

>YLR438C-A (LSM3) [3813] chr12 complement(1013905..1014174) U6
          snRNA-associated protein of the Sm-like group [270 bp,
          89 aa]
          Length = 89

 Score = 26.6 bits (57), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 24/42 (57%)

Query: 4  LLKDFLNKRIVIITTEGQCVTATLEGFDKSTNLLLSNVRERV 45
          LLK  L++R+ I     + +  TL+ FD   N++LS+  E +
Sbjct: 7  LLKLNLDERVYIKLRGARTLVGTLQAFDSHCNIVLSDAVETI 48

>Kwal_56.23289
          Length = 79

 Score = 26.6 bits (57), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 13/59 (22%), Positives = 28/59 (47%), Gaps = 9/59 (15%)

Query: 13 IVIITTEGQCVTATLEGFDKSTNLLLSNVRE---------RVSGDVVASSYLMRGNQVV 62
          ++I       + A ++ FD+  N++L NV+E          V+ +   S   +RG+ ++
Sbjct: 14 VIISLRNNHKIIARVKAFDRHCNMVLENVKELWTEKQNKKTVNRERFISKLFLRGDSII 72

>ADR373W [2114] [Homologous to ScYAL035W (FUN12) - SH]
           complement(1369501..1372389) [2889 bp, 962 aa]
          Length = 962

 Score = 27.3 bits (59), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 21/40 (52%), Gaps = 12/40 (30%)

Query: 27  LEGFDKSTNLLLSNVRERVSGDVVASSYLMRGNQVVCCGL 66
           +EGF  + +++LSN             YL  G+++V CGL
Sbjct: 600 IEGFGTTIDIILSN------------GYLREGDRIVLCGL 627

>CAGL0F04961g join(506566..506570,506700..507027) highly similar to
           sp|Q06217 Saccharomyces cerevisiae YLR275w SMD2 U1 snRNP
           protein of the Sm class
          Length = 110

 Score = 26.6 bits (57), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 14/60 (23%), Positives = 28/60 (46%), Gaps = 9/60 (15%)

Query: 13  IVIITTEGQCVTATLEGFDKSTNLLLSNVRE---------RVSGDVVASSYLMRGNQVVC 63
           ++I       + A ++ FD+  NL+L NV+E          ++ +   S   +RG+ V+ 
Sbjct: 44  VIISLRNNHKLIARVKAFDRHCNLVLENVKELWTEKKNKQTINRERFISKLFLRGDSVIV 103

>AER125C [2629] [Homologous to ScYLR438C-A (LSM3) - SH]
          (877996..878247) [252 bp, 83 aa]
          Length = 83

 Score = 26.2 bits (56), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 12/42 (28%), Positives = 25/42 (59%)

Query: 4  LLKDFLNKRIVIITTEGQCVTATLEGFDKSTNLLLSNVRERV 45
          LL+  L++R+ +     + ++ TL+ FD   N++LS+  E +
Sbjct: 8  LLRLNLDERVYVKLRGARKLSGTLQAFDSHCNIVLSDAEETI 49

>YOR108W (LEU9) [4911] chr15 (523027..524841) Alpha-isopropylmalate
           synthase II [1815 bp, 604 aa]
          Length = 604

 Score = 27.3 bits (59), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 20/33 (60%)

Query: 66  LLEEAEGLGPDLTSDTVYTELKDTKNYVRDEHL 98
           L + A+ LG +L S+ +    K+T NY  +EH+
Sbjct: 445 LQKNADALGRELKSEEITKLFKETYNYNNNEHI 477

>Sklu_2241.2 YLR438C-A, Contig c2241 833-1084
          Length = 83

 Score = 26.2 bits (56), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 36/67 (53%), Gaps = 9/67 (13%)

Query: 4  LLKDFLNKRIVIITTEGQCVTATLEGFDKSTNLLLSN----VRERVSGDVVASS-----Y 54
          LLK  L++++ +     + +  TL+ FD   N++LSN    V E V G++ ++S      
Sbjct: 9  LLKLNLDEKVYVKLRGARELIGTLQAFDSHCNIVLSNATETVYELVDGELKSTSRNSEMI 68

Query: 55 LMRGNQV 61
           +RG+ V
Sbjct: 69 FVRGDTV 75

>KLLA0E20889g 1856387..1856938 gi|15072878|emb|CAC48005.1
          Kluyveromyces lactis hypothetical protein, start by
          similarity
          Length = 183

 Score = 26.6 bits (57), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 26/51 (50%), Gaps = 1/51 (1%)

Query: 20 GQCVTATLEGFDKSTNLLLSNVRERVSGDVVA-SSYLMRGNQVVCCGLLEE 69
          G+ V  TL   D   NL LSNV    SG+ +   S+ ++G+ +    L ++
Sbjct: 22 GETVEGTLSDVDNWMNLTLSNVTHVASGETLKLPSFYLKGSFIKYVNLQDD 72

>YER029C (SMB1) [1454] chr5 complement(212586..213176)
          Spliceosomal snRNA-associated Sm core protein, also
          likely associated with telomerase TLC1 RNA [591 bp, 196
          aa]
          Length = 196

 Score = 26.6 bits (57), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 13/42 (30%), Positives = 25/42 (59%), Gaps = 1/42 (2%)

Query: 5  LKDFLNKRIVIITTEGQCVTATLEGFDKSTNLLLSN-VRERV 45
          L + ++ ++ ++T +G+     L  FDK  NL+L+  + ERV
Sbjct: 12 LANLIDYKLRVLTQDGRVYIGQLMAFDKHMNLVLNECIEERV 53

>Scas_589.4
          Length = 530

 Score = 26.2 bits (56), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 12/38 (31%), Positives = 20/38 (52%)

Query: 17  TTEGQCVTATLEGFDKSTNLLLSNVRERVSGDVVASSY 54
           T   + ++  L+GFD    +L+ +  +  S DVV S Y
Sbjct: 284 TKNNEVLSKVLQGFDFDKPMLVDDEDDEGSADVVMSDY 321

>Scas_697.20*
          Length = 118

 Score = 25.4 bits (54), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 11/39 (28%), Positives = 23/39 (58%)

Query: 5  LKDFLNKRIVIITTEGQCVTATLEGFDKSTNLLLSNVRE 43
          L  + + ++ +    G+ V+ TL+G+D+  NL+L +  E
Sbjct: 31 LSKYKDSKVRVKLMGGKLVSGTLKGYDQLMNLVLDDTIE 69

>Kwal_27.12727
          Length = 536

 Score = 25.8 bits (55), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 32/69 (46%), Gaps = 4/69 (5%)

Query: 33  STNLLLSNVRERVSGDVVASSYLMRGNQVVCCGLLEEAEGLGPDLTSDTVYTELKDTKNY 92
           S N  L +V+ RV    V S       +++  GL+  A+ L  DL + +V   L DT   
Sbjct: 228 SLNHFLYSVQRRV----VISYINADSEEILSSGLIFSADSLSFDLGNSSVSCPLTDTTAL 283

Query: 93  VRDEHLIWQ 101
            +  ++ W+
Sbjct: 284 TKRSNMSWR 292

>KLLA0E10791g 951335..953896 weakly similar to sp|P48237
           Saccharomyces cerevisiae YGR150c singleton, hypothetical
           start
          Length = 853

 Score = 25.8 bits (55), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 12/41 (29%), Positives = 23/41 (56%)

Query: 7   DFLNKRIVIITTEGQCVTATLEGFDKSTNLLLSNVRERVSG 47
           D L ++ VI   E + V   +  FD    ++LS++ ++V+G
Sbjct: 82  DELKRKHVIEEEETKSVDPEMHDFDSDAGVILSSLNDKVAG 122

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.133    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 3,527,504
Number of extensions: 126431
Number of successful extensions: 403
Number of sequences better than 10.0: 47
Number of HSP's gapped: 396
Number of HSP's successfully gapped: 47
Length of query: 110
Length of database: 16,596,109
Length adjustment: 80
Effective length of query: 30
Effective length of database: 13,826,669
Effective search space: 414800070
Effective search space used: 414800070
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 54 (25.4 bits)